| Basic Information | |
|---|---|
| Family ID | F049382 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MAWSLGLVGGCLILIALLAVYVPTIYIRKTNKVIGLLEKIEANTRK |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.77 % |
| % of genes near scaffold ends (potentially truncated) | 26.03 % |
| % of genes from short scaffolds (< 2000 bps) | 67.12 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.918 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (26.027 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.233 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.671 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF01966 | HD | 5.48 |
| PF03737 | RraA-like | 3.42 |
| PF14378 | PAP2_3 | 2.05 |
| PF13519 | VWA_2 | 1.37 |
| PF00581 | Rhodanese | 1.37 |
| PF03631 | Virul_fac_BrkB | 1.37 |
| PF07690 | MFS_1 | 1.37 |
| PF00324 | AA_permease | 0.68 |
| PF01676 | Metalloenzyme | 0.68 |
| PF08359 | TetR_C_4 | 0.68 |
| PF01547 | SBP_bac_1 | 0.68 |
| PF00482 | T2SSF | 0.68 |
| PF17128 | DUF5107 | 0.68 |
| PF14534 | DUF4440 | 0.68 |
| PF00146 | NADHdh | 0.68 |
| PF13520 | AA_permease_2 | 0.68 |
| PF01613 | Flavin_Reduct | 0.68 |
| PF00753 | Lactamase_B | 0.68 |
| PF13487 | HD_5 | 0.68 |
| PF00881 | Nitroreductase | 0.68 |
| PF02643 | DUF192 | 0.68 |
| PF13231 | PMT_2 | 0.68 |
| PF02781 | G6PD_C | 0.68 |
| PF00561 | Abhydrolase_1 | 0.68 |
| PF17115 | Toast_rack_N | 0.68 |
| PF00188 | CAP | 0.68 |
| PF04471 | Mrr_cat | 0.68 |
| PF13432 | TPR_16 | 0.68 |
| PF13857 | Ank_5 | 0.68 |
| PF01564 | Spermine_synth | 0.68 |
| PF02663 | FmdE | 0.68 |
| PF07811 | TadE | 0.68 |
| PF01041 | DegT_DnrJ_EryC1 | 0.68 |
| PF16976 | RcpC | 0.68 |
| PF01451 | LMWPc | 0.68 |
| PF13701 | DDE_Tnp_1_4 | 0.68 |
| PF07722 | Peptidase_C26 | 0.68 |
| PF08533 | Glyco_hydro_42C | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF03447 | NAD_binding_3 | 0.68 |
| PF01408 | GFO_IDH_MocA | 0.68 |
| PF13400 | Tad | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 3.42 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.37 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.68 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.68 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.68 |
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 0.68 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.68 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.68 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.68 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.68 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.68 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.68 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.68 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.68 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.68 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.68 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.68 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.68 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.68 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.68 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.92 % |
| Unclassified | root | N/A | 28.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100625572 | Not Available | 880 | Open in IMG/M |
| 3300004631|Ga0058899_12155975 | Not Available | 560 | Open in IMG/M |
| 3300005538|Ga0070731_10019548 | All Organisms → cellular organisms → Bacteria | 4720 | Open in IMG/M |
| 3300009038|Ga0099829_10061320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2822 | Open in IMG/M |
| 3300009038|Ga0099829_10074776 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
| 3300009088|Ga0099830_10000252 | All Organisms → cellular organisms → Bacteria | 21828 | Open in IMG/M |
| 3300009518|Ga0116128_1063456 | Not Available | 1140 | Open in IMG/M |
| 3300009519|Ga0116108_1151994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 687 | Open in IMG/M |
| 3300009548|Ga0116107_1011214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3807 | Open in IMG/M |
| 3300009549|Ga0116137_1020418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2472 | Open in IMG/M |
