 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F049204 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MLRPIAIALILVLSVGIMLPFANSAHGVRQTVQVGQRRHHRYRSRAWW |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (10.884 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF00437 | T2SSE | 48.98 |
| PF05157 | T2SSE_N | 6.12 |
| PF08811 | DUF1800 | 0.68 |
| PF13620 | CarboxypepD_reg | 0.68 |
| PF06508 | QueC | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.68 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.68 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.68 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.68 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.68% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_104577012 | 3300000890 | Soil | MLRPIAIALILVLSVGIMLPFANSAHGLRQTVQVGQRRHHR |
| JGI10214J12806_120788002 | 3300000891 | Soil | MLRTIAIALILVLSVGVMLPFSNSAHGVRQSVQVTKKHHYRYRSRAWWRRYRARLRQRRE |
| JGI24036J26619_100244491 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRYHSRAWWHRYRAR |
| JGI24036J26619_100291961 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRYHSRAWWHRYRA |
| Ga0062593_1002676061 | 3300004114 | Soil | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRYHSRAWWH |
| Ga0062593_1011762792 | 3300004114 | Soil | MLRTIAIALTLVLSIGVMLPLANSAHGVRQTIELGQQQGHHRYRSRAWWRRY |
| Ga0062593_1029871331 | 3300004114 | Soil | MLRTIAIALILVLSVGVMLPLGNEAHGVRQSVQVTKKRHH |
| Ga0065714_104534512 | 3300005288 | Miscanthus Rhizosphere | MLRTIAIALILVLSVGVMLPFSNEAHGVRQSVQVTTKRHHRY |
| Ga0065712_107155551 | 3300005290 | Miscanthus Rhizosphere | MLRVIAITMTLVLSVSIMLPFAQEAHGIRQTVELNQSRHHRH |
| Ga0065705_105163482 | 3300005294 | Switchgrass Rhizosphere | MLRTIAISLILVLSVGIMLPFTNSAHGVRQTVQIGQKRHHRYHSR |
| Ga0065705_106228032 | 3300005294 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGVRQTVQVGQQRHHRFRSRAWWRRYRARLRQKRL |
| Ga0065705_108257252 | 3300005294 | Switchgrass Rhizosphere | MLRTIAIALILVLSLGVMLPLANEAHGIRQSVQLHKRHRRHHSRAWWRRYRARLR |
| Ga0065705_111199572 | 3300005294 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRQHRYRSRTWWR |
| Ga0065707_104705362 | 3300005295 | Switchgrass Rhizosphere | MLRTIAISLILVLSLGVMLPLANSAHGVRQSVQAKQRWHHR |
| Ga0066388_1065905292 | 3300005332 | Tropical Forest Soil | MLRTIAISLILLLTVGVMLPFANSAHGVRQSTEVSMRRHHRYHSRAWWR |
| Ga0070680_1014035311 | 3300005336 | Corn Rhizosphere | MLRVIAISLVLVLSVGVMLPFANEAHGIRQSVQVTKRRHHRYRSHAWWRRYRARL |
| Ga0070660_1005398212 | 3300005339 | Corn Rhizosphere | MLRTTAISLILLLSVGVMLPFTNSAHGVRQSAQVGQFSPHRY |
| Ga0070689_1009551901 | 3300005340 | Switchgrass Rhizosphere | MLRTIAIALILVLSVGVMLPFSNEAHGVRQSVQVTTKRHHRYRSRAWWRRYRARLRLKREAA |
| Ga0070689_1020576461 | 3300005340 | Switchgrass Rhizosphere | MLRPIAIALILVLSASIMLPFANSAHGLRQSVQVGQRRHHRYRS |
| Ga0070687_1003955602 | 3300005343 | Switchgrass Rhizosphere | MLRTIAISLILLLSVGVMLPFANSAHGVRQTTQIGEHKSKRHRSR |
| Ga0070669_1009396161 | 3300005353 | Switchgrass Rhizosphere | MLRIIALSLMLVLSVGVMLPCANEAHGVRQSTQIGLRRHHRYHSRAWWRRYRARL |
| Ga0070674_1018800182 | 3300005356 | Miscanthus Rhizosphere | MLRTIAIFLMLLISVGVMLPFANSAHGVRQSSQIGVRQNRHHSRAWW |
| Ga0070701_110504121 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAIALILVLSVGVMLPFSNEAHGVRQSVQVTTKRHHRYRSRAWWRRY |
| Ga0070705_1011928752 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRHHRYRSRAWWRRYRARLRAKRLAAEMA |
| Ga0070705_1014106972 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLVLLLSVGIMLPFANSAHGIRQSTQLTQKKSK |
| Ga0070705_1015601532 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILVLSVGVMLPFANEAHGIRQSVQVHQRRHR |
| Ga0070705_1016905962 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRPIAIALILVLSVGVMLPFANEAHGVRQTVQVGQRRHHRYRSRAWWRRYRARLRQK |
| Ga0070694_1016319501 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRVIAISMILVLSASIMLPFANEAHGIRQTVEIGQQRHKRHRSK |
| Ga0070678_1011006961 | 3300005456 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGVMLPFTNSAHGLRQTVEVGKRRHHR |
| Ga0070681_103425892 | 3300005458 | Corn Rhizosphere | MLRTIAIALILVLSVGVMLPFSNSAHGVRQSVQTTKKHHYRYRSRAWWR |
| Ga0068867_1008237392 | 3300005459 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGVMLPFANEAHGIRQTVQVGQRRHHRYRSRAWWRR |
| Ga0070672_1018235602 | 3300005543 | Miscanthus Rhizosphere | MLRTTAISLILLLSVGVMLPFTNSAHGVRQSAQVGQFSPHRYRSRAWWRRYRARLRKKRA |
| Ga0070686_1009682731 | 3300005544 | Switchgrass Rhizosphere | MLTTTAISLILLLSVGVMLPFANSAHGVRQSAQVGQFRHSRYRSRAWW |
| Ga0070695_1017311502 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILLLSVGIMLPLANSAHGVMQTVQVGKRRHHR |
| Ga0070696_1013786231 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLIMVLSVGVMLPFANEAHGIRQSVQVNQRRHRRHHSRAWWRRYHAR |
| Ga0070693_1002174782 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILVLTVGVMMPFTHEAHGVRQSAQVGGPKRHYRYRSRAWWRR |
| Ga0070693_1003252292 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAIALILLISVGVMLPFANSAHGIRQSAQVSVSHHRYHSRAWWRRYRARLRKKRAAAAL |
| Ga0068857_1018582941 | 3300005577 | Corn Rhizosphere | MLRTIAITMVLLLSVGIMLPFANSAHGIRQSTEVTQKKSKRHRSRTWWRR |
| Ga0070702_1004113602 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILLLSVGVMLPFANSAHGIRQSTQIEQKKSKRYRSRAWWRRYRARL |
| Ga0068859_1023659692 | 3300005617 | Switchgrass Rhizosphere | MLRTIAIALILVLSVGVMLPFANEAHGVRQSVQVKQRRHYRYRSRAWWRR |
| Ga0068864_1006510551 | 3300005618 | Switchgrass Rhizosphere | MLRTIAISLILVLTVGVMLPFTHEAHGVRQSAQVGGPKRHYRYRSRAWWRRYRAR |
| Ga0068861_1018188131 | 3300005719 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVGQRRHHRYRSRAWWRRYRAR |
| Ga0068863_1005635101 | 3300005841 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRHHRYRSRAWWR |
| Ga0068858_1013704801 | 3300005842 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVGQRRHH |
| Ga0068858_1022348542 | 3300005842 | Switchgrass Rhizosphere | MLRTTAISLILLLSVGVMLPFANSAHGVRQSAQVGQFRHSRYRSRAWWRRYRARLRKK |
| Ga0075287_10603431 | 3300005873 | Rice Paddy Soil | MLRPIAIALILVLSVGVMLPFANEAHGLRQTVEVG |
| Ga0075417_101678421 | 3300006049 | Populus Rhizosphere | MLRTIAISLVLLLSVGIMLPFANSAHGIRQSTQVTQKKSKRYRS |
| Ga0082029_15030991 | 3300006169 | Termite Nest | MLRPIAIALILVLSVGVMLPFANSAHGLRQTVQVGQ |
| Ga0070716_1014012041 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAIALVLVLTASVMLPFANSAHGLRQSTQISLRQHHRYHSRAWWRRYKARQ |
| Ga0079221_113843241 | 3300006804 | Agricultural Soil | MLRTIAISLILVLSVSIMLPFANEAHGIRQSVQVHHRRHRRHSRAWWRRYRARL |
| Ga0075421_1024150212 | 3300006845 | Populus Rhizosphere | MLRTIAISLILVLSVGVMLPFANSAHGVRQTVQLGATKKRAHRYRSRA |
| Ga0079217_1000008318 | 3300006876 | Agricultural Soil | MLRTIAITLVLLLSVGVMLPFANSAHGIRQSTQITK |
| Ga0075429_1013246651 | 3300006880 | Populus Rhizosphere | MLRTIAISLVLLLSVGIMLPFANSAHGIRQSTQVTQKKSKRYRSRAWWRRYRARMRA |
| Ga0075418_119936492 | 3300009100 | Populus Rhizosphere | MLRTIAIFLMLLISVGVMLPFANSAHGVRQSAQIGVSRNRHHSRAWWRRYRARLRKKRAAATAA |
| Ga0105247_106824692 | 3300009101 | Switchgrass Rhizosphere | MLRIISIALILVLSIGVMLPLGNEAHGIRQTVEIGQSH |
| Ga0114129_116316241 | 3300009147 | Populus Rhizosphere | MLRITAISLMLVLSVGIMLPFTQEAHGVRQSMQIGQSRHHRYRSRAWWRRYRARLKQRRMAAEL |
| Ga0105243_130821232 | 3300009148 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVGQRRHHRYRSRAWWR |
| Ga0075423_104941931 | 3300009162 | Populus Rhizosphere | MFRTIALSLILVLSVGVMMPFANSAHGIRQTVQLGTKRHHRYRSRAWW |
| Ga0105242_103043361 | 3300009176 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGIRQTVQVGQRRHHRYRSRA |
| Ga0105248_133043772 | 3300009177 | Switchgrass Rhizosphere | MLRTIAIALVLVLTASVMLPFANSAHGLRQSTQISLRQHHRYHSRAWW |
| Ga0126313_109759082 | 3300009840 | Serpentine Soil | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVG |
| Ga0126380_107760002 | 3300010043 | Tropical Forest Soil | MLRPIAIALILVLSVGVMLPFANEAHGIRQTVQVGQRRHHR |
| Ga0126382_109637392 | 3300010047 | Tropical Forest Soil | MLRPIAIAMIFVLSVSIMLPFANSAHGIRQTVEIGQQ |
| Ga0126382_125233722 | 3300010047 | Tropical Forest Soil | MLRPIAIALIIVLSVGIMLPLANEAHGVRQSVEIGQPRHHRYRTRAWWRRYRARLRA |
| Ga0126377_126898282 | 3300010362 | Tropical Forest Soil | MLRPIAIALILVLSVGVMLPFANEAHGIRQTVEVGQQRRHHRYRSRAWWRRYR |
| Ga0105239_111486612 | 3300010375 | Corn Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRQHRYRSRAWW |
| Ga0134127_123020832 | 3300010399 | Terrestrial Soil | MLRPIAIAVILVLSVGIMLAFANSAHGLRQTVQVGQRRHH |
| Ga0134127_126038562 | 3300010399 | Terrestrial Soil | LMLLLTVGVMLPFANEAHGVRQSSQAGMRRHHRYHSRA* |