| 3300009549|Ga0116137_1112113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300009616|Ga0116111_1068234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 968 | Open in IMG/M |
| 3300009621|Ga0116116_1109490 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009634|Ga0116124_1214288 | Not Available | 535 | Open in IMG/M |
| 3300009637|Ga0116118_1264445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 525 | Open in IMG/M |
| 3300009639|Ga0116122_1263008 | Not Available | 533 | Open in IMG/M |
| 3300009839|Ga0116223_10091103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1936 | Open in IMG/M |
| 3300010379|Ga0136449_103854092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 563 | Open in IMG/M |
| 3300011078|Ga0138565_1055590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 549 | Open in IMG/M |
| 3300012201|Ga0137365_11121727 | Not Available | 566 | Open in IMG/M |
| 3300012361|Ga0137360_10935322 | Not Available | 748 | Open in IMG/M |
| 3300014151|Ga0181539_1057527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1789 | Open in IMG/M |
| 3300014152|Ga0181533_1022785 | Not Available | 3927 | Open in IMG/M |
| 3300014152|Ga0181533_1032720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2981 | Open in IMG/M |
| 3300014155|Ga0181524_10272089 | Not Available | 785 | Open in IMG/M |
| 3300014156|Ga0181518_10401978 | Not Available | 662 | Open in IMG/M |
| 3300014164|Ga0181532_10363401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300014491|Ga0182014_10423978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → unclassified Candidatus Eremiobacteraeota → Candidatus Eremiobacteraeota bacterium | 660 | Open in IMG/M |
| 3300014496|Ga0182011_10001455 | All Organisms → cellular organisms → Bacteria | 20733 | Open in IMG/M |
| 3300014638|Ga0181536_10159643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300016445|Ga0182038_10813151 | Not Available | 820 | Open in IMG/M |
| 3300016750|Ga0181505_10790524 | Not Available | 623 | Open in IMG/M |
| 3300017822|Ga0187802_10019599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 2313 | Open in IMG/M |
| 3300017822|Ga0187802_10041899 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300017823|Ga0187818_10153490 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300017823|Ga0187818_10197206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 879 | Open in IMG/M |
| 3300017823|Ga0187818_10206067 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300017925|Ga0187856_1017275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3811 | Open in IMG/M |
| 3300017927|Ga0187824_10138103 | Not Available | 802 | Open in IMG/M |
| 3300017927|Ga0187824_10353109 | Not Available | 531 | Open in IMG/M |
| 3300017929|Ga0187849_1073545 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300017930|Ga0187825_10225351 | Not Available | 681 | Open in IMG/M |
| 3300017932|Ga0187814_10104915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1044 | Open in IMG/M |
| 3300017933|Ga0187801_10033677 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300017934|Ga0187803_10001401 | All Organisms → cellular organisms → Bacteria | 9483 | Open in IMG/M |
| 3300017934|Ga0187803_10010789 | Not Available | 3649 | Open in IMG/M |
| 3300017934|Ga0187803_10477437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 509 | Open in IMG/M |
| 3300017935|Ga0187848_10434108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 539 | Open in IMG/M |
| 3300017941|Ga0187850_10245675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 806 | Open in IMG/M |
| 3300017942|Ga0187808_10073881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1464 | Open in IMG/M |
| 3300017946|Ga0187879_10359723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300017955|Ga0187817_10488449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 786 | Open in IMG/M |
| 3300017961|Ga0187778_10357132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 953 | Open in IMG/M |
| 3300017972|Ga0187781_10001104 | All Organisms → cellular organisms → Bacteria | 20259 | Open in IMG/M |
| 3300017972|Ga0187781_10004763 | All Organisms → cellular organisms → Bacteria | 10096 | Open in IMG/M |
| 3300017972|Ga0187781_10008715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 7347 | Open in IMG/M |
| 3300017972|Ga0187781_10037863 | All Organisms → cellular organisms → Bacteria | 3323 | Open in IMG/M |
| 3300017972|Ga0187781_10044345 | All Organisms → cellular organisms → Bacteria | 3059 | Open in IMG/M |
| 3300017972|Ga0187781_10298830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1142 | Open in IMG/M |
| 3300017972|Ga0187781_11082095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 588 | Open in IMG/M |
| 3300017973|Ga0187780_10668366 | Not Available | 748 | Open in IMG/M |
| 3300017975|Ga0187782_10053205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2947 | Open in IMG/M |
| 3300017975|Ga0187782_10057990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2818 | Open in IMG/M |
| 3300017975|Ga0187782_10162459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1665 | Open in IMG/M |
| 3300017975|Ga0187782_10326617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1159 | Open in IMG/M |
| 3300017993|Ga0187823_10144513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 746 | Open in IMG/M |
| 3300017994|Ga0187822_10200858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 665 | Open in IMG/M |
| 3300017995|Ga0187816_10047358 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300018004|Ga0187865_1025976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2639 | Open in IMG/M |
| 3300018004|Ga0187865_1036561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2082 | Open in IMG/M |
| 3300018009|Ga0187884_10408770 | Not Available | 546 | Open in IMG/M |
| 3300018017|Ga0187872_10204980 | Not Available | 908 | Open in IMG/M |
| 3300018021|Ga0187882_1278961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 643 | Open in IMG/M |
| 3300018022|Ga0187864_10122652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1320 | Open in IMG/M |
| 3300018025|Ga0187885_10335059 | Not Available | 682 | Open in IMG/M |
| 3300018057|Ga0187858_10194223 | Not Available | 1328 | Open in IMG/M |
| 3300018062|Ga0187784_10283625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1346 | Open in IMG/M |
| 3300018062|Ga0187784_10441319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1051 | Open in IMG/M |
| 3300018062|Ga0187784_10909679 | Not Available | 700 | Open in IMG/M |
| 3300018085|Ga0187772_11323356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 533 | Open in IMG/M |
| 3300018086|Ga0187769_10092633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2162 | Open in IMG/M |
| 3300018086|Ga0187769_10094600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2140 | Open in IMG/M |
| 3300018086|Ga0187769_10236779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1356 | Open in IMG/M |
| 3300018086|Ga0187769_10260999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1290 | Open in IMG/M |
| 3300018086|Ga0187769_10634668 | Not Available | 807 | Open in IMG/M |
| 3300018086|Ga0187769_10807064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 709 | Open in IMG/M |
| 3300018088|Ga0187771_10036393 | All Organisms → cellular organisms → Bacteria | 3777 | Open in IMG/M |
| 3300018088|Ga0187771_10114985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2182 | Open in IMG/M |
| 3300018088|Ga0187771_10119745 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin179 | 2139 | Open in IMG/M |
| 3300018088|Ga0187771_10156746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1874 | Open in IMG/M |
| 3300018088|Ga0187771_10333177 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300018088|Ga0187771_10470398 | Not Available | 1062 | Open in IMG/M |
| 3300018088|Ga0187771_10491501 | Not Available | 1038 | Open in IMG/M |
| 3300018088|Ga0187771_11246882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 631 | Open in IMG/M |
| 3300018088|Ga0187771_11385579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 596 | Open in IMG/M |