| Ga0134127_131269431 | 3300010399 | Terrestrial Soil | MLRPIAIALILVLSVGIMLPFANSAHGVRQTVQVGQRRHHRYRSRAWW |
| Ga0134122_113631321 | 3300010400 | Terrestrial Soil | MLRTIAISLILVLSVGVMLPFANSAHGVRQTVQLGATKRHGSRYRSRAWWKRHRARLRQKRLAAE |
| Ga0134121_110366161 | 3300010401 | Terrestrial Soil | KMLRPIAIALILVLSVGVMLPFANEAHGLRQTVEVGKRRHHRYRSRA* |
| Ga0105246_100313583 | 3300011119 | Miscanthus Rhizosphere | MLRTIAISLILVLTVGVMMPFTHEAHGVRQSAQVGGPKRHYRYRSRAWWRRYRAR |
| Ga0126317_106717642 | 3300011332 | Soil | MLRTIAISLILVLSLGVMLPLANSAHGVRQSVQARQRWHH |
| Ga0120192_100482842 | 3300012021 | Terrestrial | MLRTIAISLILVLSVGIMMPLTHEAHGVRQSVQVG |
| Ga0150985_1079367731 | 3300012212 | Avena Fatua Rhizosphere | MLRPIAIALILVLSVGVMLPFTNSAHGLRQTVEVGKQRHHRYRSHAWWR |
| Ga0157291_103811442 | 3300012902 | Soil | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVGQRRHHRYRSR |
| Ga0126375_109132902 | 3300012948 | Tropical Forest Soil | MLRIIAISLMLVLSVGIMLPFANEAHGVRQTTQIG* |
| Ga0164300_109360472 | 3300012951 | Soil | MLRTIVISLILVLSTGIMLPLANSAHAVMQTVQVGQRRHHRYHSRAWWRRYH |
| Ga0164298_105606332 | 3300012955 | Soil | MLRTIAIALILLISVGVMLPFANSAHGIRQSAQVSVRHHRYHSRAWWRRYHARLRK |
| Ga0157371_102873651 | 3300013102 | Corn Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGIRQTVQVGQQRRHHRYRSRAW |
| Ga0163163_100351831 | 3300014325 | Switchgrass Rhizosphere | MLRTIAIALVLVLTASVMLPFANSAHGLRQSTQISLRQ |
| Ga0157377_102323602 | 3300014745 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGVMLPFANEAHGLRQTVEVGKRRHHRYRSRA |
| Ga0157379_114348543 | 3300014968 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVGQRR |
| Ga0134089_105535312 | 3300015358 | Grasslands Soil | MLRTIAISLILLLTVGVMLPFANSAHGVRQSSQVGMRRHHHYHSRAWW |
| Ga0132257_1025832032 | 3300015373 | Arabidopsis Rhizosphere | MLRIIALSLMLVLSVGVMLPCANEAHGVRQSTQIGLRRHHRYHSRAWWRRYRA |
| Ga0132255_1036921562 | 3300015374 | Arabidopsis Rhizosphere | MLRTIAISLILVLSVGIMLPFTNSAHGVRQSVQIGQHYHYRHRSRAWWRRYRARQ |
| Ga0132255_1042020292 | 3300015374 | Arabidopsis Rhizosphere | MILVLSVSIMLPFANEAHGIRQTVEIGQSHHKHYRSKAWWRR |
| Ga0132255_1061547191 | 3300015374 | Arabidopsis Rhizosphere | MLRPIAIALILVLSVGVMLPFANEAHGIRQTVEVGQQRRHHRRYRSRAWWRRYRARL |
| Ga0163161_113147292 | 3300017792 | Switchgrass Rhizosphere | MLRTTAISLILLLSVGVMLPFANSAHGVRQSAQVGQF |
| Ga0190265_112629172 | 3300018422 | Soil | MLRTIAITLVLLLSVGVMLPFANSAHGIRQSTQITKKKSKRYRSRAWWRRYRARLRAKR |
| Ga0182009_105910522 | 3300021445 | Soil | MLRTIAISLIMVLSVGVMLPFANEAHGIRQSVQVNQRHH |
| Ga0207713_12079881 | 3300025735 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPFANEAHGLRQTVQVGQRRHHRYRSRAWWRR |
| Ga0207684_110073992 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRYHSRAWW |
| Ga0207657_101241761 | 3300025919 | Corn Rhizosphere | MLRTTAISLILLLSVGVMLPFTNSAHGVRQSAQVGQFSPHRYRSR |