| 3300018088|Ga0187771_11388739 | Not Available | 596 | Open in IMG/M |
| 3300018090|Ga0187770_10100500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2158 | Open in IMG/M |
| 3300018090|Ga0187770_10107509 | Not Available | 2089 | Open in IMG/M |
| 3300018090|Ga0187770_10127851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1921 | Open in IMG/M |
| 3300018090|Ga0187770_10274826 | Not Available | 1308 | Open in IMG/M |
| 3300018090|Ga0187770_11640926 | Not Available | 525 | Open in IMG/M |
| 3300019082|Ga0187852_1393623 | Not Available | 541 | Open in IMG/M |
| 3300019264|Ga0187796_1232535 | Not Available | 544 | Open in IMG/M |
| 3300019275|Ga0187798_1778897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 929 | Open in IMG/M |
| 3300019284|Ga0187797_1063859 | Not Available | 551 | Open in IMG/M |
| 3300023088|Ga0224555_1006023 | All Organisms → cellular organisms → Bacteria | 9726 | Open in IMG/M |
| 3300025442|Ga0208034_1050075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 870 | Open in IMG/M |
| 3300025460|Ga0208562_1034755 | Not Available | 1151 | Open in IMG/M |
| 3300026551|Ga0209648_10037864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4183 | Open in IMG/M |
| 3300027825|Ga0209039_10040539 | Not Available | 2171 | Open in IMG/M |
| 3300027846|Ga0209180_10306363 | Not Available | 910 | Open in IMG/M |
| 3300027854|Ga0209517_10125405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → unclassified Chthonomonadales → Chthonomonadales bacterium | 1682 | Open in IMG/M |
| 3300027862|Ga0209701_10001879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13617 | Open in IMG/M |
| 3300027862|Ga0209701_10025263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3863 | Open in IMG/M |
| 3300027896|Ga0209777_10659116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 750 | Open in IMG/M |
| 3300030659|Ga0316363_10436512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 505 | Open in IMG/M |
| 3300031720|Ga0307469_10012439 | All Organisms → cellular organisms → Bacteria | 4259 | Open in IMG/M |
| 3300031862|Ga0315280_10293031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → unclassified Chthonomonadales → Chthonomonadales bacterium | 822 | Open in IMG/M |
| 3300032180|Ga0307471_104163164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 511 | Open in IMG/M |
| 3300032805|Ga0335078_11240091 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300033158|Ga0335077_11406309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 672 | Open in IMG/M |
| 3300033158|Ga0335077_11632520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 612 | Open in IMG/M |
| 3300033402|Ga0326728_10000198 | All Organisms → cellular organisms → Bacteria | 251154 | Open in IMG/M |
| 3300033402|Ga0326728_10002094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 67767 | Open in IMG/M |
| 3300033402|Ga0326728_10002223 | All Organisms → cellular organisms → Bacteria | 65449 | Open in IMG/M |
| 3300033402|Ga0326728_10006138 | All Organisms → cellular organisms → Bacteria | 32795 | Open in IMG/M |
| 3300033402|Ga0326728_10017112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14611 | Open in IMG/M |
| 3300033402|Ga0326728_10065443 | All Organisms → cellular organisms → Bacteria | 4939 | Open in IMG/M |
| 3300033402|Ga0326728_10373574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1238 | Open in IMG/M |
| 3300033402|Ga0326728_10481421 | Not Available | 1017 | Open in IMG/M |
| 3300033402|Ga0326728_10485505 | Not Available | 1011 | Open in IMG/M |
| 3300033402|Ga0326728_10501655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300033402|Ga0326728_10586257 | Not Available | 874 | Open in IMG/M |
| 3300033402|Ga0326728_10727272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 739 | Open in IMG/M |
| 3300033405|Ga0326727_10938825 | Not Available | 641 | Open in IMG/M |
| 3300033561|Ga0371490_1002435 | All Organisms → cellular organisms → Bacteria | 8624 | Open in IMG/M |
| 3300033977|Ga0314861_0000129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 129003 | Open in IMG/M |