| Ga0207649_110799872 | 3300025920 | Corn Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRY |
| Ga0207681_108862722 | 3300025923 | Switchgrass Rhizosphere | MLRTIAISLMLLLTVGVMLPFANEAHGVRQSSQAGLRRHHRYHSRAWWRRYRAR |
| Ga0207687_110553291 | 3300025927 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQ |
| Ga0207687_113669481 | 3300025927 | Miscanthus Rhizosphere | MLRTIAIALILLISVGVMLPFANSAHGIRQSAQVSVRHHRYHSRTWWRRYR |
| Ga0207701_100509581 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLVLLLSVGIMLPFANSAHGIRQSTQLTQKKSKRYR |
| Ga0207670_116529591 | 3300025936 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGVMLPFANEAHGIRQTVQVGQRRHHHYRSRAW |
| Ga0207669_100980802 | 3300025937 | Miscanthus Rhizosphere | MLRTIAIFLMLLISVGVMLPFANSAHGVRQSSQIGVRQNRHHSRAWWRRYRARL |
| Ga0207665_104501852 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLIMVLSVGVMLPFANEAHGIRQSVQVNQRRH |
| Ga0207691_105207592 | 3300025940 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGVMLPFANEAHGIRQTVQVG |
| Ga0207711_113708491 | 3300025941 | Switchgrass Rhizosphere | MLRTIAIALILVLSVGVMLPFSNEAHGVRQSVQVTTKRHHRYRSRAWWRRYRARLRLKREAAA |
| Ga0207711_120678362 | 3300025941 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGVMLPFTNSAHGLRQTVEVGKRHHRYRSRAWWRR |
| Ga0207689_101385981 | 3300025942 | Miscanthus Rhizosphere | MLRIIAISLMLLLTVGVMLPFANEAHGVRQSSQAGMRRHHRYHSRAWWRRYR |
| Ga0207651_102269822 | 3300025960 | Switchgrass Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRYHSRAWWHRYRARLRK |
| Ga0207677_109748661 | 3300026023 | Miscanthus Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRHHRYRSRAWWRRYRARV |
| Ga0207708_110805372 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTIAISLILVLTVGVMMPFTHEAHGVRQSAQVGGPKRHYRYRS |
| Ga0207708_112544662 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRITAISLMLVLSVGIMLPFTQEAHGVRQSMEIGQRRHHRYRSRAWW |
| Ga0207641_100452031 | 3300026088 | Switchgrass Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQ |
| Ga0207641_103004681 | 3300026088 | Switchgrass Rhizosphere | MLRTIAISLILLLSVGVMLPFANSAHGIRQSTQVEQKKSKRYRSRAWWRRYRA |
| Ga0207641_107735502 | 3300026088 | Switchgrass Rhizosphere | MLRTIAIALILLISVGVMLPFANSAHGIRQSAQVSVRHHRY |
| Ga0207641_125867442 | 3300026088 | Switchgrass Rhizosphere | MLRVIAISMILVLSVSIMLPFANEAHGIRQTVEIGQRR |
| Ga0207676_100560171 | 3300026095 | Switchgrass Rhizosphere | MLVLSVSIMLPFAHEAHGVRQTTQVGQSRHHRYRSRAWWRRYRA |
| Ga0207676_111091561 | 3300026095 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRHHRYRSRAWWRRYRARLRAK |
| Ga0207676_115161641 | 3300026095 | Switchgrass Rhizosphere | MLRPIAIALILVLSASIMLPFANSAHGLRQSVQVGQRRHHR |
| Ga0207674_109951551 | 3300026116 | Corn Rhizosphere | MLRTIAITMVLLLSVGIMLPFANSAHGIRQSTEVTQKKSKRHRSRTWWRRY |
| Ga0207675_1024181591 | 3300026118 | Switchgrass Rhizosphere | MLRPIAIALILVLSVGIMLPLANEAHGVRQTVEIGQPRHHRYRSRAWWRRY |