| 3300033977|Ga0314861_0000367 | All Organisms → cellular organisms → Bacteria | 75207 | Open in IMG/M |
| 3300033977|Ga0314861_0000953 | All Organisms → cellular organisms → Bacteria | 41118 | Open in IMG/M |
| 3300033977|Ga0314861_0001093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 37694 | Open in IMG/M |
| 3300033977|Ga0314861_0005766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10197 | Open in IMG/M |
| 3300033977|Ga0314861_0013037 | All Organisms → cellular organisms → Bacteria | 5703 | Open in IMG/M |
| 3300033977|Ga0314861_0292285 | Not Available | 737 | Open in IMG/M |
| 3300033977|Ga0314861_0462931 | Not Available | 548 | Open in IMG/M |
| 3300033983|Ga0371488_0292895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 782 | Open in IMG/M |
| 3300034091|Ga0326724_0284668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 26.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 12.33% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 10.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 8.22% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 7.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.68% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1006255721 | 3300004152 | Bog Forest Soil | MAWSLGLVGGCLILIALLAVYVPTIYIRKTDKVIGLLEKIEANTRK* |
| Ga0058899_121559751 | 3300004631 | Forest Soil | MWSLAMTGGAVVVIALLAAYVPTIYIRKTNKVLRVLEQIASNTQH* |
| Ga0070731_100195485 | 3300005538 | Surface Soil | MEWSFALTVGCTVLIALLAIYVPTIYIRKTNKIINLLEQIQANTRK* |
| Ga0099829_100613202 | 3300009038 | Vadose Zone Soil | MEWSFALVGASLVLVALLAVYVPTIYIRKTNKVIALLEQIAANTKK* |
| Ga0099829_100747762 | 3300009038 | Vadose Zone Soil | MWPVGLLGGCAVLVALLAAYVPLIYIRKTNKVLKVLEQIEVNTRK* |
| Ga0099830_1000025217 | 3300009088 | Vadose Zone Soil | MWPVALLSACAVLVALLAAYVPSIYIRKTNKVLKLLEQIEANTRK* |
| Ga0116128_10634562 | 3300009518 | Peatland | LPEVSMAWSLGLIGGCVILLALLAVYVPTIYMRKTDKVIGLLEKIEANTRK* |
| Ga0116108_11519942 | 3300009519 | Peatland | MAWSLGLVGGCVILLALLAVYVPTIYIRKTNKLIELLEKIEANTRK* |
| Ga0116107_10112143 | 3300009548 | Peatland | MAWSLGLIGGCVILLALLAVYVPTIYMRKTDKVIGLLEKIEANTRK* |
| Ga0116137_10204183 | 3300009549 | Peatland | MAWSLGLVGGCLILIALLAVYVPTIYIRKTNKVIGLLEKIEANTRK* |
| Ga0116137_11121131 | 3300009549 | Peatland | MAWPLGLVGGCLILIALLAVYVPTIYIRKTDKILKLLEKIEANTRK* |
| Ga0116111_10682341 | 3300009616 | Peatland | PFLAEVSMAWSLGLVGGCVILLALLAVYVPTIYIRKTNKLIELLEKIEANTRK* |
| Ga0116116_11094902 | 3300009621 | Peatland | MAWSLGLVGGCVILLALLAVYAPTIYIRKTNKLIELLEKIEANTRK* |
| Ga0116124_12142881 | 3300009634 | Peatland | YPFLPEVSMAWSLGLIGGCVILLALLAVYVPTIYMRKMDKVIGLLEKIEANTRK* |
| Ga0116118_12644451 | 3300009637 | Peatland | MPWSLSMIGGCVILIALLAVYVPTIYIRKTNKLIELLEKIEANTRK* |
| Ga0116122_12630082 | 3300009639 | Peatland | MGWPLGLVGACLILIALLAVYVPTIYIRKTDKVLKLLEKIEANTRK* |
| Ga0116223_100911032 | 3300009839 | Peatlands Soil | MAWSVAYVGGGIIVVALLAIYVPTIYIRKTNKLLAVLEKIEANTRK* |
| Ga0136449_1038540921 | 3300010379 | Peatlands Soil | FLPEVSMAWSLAFVGGGIIIVALLAIYVPTIYIRKTNKLITLLEKIEANTRK* |
| Ga0138565_10555901 | 3300011078 | Peatlands Soil | PFLAEVSMAWSVAYVGGGIIVVALLAIYVPTIYIRKTNKLLAVLEKIEANTRK* |
| Ga0137365_111217271 | 3300012201 | Vadose Zone Soil | MWSFALFGGCIVLIALLAVYVPTIYIRKTNKLLKALEQ |
| Ga0137360_109353222 | 3300012361 | Vadose Zone Soil | MWSFALLGGCVVVIALLAAYVPTIYIRKTNKLIATLEQIADNTAEA |
| Ga0181539_10575272 | 3300014151 | Bog | MAWSLGLIGGCVILLALLAVYVPTIYIRKTNRLIGLLEKIEANTRK* |
| Ga0181533_10227852 | 3300014152 | Bog | MAWPLALAWGSLIVVALVAIYVPTVYIRKTNKLIELLQKIEVNTRK* |
| Ga0181533_10327204 | 3300014152 | Bog | MVLFLVLAWGSLVLVALLAVYVPTVYIRKTNKLIVLLEKIEANTRK* |
| Ga0181524_102720892 | 3300014155 | Bog | MAWELGLVGGCLILIALLSVYVPTIYIRKTDKVIGLLEKIEANTRK* |
| Ga0181518_104019782 | 3300014156 | Bog | GLIGGCVILLALLAVYVPTIYMRKTDKVIGLLEKIEANTRK* |
| Ga0181532_103634012 | 3300014164 | Bog | MAWTFALVGGCVVVIALLALYVPTIYIRDTRKVIQLLEKIEANTRK* |
| Ga0182014_104239781 | 3300014491 | Bog | MVWSLAVAWGGLIVVALMAVYVPTIYIRKTNKLIGLLEK |
| Ga0182011_1000145513 | 3300014496 | Fen | MVWSLAVAWGGLIVVALMAVYVPTIYIRKTNKLIGLLEKIEANTRK* |
| Ga0181536_101596432 | 3300014638 | Bog | SIFLLTEVPMVLFLVLAWGSLVLVALLAVYVPTVYIRKTNKLIVLLEKIEANTRK* |
| Ga0182038_108131512 | 3300016445 | Soil | MNSWPFALVGGCVMLIALLAVYVPTIYIRKTNRVIKILEQIEANTRK |
| Ga0181505_107905242 | 3300016750 | Peatland | EANMAWTFALVGGCVVVIALLALYVPTIYIRDTRKVIQLLEKIEANTRK |
| Ga0187802_100195993 | 3300017822 | Freshwater Sediment | MTWTWWSIGMVGGTVVLIGLLGIYFPTIYIRKTNKVMGLLERIEANTRK |
| Ga0187802_100418992 | 3300017822 | Freshwater Sediment | MEWSFAMIGGAIVLVALLAVYVPTVYIRKTNKLLAVLEKIEANTHK |
| Ga0187818_101534901 | 3300017823 | Freshwater Sediment | MAWNVAMLGAALVVVALLAIYVPTIYIRKTNKLIGLLEKIEANTHK |
| Ga0187818_101972062 | 3300017823 | Freshwater Sediment | MQWSFALVGGCIIFIALLAVYVPTIYIRKTNKVLKLLEKIEANTRK |
| Ga0187818_102060672 | 3300017823 | Freshwater Sediment | MAWALAYVGGGIVMVALLAIYVPTIYIRKTNKLIGLLERIEANTRK |
| Ga0187856_10172758 | 3300017925 | Peatland | MAWSLGLIGGCVILLALLAVYVPTIYMRKTDKVIGLLEKIEANTRK |
| Ga0187824_101381032 | 3300017927 | Freshwater Sediment | VAMSLWPFSLIGGWVVVVTLLAIYVPTIYIRRTNKILKLLEQIEANTRK |
| Ga0187824_103531092 | 3300017927 | Freshwater Sediment | MWPVGLLGGCAVLIALMSAYAPLIYIRKTNKVLKVLEQIEANTRK |
| Ga0187849_10735452 | 3300017929 | Peatland | MAWSLGLVGGCVILLALLAVYVPTIYIRKTNKLIELLEKIEANTRK |
| Ga0187825_102253512 | 3300017930 | Freshwater Sediment | MSLWPFSLIGGWVVVVTLLAIYVPTIYIRRTNKILKLLEQIEANTRK |
| Ga0187814_101049152 | 3300017932 | Freshwater Sediment | MWPIGLVGACVFLVALLAVYVPTIYIRKTNKITKILEQIEANTRKS |
| Ga0187801_100336773 | 3300017933 | Freshwater Sediment | MEWSFAMIGGAIVLVALLAVYVPTVYIRKTNKLIGLLEKIEANTR |
| Ga0187803_1000140110 | 3300017934 | Freshwater Sediment | MQWPFAFVGGCIIFIALLAVYVPTIYIRKTNKVLKLLEKIEANTRK |
| Ga0187803_100107891 | 3300017934 | Freshwater Sediment | MGWSLGLVGACVILIALLAIYVPTIYIRKTDKVIRLLEKIEANTRK |
| Ga0187803_104774371 | 3300017934 | Freshwater Sediment | MAWPLALVGGCVVLLALLVIYVPTIYIRKTNKVIGLLEKIEANTRK |
| Ga0187848_104341081 | 3300017935 | Peatland | MAWSLALVGGCVILLALLAVYVPTIYIRKTNKLIELLEKIEANTRK |
| Ga0187850_102456751 | 3300017941 | Peatland | MAWALAYVGGGIVMVVLLAIYVPTIYIRKTNKLIALLEKIEANTRK |
| Ga0187808_100738811 | 3300017942 | Freshwater Sediment | MVGGTVVLIGLLGIYFPTIYIRKTNKVMGLLERIEANTRK |
| Ga0187879_103597232 | 3300017946 | Peatland | MAWTFALVGGCVVVIALLALYVPTIYIRDTRKVIQLLEKIEANTRK |
| Ga0187817_104884491 | 3300017955 | Freshwater Sediment | FVGGGIIVVALLAIYVPTIYIRKTNKLVVLLEKIEANTRK |
| Ga0187778_103571321 | 3300017961 | Tropical Peatland | MAWSLALVGGCVVLLALLVIYVPTIYIRKTNKVIGLLEKIEANTRK |
| Ga0187781_100011045 | 3300017972 | Tropical Peatland | MAWSVTMLAAGVIVVALLAIYVPTIYIRKTNKLINLLEKIEANTHK |
| Ga0187781_100047639 | 3300017972 | Tropical Peatland | MTWTWWSIGMVGGAVILIGLLGVYFPTIYIRKTNKVMRLLERIEANTRK |
| Ga0187781_100087156 | 3300017972 | Tropical Peatland | MAWSVAVVGGALVAVALLAVYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0187781_100378634 | 3300017972 | Tropical Peatland | MEWSIALVAGAIVLVALLAIYVPTVYIRKTNKLIAILEKIEANTHK |
| Ga0187781_100443453 | 3300017972 | Tropical Peatland | MAWSVALLGGALVAVALLAIYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0187781_102988301 | 3300017972 | Tropical Peatland | MANSLGLIGACVVLVALLAIYVPTIYIRKTNKLLDYLQKIEANTRK |
| Ga0187781_110820952 | 3300017972 | Tropical Peatland | MAWSLAFVGGGIIVVALLAIYVPTIYIRKTNKLVELLEKIEANTRK |
| Ga0187780_106683663 | 3300017973 | Tropical Peatland | MAWPLGLMGGCVIVIALLAIYVPTIYIRKTDKILALLEKIEANTRK |
| Ga0187782_100532052 | 3300017975 | Tropical Peatland | MAWSVALLGGALIVIALQAIYVPTVYIRKTNKVIDVLNRIEANTRK |
| Ga0187782_100579904 | 3300017975 | Tropical Peatland | MAWSVALLGGALIVIALQAIYVPTVYIRKTNKVIEVLNKIEANTRK |
| Ga0187782_101624591 | 3300017975 | Tropical Peatland | MAWSLTMLGAAFIVVALLAIYVPTIYIRKTNKLIALLEKIEANTHKS |
| Ga0187782_103266172 | 3300017975 | Tropical Peatland | MASSVAMLGAALIVVALLVVYVPTIYIRKTNKLIRLLEKIEANTRK |
| Ga0187823_101445132 | 3300017993 | Freshwater Sediment | MSLWPISLFRGWVVLVTLLAIYVPTIYIRKTNKILKLLEQIEANTRK |
| Ga0187822_102008581 | 3300017994 | Freshwater Sediment | MSLWPISLFGGWVVLVTLLAIYVPTIYIRKTNKILKLLEQIEANTRK |
| Ga0187816_100473581 | 3300017995 | Freshwater Sediment | MEWSFAMIGGAIVLVALLAVYVPTVYIRKTNKLLA |
| Ga0187865_10259764 | 3300018004 | Peatland | MAWSLGLVGGCLILIALLAVYVPTIYIRKTNKVIGLLEKIEANTRK |
| Ga0187865_10365614 | 3300018004 | Peatland | MAWPLGLVGGCLILIALLAVYVPTIYIRKTDKILKLLEKIEANTRK |
| Ga0187884_104087702 | 3300018009 | Peatland | GGCVILLALLAVYVPTIYMRKTDKVIGLLEKIEANTRK |
| Ga0187872_102049801 | 3300018017 | Peatland | MAWSLALVGGCVILLALLAVYVPTIYIRKTDKVLKLLEKIEANTRK |
| Ga0187882_12789611 | 3300018021 | Peatland | AWALAYVGGGIVMVVLLAIYVPTIYIRKTNKLIALLEKIEANTRK |
| Ga0187864_101226521 | 3300018022 | Peatland | FYPFLAEVSMAWSLGLVGGCVILLALLAVYVPTIYIRKTNKLIELLEKIEANTRK |
| Ga0187885_103350591 | 3300018025 | Peatland | MAWSLGLVGGCLILIALLAVYVPTIYIRKTDKVIRLLEKIEANTRK |
| Ga0187858_101942232 | 3300018057 | Peatland | MAWSLGLIGGCVILLALLAVYVPKIYMRKTDKVIGLLEKIEANTRK |
| Ga0187784_102836252 | 3300018062 | Tropical Peatland | MEWSIAMVAGAIILVALLAIYVPTVYIRKTNKLIAILEKIEANTHK |
| Ga0187784_104413192 | 3300018062 | Tropical Peatland | SSVAMLGAALIVVALLVVYVPTIYIRKTNKLIRLLEKIEANTRK |
| Ga0187784_109096791 | 3300018062 | Tropical Peatland | FLLEAFMAWSMALLGAALVVIALQAIYVPTVYIRKTNKVIQLLEKIEANTHK |
| Ga0187772_113233561 | 3300018085 | Tropical Peatland | MAWSVTMLGAALIVVALLAIYVPTIYIRKTNKLIGLLEKIEANTHK |
| Ga0187769_100926332 | 3300018086 | Tropical Peatland | MAWSVAVVGGALIAVALLAVYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0187769_100946001 | 3300018086 | Tropical Peatland | MAWSMALLGAALVVIALQAMYVPTVYIRKTNKVLHLLEKIEANTRK |
| Ga0187769_102367792 | 3300018086 | Tropical Peatland | MVGGAVILIGLLGIYFPTIYIRKTNKVMRLLERIEANTRK |
| Ga0187769_102609991 | 3300018086 | Tropical Peatland | MEWPIALVAGAIILVALLAIYVPTVYIRKTNKLIAILEKIEANTHK |
| Ga0187769_106346681 | 3300018086 | Tropical Peatland | GAVILIGLLGIYFPTIYIRKTNKVMGLLERIEANTRK |
| Ga0187769_108070641 | 3300018086 | Tropical Peatland | MAWSVAVLGGALVAVALLAIYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0187771_100363932 | 3300018088 | Tropical Peatland | MEGSFWSFAMVGGAIVLVALLAIYVPTVYIRKTNKLIALLEKIEANTHK |
| Ga0187771_101149854 | 3300018088 | Tropical Peatland | MAWSMALLGGALVVIALQAIYVPTVYIRKTNKVIHLLEKIEANTHK |
| Ga0187771_101197451 | 3300018088 | Tropical Peatland | MAWNLALVGGGIVVVALLAIYVPTIYIRKTNKILALLEKIEANTRK |
| Ga0187771_101567464 | 3300018088 | Tropical Peatland | LGGALVAVALLAIYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0187771_103331772 | 3300018088 | Tropical Peatland | MPWSVGLIGGCVILIALLAIYVPTIYIRKTDKILALLEKIEANTRK |
| Ga0187771_104703982 | 3300018088 | Tropical Peatland | MAWSVAIVGGALIAVALLAVYVPTIYIRKTNKLLDVLNKIE |
| Ga0187771_104915012 | 3300018088 | Tropical Peatland | MTGTWWSIGMVGGAVILIGLLGIYFPTIYIRKTNKVMGLLERIE |
| Ga0187771_112468821 | 3300018088 | Tropical Peatland | MAWSAGLVGACLILLAALAVYVPTIYIRKTNKLMRLLEKIEANTRK |
| Ga0187771_113855791 | 3300018088 | Tropical Peatland | MAWSGAIVGGCVVLIALIAIYVPTIYIRKTNKVMRLLEKIEANTRK |
| Ga0187771_113887391 | 3300018088 | Tropical Peatland | DPSFLPEVSMAWPLALIGGCLILIALLAVYVPTIYIRKTDKILKLLEKIEVNTRK |
| Ga0187770_101005001 | 3300018090 | Tropical Peatland | MAWSVAIVGGALIAVALLAVYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0187770_101075092 | 3300018090 | Tropical Peatland | MTWTWWSIGMVGGAVILIGLLGIYFPTIYIRKTNKVMGLLERIEANTRK |
| Ga0187770_101278513 | 3300018090 | Tropical Peatland | MAWSVAVLGGALVAVALLAIYVPTIYIRKTNKLLEVLNKIEANTHK |
| Ga0187770_102748261 | 3300018090 | Tropical Peatland | MTGTWWSIGMVGGAVILIGLLGIYFPTIYIRKTNKVMGLLERIEANTRK |
| Ga0187770_116409261 | 3300018090 | Tropical Peatland | LLEVFMAWSVALLGGALIVVALLAIYTPTIYIRKTNKLIDVLNKIEANTRK |
| Ga0187852_13936231 | 3300019082 | Peatland | MAWSLSMVGGCVILIALLAIYVPTIYIRKTDKLIGLLEKIEANTRK |
| Ga0187796_12325351 | 3300019264 | Peatland | MEGSIWSFAMVGGAIVLVALLAIYVPTVYIRKTNKLIALLEKIEANTHK |
| Ga0187798_17788972 | 3300019275 | Peatland | LVLPEVYMAWSGGIVGGCVILITLLAIYVPTIYIRKTNKLLRLLEKIEANTRK |
| Ga0187797_10638592 | 3300019284 | Peatland | SFFLLEAFMAWSMALLGAALVVIALQAMYVPTVYIRKTNKVLHLLEKIEANTRK |
| Ga0224555_10060233 | 3300023088 | Soil | MVWSLAVAWGGLIVVALMAVYVPTIYIRKTNKLIGLLEKIEANTRK |
| Ga0208034_10500752 | 3300025442 | Peatland | PFLAEVSMAWSLGLVGGCVILLALLAVYVPTIYIRKTNKLIELLEKIEANTRK |
| Ga0208562_10347551 | 3300025460 | Peatland | IGGCVILLALLAVYVPTIYMRKTDKVIGLLEKIEANTRK |
| Ga0209648_100378645 | 3300026551 | Grasslands Soil | MWQLAMLGGCIVLVTLLAVYVPTIYIRKTNKVLKVLEQIEANTRK |
| Ga0209039_100405392 | 3300027825 | Bog Forest Soil | MAWSLGLVGGCLILIALLAVYVPTIYIRKTDKVIGLLEKIEANTRK |
| Ga0209180_103063631 | 3300027846 | Vadose Zone Soil | MWPVGLLGGCAVLVALLAAYVPLIYIRKTNKVLKVLEQIEVNTRK |
| Ga0209517_101254053 | 3300027854 | Peatlands Soil | MAWSVAYVGGGIIVVALLAIYVPTIYIRKTNKLLAVLEKIEANTRK |
| Ga0209701_100018794 | 3300027862 | Vadose Zone Soil | MWPVALLSACAVLVALLAAYVPSIYIRKTNKVLKLLEQIEANTRK |
| Ga0209701_100252633 | 3300027862 | Vadose Zone Soil | MEWSFALVGASLVLVALLAVYVPTIYIRKTNKVIALLEQIAANTKK |
| Ga0209777_106591161 | 3300027896 | Freshwater Lake Sediment | MSSKILSFLPEVTMAWSLALVGGGVWLIALVAVYAPTVYIRKTNKLIALLEKIEANTRK |
| Ga0316363_104365122 | 3300030659 | Peatlands Soil | VAYVGGGIIVVALLAIYVPTIYIRKTNKLLAVLEKIEANTRK |
| Ga0307469_100124392 | 3300031720 | Hardwood Forest Soil | MASATLVSGCAVLIALLVAYVPIVYIRKTNKVLKFLEQIEANTRK |
| Ga0315280_102930311 | 3300031862 | Sediment | MAWSLAYVGGGIIVVALLAIYVPTIYIRKTNKLIALLEKIEANTRK |
| Ga0307471_1041631641 | 3300032180 | Hardwood Forest Soil | MEWSFAVTVGCAVVIALLAIYVPTIYIRKTNKIINLLEQIQANTRK |
| Ga0335078_112400911 | 3300032805 | Soil | MEWSFAMIGGAIVLVALLAVYVPTVYIRKTNKLLEVLQKIEANTHK |
| Ga0335077_114063091 | 3300033158 | Soil | LGGALVVVALLAVYVPTIYIRKTNKLIGLLERIEANTHK |
| Ga0335077_116325202 | 3300033158 | Soil | MDVPVTMLGAAVIVVALLAIYVPTIYIRKTNKLIRLLERIEANTRK |
| Ga0326728_100001986 | 3300033402 | Peat Soil | MAWSVAMLGGALIVVALLVIYVPTIYIRKTNKLINLLEKIEANTRK |
| Ga0326728_1000209443 | 3300033402 | Peat Soil | MAWQVGLMGGCLIVIALLSIYVPTIYIRKTDKVLALLEKIEANTRK |
| Ga0326728_1000222328 | 3300033402 | Peat Soil | MSWSVTMLGGALVVVALLAIYVPTIYIRKTNKLIALLERIEANTHK |
| Ga0326728_1000613816 | 3300033402 | Peat Soil | MGWSVTLLGGALVVVALLAIYVPTIYIRKTNKLIGLLERIEANTHK |
| Ga0326728_1001711218 | 3300033402 | Peat Soil | MAWSLGLIGGCVILLALLAVYVPTIYIRKTNRLIGLLEKIEANTRK |
| Ga0326728_100654433 | 3300033402 | Peat Soil | MAWQVGLMGGCLIVIALLSIYVPTIYIRKTDKILALLEKIEANTRK |
| Ga0326728_103735743 | 3300033402 | Peat Soil | MDLSVAMLGAAVVVVALLAIYVPTIYIRKTNKLIGLLERIEANTRK |
| Ga0326728_104814212 | 3300033402 | Peat Soil | MAWPLALLGGCLIMIALLAVYVPTIYIRKTDKVIGLLEKIEANTRK |
| Ga0326728_104855051 | 3300033402 | Peat Soil | MAWSVGLLGVSVVLIALLAIYFPTIYIRKTNKVLALLEKIEANTRK |
| Ga0326728_105016552 | 3300033402 | Peat Soil | MWSLAMVGGCVIVLALLAIYVPTIYIRKTDKLIGLLEKIEANTRK |
| Ga0326728_105862571 | 3300033402 | Peat Soil | MAWSLAMVVGCLIVIALLAIYVPTIYIRKTDKLLAVLDKIEANTRK |
| Ga0326728_107272722 | 3300033402 | Peat Soil | MAWSGGIVGGCVILITLLAIYVPTIYIRKTNKVIRLLEKIEANTRK |
| Ga0326727_109388251 | 3300033405 | Peat Soil | MAWSVTLLSAAVVLIALLAIYVPTIYIRKTNKLLGLLEKIEANTRK |
| Ga0371490_10024354 | 3300033561 | Peat Soil | FFLLEAFMAWSVAMLGGALIVVALLVIYVPTIYIRKTNKLINLLEKIEANTRK |
| Ga0314861_0000129_57534_57674 | 3300033977 | Peatland | MEWSIALVAGAIILVALLAVYVPTVYIRKTNKLIAILEKIEANTHK |
| Ga0314861_0000367_52731_52871 | 3300033977 | Peatland | MAWSLAFVGGGIIVVALLAIYVPTIYIRKTNKLVELLERIEANTRK |
| Ga0314861_0000953_32464_32613 | 3300033977 | Peatland | MTWTWWSIGMVGGAVILISLLGIYFPTIYIRKTNKVMGLLERIEANTRK |
| Ga0314861_0001093_19276_19416 | 3300033977 | Peatland | MAWSVAIVGGALVAVALLAVYVPTIYIRKTNKLLDVLNKIEANTHK |
| Ga0314861_0005766_1124_1264 | 3300033977 | Peatland | MAWSMALLGAALVVIALQAIYVPTVYIRKTNKVIQLLEKIEANTHK |
| Ga0314861_0013037_1729_1869 | 3300033977 | Peatland | MAWSGGIVGGCVILITLLAIYVPTIYIRKTNKVLRLLEKIEANTRK |
| Ga0314861_0292285_3_170 | 3300033977 | Peatland | YLFFLLEAFMAWSMALLGAALVVIALQAMYVPTVYIRKTNKVLHLLEKIEANTRK |
| Ga0314861_0462931_2_169 | 3300033977 | Peatland | LFLFLLEAFMAWSVALLGGALIVIALQAIYVPTVYIRKTNKVIHLLEKIEVNTRK |
| Ga0371488_0292895_503_625 | 3300033983 | Peat Soil | MLGGALVVVALLAIYVPTIYIRKTNKLIALLERIEANTHK |
| Ga0326724_0284668_765_926 | 3300034091 | Peat Soil | PFFSEVSMAWQVGLMGGCLIVIALLSIYVPTIYIRKTDKILALLEKIEANTRK |
| ⦗Top⦘ |