| Ga0207698_101795422 | 3300026142 | Corn Rhizosphere | MLRTIAIALVLVLTASVMLPFANSAHGLRQSTQISLRQHHRYHS |
| Ga0207698_103260062 | 3300026142 | Corn Rhizosphere | MILVLSASIMLPFANEAHGIRQTVEIGQQRHKRHRSKAWWRRY |
| Ga0207698_106951661 | 3300026142 | Corn Rhizosphere | MLRTIAISLILVLSVGVMMPFANSAHGVRQTVQLGATKRYSY |
| Ga0207698_110409051 | 3300026142 | Corn Rhizosphere | MLRTIAISLILLLTVGVMLPFANSAHGVRQSAQVGIRQHRRYHSRAWWHRY |
| Ga0209481_102275331 | 3300027880 | Populus Rhizosphere | MLRTIAISLILLLSVGVMLPFANSAHGVRQTTQVGQRNSTRS |
| Ga0207428_101882261 | 3300027907 | Populus Rhizosphere | MLRTIAISLILVLSVGVMLPFANSAHGVRQTVQLGATKRHGSR |
| Ga0268240_101943171 | 3300030496 | Soil | MLRTIAIALILVLSVGVMLPFANEAHGVRQSVQVT |
| Ga0268241_101415541 | 3300030511 | Soil | MLRTIAIALILVLSLGVMLPLANEAHGIRQSVQVHHRRHRRHSRAWWRRYRA |
| Ga0307408_1009280931 | 3300031548 | Rhizosphere | MLRTIAISLILVLTVGVLMPFTHEAHGVRQSAQVDGP |
| Ga0310813_120900782 | 3300031716 | Soil | MLRTIAIALILLISVGVMLPFANSAHGIRQSAQVSVRH |
| Ga0307405_100411721 | 3300031731 | Rhizosphere | MLRTIAISLILVLSVGIMLPFTNSAHGVRQSVQVGQRRHHRYR |
| Ga0307468_1001044332 | 3300031740 | Hardwood Forest Soil | MLRTIAISLILLLTVVVMLPFANSAHGVRQSAQVAIRQHHRYHSRAWW |
| Ga0310893_105649851 | 3300031892 | Soil | MLRPIAIALILVLSASIMLPFANSAHGLRQSVQVGQRRHHRYR |
| Ga0307407_105375281 | 3300031903 | Rhizosphere | MLRTIAISLILVLSVGIMLPFTNSAHGVRQSVQVGQRRHHRYRSRAWWRRYRA |
| Ga0307409_1023398611 | 3300031995 | Rhizosphere | MLRTIAISLILVLSVGIMLPFTNSAHGVRQSVQVGQRRHHRYRSRAWWRRYRARLRQ |
| Ga0307416_1025607392 | 3300032002 | Rhizosphere | MLRITAISLMLVLSVGIMLPFTQEAHGVRQSMQIGQRRHHR |
| Ga0310906_104158122 | 3300032013 | Soil | MLRTIAITLVLLLSVGIMLPFANSAHGIRQSTQLTQKKSKRYRSRAW |
| Ga0310810_105398252 | 3300033412 | Soil | MLRVIAISLILVLSVGVMLPFANEAHGIRQSVQVTKRRHHRYRSHAWWRR |
| Ga0310811_108435881 | 3300033475 | Soil | MLRVIAISLILVLSVGVMLPFANEAHGIRQSVQVNKRRHH |
| Ga0314784_142351_3_149 | 3300034663 | Soil | MLRVIAISMILVLSVSIMLPFANEAHGIRQTVEIGQRHHKRHRSKAWWR |
| Ga0314786_144554_1_141 | 3300034664 | Soil | MLRITAISLMLVLSVGIMLPFTQEAHGVRQTTQVGQSRHHRYRSRAW |
| Ga0314787_121955_1_120 | 3300034665 | Soil | MLRTIAISLILVLSLSVILPLANEAHGIRQSVQVHQRRHR |
| Ga0314788_091241_1_114 | 3300034666 | Soil | MLRITAISLMLVLSVGIMLPFTQEAHGVRQTTQVGQRR |
| Ga0314793_146204_381_530 | 3300034668 | Soil | MLRTIAISLILVLSVGVMLPFANEAHGIRQSVQVHQRRHRRHSRAWWRRY |
| Ga0314794_060171_3_125 | 3300034669 | Soil | MLRIIAITLMLVLSVGIMLPFTNEAHGVRQTTQIGQRKHHR |
| Ga0314798_036694_701_871 | 3300034673 | Soil | MLRTIAISLVLLLSVGIMLPFANSAHGIRQSTQLTQKKSKRYRSRAWWRRYRARMRA |
| Ga0314801_154833_438_557 | 3300034676 | Soil | MLRTIAISLVLLLSVGIMLPFANSAHGIRQSAQVTQKKSK |
| Ga0373959_0126074_2_106 | 3300034820 | Rhizosphere Soil | MLRPIAIALILVLSVGIMLPFANSAHGLRQTVQVG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |