| Basic Information | |
|---|---|
| Family ID | F049122 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MISITRNHAVRKGQSGQFTCGITPSTGKWSAPAANEVAP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.91 % |
| % of genes near scaffold ends (potentially truncated) | 25.17 % |
| % of genes from short scaffolds (< 2000 bps) | 77.55 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.143 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.891 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.293 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.503 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF13560 | HTH_31 | 21.77 |
| PF04149 | DUF397 | 6.80 |
| PF00221 | Lyase_aromatic | 3.40 |
| PF12730 | ABC2_membrane_4 | 0.68 |
| PF13701 | DDE_Tnp_1_4 | 0.68 |
| PF01315 | Ald_Xan_dh_C | 0.68 |
| PF13520 | AA_permease_2 | 0.68 |
| PF02403 | Seryl_tRNA_N | 0.68 |
| PF03734 | YkuD | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 3.40 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.14 % |
| All Organisms | root | All Organisms | 42.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig15735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1357 | Open in IMG/M |
| 3300004267|Ga0066396_10042718 | Not Available | 703 | Open in IMG/M |
| 3300004479|Ga0062595_100004409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3890 | Open in IMG/M |
| 3300004633|Ga0066395_10135470 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300005175|Ga0066673_10548564 | Not Available | 677 | Open in IMG/M |
| 3300005332|Ga0066388_100131615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3047 | Open in IMG/M |
| 3300005332|Ga0066388_100467286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1901 | Open in IMG/M |
| 3300005332|Ga0066388_105294261 | Not Available | 654 | Open in IMG/M |
| 3300005332|Ga0066388_108144966 | Not Available | 523 | Open in IMG/M |
| 3300005332|Ga0066388_108144970 | Not Available | 523 | Open in IMG/M |
| 3300005434|Ga0070709_10000840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 17199 | Open in IMG/M |
| 3300005435|Ga0070714_100055126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3397 | Open in IMG/M |
| 3300005435|Ga0070714_100604019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1054 | Open in IMG/M |
| 3300005439|Ga0070711_100166545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1676 | Open in IMG/M |
| 3300005445|Ga0070708_100183407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1956 | Open in IMG/M |
| 3300005445|Ga0070708_101560353 | Not Available | 615 | Open in IMG/M |
| 3300005537|Ga0070730_10006732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 9807 | Open in IMG/M |
| 3300005537|Ga0070730_10031561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3994 | Open in IMG/M |
| 3300005540|Ga0066697_10564134 | Not Available | 636 | Open in IMG/M |
| 3300005541|Ga0070733_10634118 | Not Available | 717 | Open in IMG/M |
| 3300005556|Ga0066707_10517665 | Not Available | 773 | Open in IMG/M |
| 3300005568|Ga0066703_10224048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1143 | Open in IMG/M |
| 3300005587|Ga0066654_10847065 | Not Available | 522 | Open in IMG/M |
| 3300005598|Ga0066706_10636141 | Not Available | 847 | Open in IMG/M |
| 3300005764|Ga0066903_100061500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4698 | Open in IMG/M |
| 3300005764|Ga0066903_100129280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3545 | Open in IMG/M |
| 3300005764|Ga0066903_100249551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2736 | Open in IMG/M |
| 3300005764|Ga0066903_100270690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2649 | Open in IMG/M |
| 3300005764|Ga0066903_102513958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 997 | Open in IMG/M |
| 3300005764|Ga0066903_103032031 | Not Available | 910 | Open in IMG/M |
| 3300005764|Ga0066903_103781542 | Not Available | 813 | Open in IMG/M |
| 3300005764|Ga0066903_104399357 | Not Available | 752 | Open in IMG/M |
| 3300005764|Ga0066903_105027026 | Not Available | 701 | Open in IMG/M |
| 3300005764|Ga0066903_106838232 | Not Available | 592 | Open in IMG/M |
| 3300005764|Ga0066903_107499610 | Not Available | 563 | Open in IMG/M |
| 3300005764|Ga0066903_108890908 | Not Available | 509 | Open in IMG/M |
| 3300006028|Ga0070717_10687110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 930 | Open in IMG/M |
| 3300006176|Ga0070765_100096596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2543 | Open in IMG/M |
| 3300006755|Ga0079222_10225940 | Not Available | 1152 | Open in IMG/M |
| 3300006755|Ga0079222_11380088 | Not Available | 650 | Open in IMG/M |
| 3300006791|Ga0066653_10116366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1246 | Open in IMG/M |
| 3300006804|Ga0079221_10037059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2108 | Open in IMG/M |
| 3300006804|Ga0079221_10045446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1943 | Open in IMG/M |
| 3300006804|Ga0079221_10065703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1677 | Open in IMG/M |
| 3300006806|Ga0079220_10036962 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300006893|Ga0073928_10287367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1240 | Open in IMG/M |
| 3300006904|Ga0075424_100715662 | Not Available | 1069 | Open in IMG/M |
| 3300006914|Ga0075436_100778141 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009089|Ga0099828_10072832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2913 | Open in IMG/M |
| 3300009090|Ga0099827_10053021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3059 | Open in IMG/M |
| 3300010043|Ga0126380_10159599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1457 | Open in IMG/M |
| 3300010046|Ga0126384_10549041 | Not Available | 1004 | Open in IMG/M |
| 3300010048|Ga0126373_11926550 | Not Available | 654 | Open in IMG/M |
| 3300010358|Ga0126370_10074310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2259 | Open in IMG/M |
| 3300010358|Ga0126370_10149041 | Not Available | 1702 | Open in IMG/M |
| 3300010360|Ga0126372_10708152 | Not Available | 984 | Open in IMG/M |
| 3300010361|Ga0126378_10056019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3703 | Open in IMG/M |
| 3300010361|Ga0126378_10104186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2807 | Open in IMG/M |
| 3300010361|Ga0126378_10653581 | Not Available | 1164 | Open in IMG/M |
| 3300010366|Ga0126379_13780931 | Not Available | 507 | Open in IMG/M |
| 3300010376|Ga0126381_100172088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2868 | Open in IMG/M |
| 3300010376|Ga0126381_100253047 | Not Available | 2388 | Open in IMG/M |
| 3300010376|Ga0126381_100904232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1271 | Open in IMG/M |
| 3300010379|Ga0136449_100869164 | Not Available | 1476 | Open in IMG/M |
| 3300010398|Ga0126383_12530052 | Not Available | 597 | Open in IMG/M |
| 3300010398|Ga0126383_13138370 | Not Available | 540 | Open in IMG/M |
| 3300010880|Ga0126350_10257929 | Not Available | 718 | Open in IMG/M |
| 3300010937|Ga0137776_1217691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4611 | Open in IMG/M |
| 3300010937|Ga0137776_1379241 | Not Available | 2873 | Open in IMG/M |
| 3300011120|Ga0150983_12445418 | Not Available | 798 | Open in IMG/M |
| 3300011120|Ga0150983_12807649 | Not Available | 912 | Open in IMG/M |
| 3300011120|Ga0150983_14606135 | Not Available | 582 | Open in IMG/M |
| 3300011270|Ga0137391_10370057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1229 | Open in IMG/M |
| 3300012199|Ga0137383_10869805 | Not Available | 658 | Open in IMG/M |
| 3300012205|Ga0137362_10787935 | Not Available | 815 | Open in IMG/M |
| 3300012208|Ga0137376_10925626 | Not Available | 748 | Open in IMG/M |
| 3300012357|Ga0137384_10056552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3249 | Open in IMG/M |
| 3300012363|Ga0137390_10445748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1271 | Open in IMG/M |
| 3300016319|Ga0182033_10676046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 902 | Open in IMG/M |
| 3300016387|Ga0182040_11577232 | Not Available | 559 | Open in IMG/M |
| 3300018431|Ga0066655_10109922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1562 | Open in IMG/M |
| 3300020199|Ga0179592_10018554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3074 | Open in IMG/M |
| 3300020582|Ga0210395_10012209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6377 | Open in IMG/M |
| 3300020582|Ga0210395_10317108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1172 | Open in IMG/M |
| 3300021171|Ga0210405_10173295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1710 | Open in IMG/M |
| 3300021171|Ga0210405_10315014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1236 | Open in IMG/M |
| 3300021171|Ga0210405_11079604 | Not Available | 601 | Open in IMG/M |
| 3300021180|Ga0210396_10247870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1584 | Open in IMG/M |
| 3300021420|Ga0210394_10369097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1262 | Open in IMG/M |
| 3300021432|Ga0210384_10236820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1643 | Open in IMG/M |
| 3300021478|Ga0210402_10698139 | Not Available | 937 | Open in IMG/M |
| 3300021478|Ga0210402_10844385 | Not Available | 842 | Open in IMG/M |
| 3300021559|Ga0210409_10517169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1058 | Open in IMG/M |
| 3300021559|Ga0210409_11129557 | Not Available | 659 | Open in IMG/M |
| 3300021560|Ga0126371_10522673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1335 | Open in IMG/M |
| 3300021560|Ga0126371_11140654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
| 3300021560|Ga0126371_12185952 | Not Available | 667 | Open in IMG/M |
| 3300022722|Ga0242657_1082004 | Not Available | 767 | Open in IMG/M |
| 3300025898|Ga0207692_10387236 | Not Available | 869 | Open in IMG/M |
| 3300025898|Ga0207692_11195236 | Not Available | 505 | Open in IMG/M |
| 3300025910|Ga0207684_10000653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 40961 | Open in IMG/M |
| 3300025915|Ga0207693_10096733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2315 | Open in IMG/M |
| 3300025922|Ga0207646_10000058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 158096 | Open in IMG/M |
| 3300027725|Ga0209178_1412718 | Not Available | 515 | Open in IMG/M |
| 3300027765|Ga0209073_10062212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1250 | Open in IMG/M |
| 3300027857|Ga0209166_10000527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 41337 | Open in IMG/M |
| 3300027857|Ga0209166_10077030 | Not Available | 1890 | Open in IMG/M |
| 3300027882|Ga0209590_10051965 | Not Available | 2288 | Open in IMG/M |
| 3300027894|Ga0209068_10924679 | Not Available | 517 | Open in IMG/M |
| 3300027903|Ga0209488_10341236 | Not Available | 1115 | Open in IMG/M |
| 3300030602|Ga0210254_10417854 | Not Available | 593 | Open in IMG/M |
| 3300030738|Ga0265462_10752932 | Not Available | 783 | Open in IMG/M |
| 3300030973|Ga0075395_11051948 | Not Available | 693 | Open in IMG/M |
| 3300031057|Ga0170834_108152563 | Not Available | 601 | Open in IMG/M |
| 3300031231|Ga0170824_114566366 | Not Available | 601 | Open in IMG/M |
| 3300031543|Ga0318516_10010335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4485 | Open in IMG/M |
| 3300031543|Ga0318516_10185326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1199 | Open in IMG/M |
| 3300031544|Ga0318534_10002750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7680 | Open in IMG/M |
| 3300031545|Ga0318541_10846253 | Not Available | 510 | Open in IMG/M |
| 3300031549|Ga0318571_10239935 | Not Available | 663 | Open in IMG/M |
| 3300031564|Ga0318573_10585554 | Not Available | 601 | Open in IMG/M |
| 3300031668|Ga0318542_10458350 | Not Available | 661 | Open in IMG/M |
| 3300031679|Ga0318561_10800216 | Not Available | 518 | Open in IMG/M |
| 3300031708|Ga0310686_102968307 | Not Available | 531 | Open in IMG/M |
| 3300031724|Ga0318500_10436858 | Not Available | 654 | Open in IMG/M |
| 3300031744|Ga0306918_10630950 | Not Available | 840 | Open in IMG/M |
| 3300031747|Ga0318502_10954987 | Not Available | 522 | Open in IMG/M |
| 3300031748|Ga0318492_10461109 | Not Available | 672 | Open in IMG/M |
| 3300031765|Ga0318554_10262863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 983 | Open in IMG/M |
| 3300031770|Ga0318521_10506079 | Not Available | 726 | Open in IMG/M |
| 3300031770|Ga0318521_10877804 | Not Available | 548 | Open in IMG/M |
| 3300031771|Ga0318546_10600169 | Not Available | 774 | Open in IMG/M |
| 3300031779|Ga0318566_10490950 | Not Available | 602 | Open in IMG/M |
| 3300031795|Ga0318557_10260391 | Not Available | 795 | Open in IMG/M |
| 3300031860|Ga0318495_10192317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300031879|Ga0306919_10780284 | Not Available | 735 | Open in IMG/M |
| 3300031896|Ga0318551_10086792 | Not Available | 1647 | Open in IMG/M |
| 3300031896|Ga0318551_10644387 | Not Available | 612 | Open in IMG/M |
| 3300031942|Ga0310916_11479796 | Not Available | 554 | Open in IMG/M |
| 3300032001|Ga0306922_10551713 | Not Available | 1225 | Open in IMG/M |
| 3300032009|Ga0318563_10001043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11641 | Open in IMG/M |
| 3300032059|Ga0318533_10749099 | Not Available | 717 | Open in IMG/M |
| 3300032160|Ga0311301_11757069 | Not Available | 742 | Open in IMG/M |
| 3300032205|Ga0307472_100986765 | Not Available | 788 | Open in IMG/M |
| 3300032261|Ga0306920_103708238 | Not Available | 560 | Open in IMG/M |
| 3300033290|Ga0318519_10558152 | Not Available | 693 | Open in IMG/M |
| 3300033290|Ga0318519_10710232 | Not Available | 615 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.04% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.36% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.68% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0735.00001450 | 2166559005 | Simulated | MIHITLNDARCNSLTGRFTCGITPSMGKWSAPAANEVAP |
| Ga0066396_100427181 | 3300004267 | Tropical Forest Soil | MTNTTLNDVRCKGPVGRFTCGIAPGAGKWSAPAANEVAP* |
| Ga0062595_1000044096 | 3300004479 | Soil | MISIALIHAVCKGQTAHFACGLTPNKGKWSSPAANEVAP* |
| Ga0066395_101354704 | 3300004633 | Tropical Forest Soil | MINITLNGARRKGPTGRFTCGITPNLGKWAAPAANEVAR* |
| Ga0066673_105485641 | 3300005175 | Soil | DLIMISITLNGARRKGPMGRFTCGITTNIGKWPAPAANEVAR* |
| Ga0066388_1001316151 | 3300005332 | Tropical Forest Soil | MIHVTPNDARRNSLTSRLTCGITPSAGKWSAPAANEVAP* |
| Ga0066388_1004672863 | 3300005332 | Tropical Forest Soil | MISIALIHAVRKGQARHFACGITPTRGKWSAPAANEVAP* |
| Ga0066388_1052942612 | 3300005332 | Tropical Forest Soil | RQPSGKPSSSPEPTDQGDLVVISIVFIKAVRKGQNGHFSGGITPDSGKWSAPAANEVAP* |
| Ga0066388_1081449661 | 3300005332 | Tropical Forest Soil | EPTDQGDLVMISIALNNSVRKGQTGQFACGITPSVGKWSAPAANEVAP* |
| Ga0066388_1081449701 | 3300005332 | Tropical Forest Soil | EPTDQGDLVMISIALNNSVRKGQTGQFACGITPSVGKWSGPAANEVAP* |
| Ga0070709_100008407 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MISITLNGARRKGPRGRFTCGITPSIGKWAAPAAKEVAR* |
| Ga0070714_1000551261 | 3300005435 | Agricultural Soil | MISITLNGARRKGHTGRFTCGITLGIGKWAAPAANEVAQ* |
| Ga0070714_1006040194 | 3300005435 | Agricultural Soil | MIHITLNDARCNSLTGRFTCGIAPSMGKWSTPAANEVAP* |
| Ga0070711_1001665452 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIIVLINAVRKGQNGHFPDGITPDSGKWSSPAANEVAP* |
| Ga0070708_1001834072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MISITANGARRKGHTGRFTCGITLGIGKWAAPAANEVAQ* |
| Ga0070708_1015603531 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHITLNNARCNSLTGRFTCGIAPSMGKWSTPAANEVAP* |
| Ga0070730_100067321 | 3300005537 | Surface Soil | MIHITLNDARRKVPAGRSTCGITPKAEKWSAPAANEVAP* |
| Ga0070730_100315614 | 3300005537 | Surface Soil | MIHITLNHAPCKGLTGRFTRGTTPNTGKWSAPAANEVAL* |
| Ga0066697_105641341 | 3300005540 | Soil | TEQGDLIMISITLNGARRKGPMGRFTCGITTNIGKWPAPAANEVAR* |
| Ga0070733_106341182 | 3300005541 | Surface Soil | MIIITLNHAVCKGQSGHFTCGITPHVGKWSAPAANEVAP* |
| Ga0066707_105176652 | 3300005556 | Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPPAKEVAR* |
| Ga0066703_102240482 | 3300005568 | Soil | MISITRNHAVCKGLSGHFTCGITPDTGKWSAPAANEVAP* |
| Ga0066654_108470653 | 3300005587 | Soil | MISITLNGARRKGPMGRFTCGITTNIGKWPAPAANEV |
| Ga0066706_106361412 | 3300005598 | Soil | MISITLNGARRKGPMGRFTCGITTNIGKWPAPAANEVAR* |
| Ga0066903_1000615004 | 3300005764 | Tropical Forest Soil | MTNTTLNDVRCKGPVGRFTCGIAPGAGKWSAAAANEVAP* |
| Ga0066903_1001292803 | 3300005764 | Tropical Forest Soil | MISIALIHAVRKGQARHFACGITPTKGKWSAPAANEVAP* |
| Ga0066903_1002495513 | 3300005764 | Tropical Forest Soil | MISIVFINAVRKGQTRHFAGGITPGSGKWSAPAANEVAP* |
| Ga0066903_1002706904 | 3300005764 | Tropical Forest Soil | MIIIAPNHAVRKGQTGQFACGITPSVGKWSAPAANEVAP* |
| Ga0066903_1025139584 | 3300005764 | Tropical Forest Soil | MINITLNGARRKGPTGRFTCGITPNLGKWAAPAASEVAR* |
| Ga0066903_1030320313 | 3300005764 | Tropical Forest Soil | MIHVTLNHARCKRPMGRFTCGITPLAGKWSAPHANEVAP* |
| Ga0066903_1037815422 | 3300005764 | Tropical Forest Soil | MISIALINAVRKGQTRHFAGGITPASGKWSAPAANEVAP* |
| Ga0066903_1043993572 | 3300005764 | Tropical Forest Soil | MINVTLNGARRKGPAGRFTCGITPNLGKWAAPAANEVAR* |
| Ga0066903_1050270263 | 3300005764 | Tropical Forest Soil | PSSSPEPTDQGDLVVISIVFIKAVRKGQNGHFSGGITPDSGKWASPAANEAAP* |
| Ga0066903_1068382322 | 3300005764 | Tropical Forest Soil | MINITLNGARRKGPAGRFTCGITPNIGKWAAPAANEVAR* |
| Ga0066903_1074996101 | 3300005764 | Tropical Forest Soil | MIYITLNDARCKGLTGRFTCGIIPSAGKWSAPAANEAAP* |
| Ga0066903_1088909082 | 3300005764 | Tropical Forest Soil | VQGDLVMINITLNGARRKGPTGRFTCGITPNIGKWAAPAASEVTR* |
| Ga0070717_106871102 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MISITLMHAVRKGQGGHFTCGITLDKWSAPAANEVAQ* |
| Ga0070765_1000965964 | 3300006176 | Soil | MISITLNHAACKGQSSHFTCGIAPNTGKWSAPAANEVAP* |
| Ga0079222_102259403 | 3300006755 | Agricultural Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPAAKEVAR* |
| Ga0079222_113800882 | 3300006755 | Agricultural Soil | MIIIALINAVRKGQNGHFPDGITPDSGKWSSPAANEVAP* |
| Ga0066653_101163662 | 3300006791 | Soil | MISITLNGARRKGPMGRFTCGITTNIGKWAAPAANEVAR* |
| Ga0079221_100370593 | 3300006804 | Agricultural Soil | MINITLNGARRKGPTGRFTCGITSNIGKWAAPAANEVAR* |
| Ga0079221_100454464 | 3300006804 | Agricultural Soil | MISIALIHAVCKGQTAHFACGITPNKGKWSSPAANEVAP* |
| Ga0079221_100657034 | 3300006804 | Agricultural Soil | MIRIALNGARRKGPTGRFTCGITTNIGKSPAPAAGEVAR* |
| Ga0079220_100369623 | 3300006806 | Agricultural Soil | MINITLNGARRKGPMGRFTCGITPNIGKWAAPAAKEVAR* |
| Ga0073928_102873672 | 3300006893 | Iron-Sulfur Acid Spring | MISITRNHAVRKGQSGQFTCGITPSTGKWSAPAANEVAP* |
| Ga0075424_1007156622 | 3300006904 | Populus Rhizosphere | MIHITLNDARCNSLASLFTCGITPSAGKWSAPAANEVAP* |
| Ga0075436_1007781413 | 3300006914 | Populus Rhizosphere | DLAMINITLNGARRKGPTGRFTCGITPNIGKWAAPAAKEVAR* |
| Ga0099828_100728321 | 3300009089 | Vadose Zone Soil | MIHITLNGARCKSPMGHFTCGITPSMGKWSAPAANEVAP* |
| Ga0099827_100530214 | 3300009090 | Vadose Zone Soil | MISITLNHAVCKGQSSHFTCGITPDMGKWSAPAANEVAQ* |
| Ga0126380_101595992 | 3300010043 | Tropical Forest Soil | MISIAFINGVRKSQNGHFSGGITPDSGKWSAPAANEVAP* |
| Ga0126384_105490413 | 3300010046 | Tropical Forest Soil | MISIALISAVRKGQTGHFTRGITRSSGKWSAPAANEVAP* |
| Ga0126373_119265503 | 3300010048 | Tropical Forest Soil | ISIALIHAVRKGQARHFACGITPTKGKWSAPAANEVAP* |
| Ga0126370_100743104 | 3300010358 | Tropical Forest Soil | MINITLNGARRKGPTGRFTCGITPNVGQWAAPAAKEVADDHPRSGHR |
| Ga0126370_101490412 | 3300010358 | Tropical Forest Soil | MISIALNNSVRKGQTGQFACGITPSVGKWSAPAANEVAP* |
| Ga0126372_107081521 | 3300010360 | Tropical Forest Soil | MISIALNNSVRKGQTGQFACGITPSVGKWSGPAANEVAP* |
| Ga0126378_100560195 | 3300010361 | Tropical Forest Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPAAREVAR* |
| Ga0126378_101041865 | 3300010361 | Tropical Forest Soil | VINITLNGARCKGPTGRFTCGITPNIGKWAAPAANEVAP* |
| Ga0126378_106535811 | 3300010361 | Tropical Forest Soil | MISIALIRAVRKGQTGHFTRGITRSSGKWSAPAANEVAP* |
| Ga0126379_137809311 | 3300010366 | Tropical Forest Soil | MISIAFINGVRKSQNGHFSGGITPDSGKWSAPAANEVA |
| Ga0126381_1001720885 | 3300010376 | Tropical Forest Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPAANEVAP* |
| Ga0126381_1002530472 | 3300010376 | Tropical Forest Soil | MISIALINAVRKGQTRHFAGGITPESGKWSAPAANEVAP* |
| Ga0126381_1009042322 | 3300010376 | Tropical Forest Soil | MISIALINAVRKGQTRHFAGGITPHSGKWSAPAANEVAP* |
| Ga0136449_1008691644 | 3300010379 | Peatlands Soil | MIRIALNGARRKGHTAHFTCGITPTMGKWPAPAANGVAQ* |
| Ga0126383_125300522 | 3300010398 | Tropical Forest Soil | MISIALIHAVCKGQTAHFACGIAPNKGKWSAPAANEVAP* |
| Ga0126383_131383701 | 3300010398 | Tropical Forest Soil | MISIAFIGAVRKGQTGHFARGITRNSGKWSAPAANEMAP* |
| Ga0126350_102579291 | 3300010880 | Boreal Forest Soil | MISITLNHAACKGQTSHFTCGIAPNTGKWSAPAANEVAP* |
| Ga0137776_12176911 | 3300010937 | Sediment | MISITLNGARRKGPKGRFTCGITRDIERWAAAAKEVAR* |
| Ga0137776_13792414 | 3300010937 | Sediment | MIIITLNRARRKGHMGRFTCGIIPGIGKWAAPAANQVAQ* |
| Ga0150983_124454182 | 3300011120 | Forest Soil | MISIALNGARRKGHTGRFTCGITLGIGKWAAPAANEVAQ* |
| Ga0150983_128076491 | 3300011120 | Forest Soil | MISITRNHAVRKGQNGQFTCGITSTNGKWSAPAANEVAP* |
| Ga0150983_146061351 | 3300011120 | Forest Soil | MIRIALNGARRKGHRAHFTCGITPNMGKWPAPAANEVAQ* |
| Ga0137391_103700572 | 3300011270 | Vadose Zone Soil | MMSITLNHAVCTGQTSHFTCGIAPNTGKWAAPAANEVAP* |
| Ga0137383_108698052 | 3300012199 | Vadose Zone Soil | MISIILNHAVCKGQSGHFTCGITPNTGKWSAPAANEVAQ* |
| Ga0137362_107879351 | 3300012205 | Vadose Zone Soil | MMTITLKHAVCKGQTSHFTRGIARNTGKWAAPAANEVAP* |
| Ga0137376_109256261 | 3300012208 | Vadose Zone Soil | GDLVMIHITLNDARCNSLTGRFTCGITSRMGKWSAPAANEVAP* |
| Ga0137384_100565521 | 3300012357 | Vadose Zone Soil | MISITRNNAVCKGQSRHFTCGTTPGTGKWSATAANEVAQ* |
| Ga0137390_104457484 | 3300012363 | Vadose Zone Soil | MMTITLNHAVCTGQTSHFTCGIAPNTGKWAAPAANEVAP* |
| Ga0182033_106760461 | 3300016319 | Soil | MISIALINAVRKGQTRHFAGGITPASGKWSAPAANE |
| Ga0182040_115772321 | 3300016387 | Soil | SIALINAVRKGQTRHFAGGITPASGKWSAPAANEVAP |
| Ga0066655_101099224 | 3300018431 | Grasslands Soil | MISITLNGARRKGPMGRFTCGITTNIGKWPAPAANEVAR |
| Ga0179592_100185544 | 3300020199 | Vadose Zone Soil | MMTITLNHAVCKGQTSHFTRGIARNTGKWAAPAANEVAP |
| Ga0210395_100122095 | 3300020582 | Soil | MISITRNHAVRKGQNGQFTCGITSTNGKWSAPAANEVAP |
| Ga0210395_103171084 | 3300020582 | Soil | TKLPTARTDQGDLVMISITRNHAVRKGQSGQFTCGITPSTGKWSAPAANEVAP |
| Ga0210405_101732952 | 3300021171 | Soil | MISITLNHAACKGQSSHFTCGIAPNTGKWSAPAANEVAP |
| Ga0210405_103150142 | 3300021171 | Soil | MISITRNHAVRKGQSGQFTCGITPITGKWSAPAANEVAP |
| Ga0210405_110796043 | 3300021171 | Soil | ITRNHAVRKGQSGQFTCGITPITGKWSAPAANEVAP |
| Ga0210396_102478702 | 3300021180 | Soil | MISITRNHAVRKGQSGQFTCGITPSTGKWSAPAANEVAP |
| Ga0210394_103690971 | 3300021420 | Soil | MISITRNHAGRKGQSGQFTCGITLTTGKWSAPAANEVAP |
| Ga0210384_102368203 | 3300021432 | Soil | MIHITLNYGRCKSPTGCFTCGIDPDTGKWSAPAANEVAP |
| Ga0210402_106981394 | 3300021478 | Soil | MISITLNHAVCKGQSSHSTCGITPGMGKWSAPAANEVAP |
| Ga0210402_108443851 | 3300021478 | Soil | MIHITLNDARCNNLTDRFTCGINPSMGKWSAPAANEVAP |
| Ga0210409_105171691 | 3300021559 | Soil | MISITLNHAACKGQSSHFTCGIAPNTGKWSAPAANEVA |
| Ga0210409_111295571 | 3300021559 | Soil | TDQGDLVMISITLNHAACKGQSSHFTCGIAPNTGKWSAPAANEVAP |
| Ga0126371_105226732 | 3300021560 | Tropical Forest Soil | MIHVTPNHARCKRPMGRFTCGITPITGKWSAPHANEVAP |
| Ga0126371_111406541 | 3300021560 | Tropical Forest Soil | PSGKPSSSPEPTDQGDLVMISIALIHAVRKGQARHFACGITPTKGKWSAPAANEVAP |
| Ga0126371_121859522 | 3300021560 | Tropical Forest Soil | MISIALINAVRKGQTGHFAGGITPGSGKWSAPAANEVAP |
| Ga0242657_10820041 | 3300022722 | Soil | MSITLNHAACKGQTSHFTRGIAPSTGKWAAPAANEVAP |
| Ga0207692_103872362 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MISIAPIHAVCKGQTAHFACGITPSKGKWSSPAANEAAP |
| Ga0207692_111952362 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TDQGDLVIMSITLNHAACKGQTSHFTCGIAPSTGKWAAPAANEVAP |
| Ga0207684_1000065313 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MISITLIHAVRKGQSGHFTCGITLDKWSAPAASEVAQ |
| Ga0207693_100967335 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIIVLINAVRKGQNGHFPDGITPDSGKWSSPAANEVAP |
| Ga0207646_1000005810 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MISIALIHAVRKGQSGHFTCGITLDKWSAPAASEVAQ |
| Ga0209178_14127182 | 3300027725 | Agricultural Soil | MIIIALINAVRKGQNGHFPDGITPDSGKWSSPAANEVAP |
| Ga0209073_100622122 | 3300027765 | Agricultural Soil | MISIALIHAVCKGQTAHFACGITPNKGKWSSPAANEVAP |
| Ga0209166_1000052730 | 3300027857 | Surface Soil | MIHITLNDARRKVPAGRSTCGITPKAEKWSAPAANEVAP |
| Ga0209166_100770301 | 3300027857 | Surface Soil | MIHITLNHAPCKGLTGRFTRGTTPNTGKWSAPAANEVAL |
| Ga0209590_100519654 | 3300027882 | Vadose Zone Soil | MISITLNHAVCKGQSSHFTCGITPDMGKWSAPAANEVAQ |
| Ga0209068_109246791 | 3300027894 | Watersheds | MIRIALNGARRKGPTGRFTCGIIPGIGKGSALAANEVAR |
| Ga0209488_103412361 | 3300027903 | Vadose Zone Soil | MIHITLNGARCKSPMGHFTCGITPSMGKWSAPAANEVAP |
| Ga0210254_104178541 | 3300030602 | Soil | MISITRNHAVRKGQSGQFTCGITPTTGKWSAPAANEVAP |
| Ga0265462_107529322 | 3300030738 | Soil | MIRIALNGARRKGRTGHFTCGITPNTGKWAALAANEVAQ |
| Ga0075395_110519482 | 3300030973 | Soil | MIHITLNDARCNSLTGRFTCGITPRMGKWSAPAANEVAP |
| Ga0170834_1081525631 | 3300031057 | Forest Soil | MISITLNHTVCKGQSSHSTRGITPSMGKWSAPAANEVAP |
| Ga0170824_1145663661 | 3300031231 | Forest Soil | MISITLNHTVCKGQSSHSTCGITPDMGKWSAPAANEVAP |
| Ga0318516_100103355 | 3300031543 | Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPAASEVAR |
| Ga0318516_101853262 | 3300031543 | Soil | MIYITLNDARCKGLTGRFTCGIIPHVGKWSAPAANEVAP |
| Ga0318534_100027504 | 3300031544 | Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPAASEVTR |
| Ga0318541_108462531 | 3300031545 | Soil | MISIALINAVRKGQTRHFAGGITPASGKWSAPAANEVAP |
| Ga0318571_102399351 | 3300031549 | Soil | ITLKRARCKGPAGRFTCGITANIKKWAATAVNEVAR |
| Ga0318573_105855541 | 3300031564 | Soil | MIHITRNDARCKGLTGRFTCGIIPSVGKWSAPAANEVAP |
| Ga0318542_104583501 | 3300031668 | Soil | MISIALINAVRKGQTRHFAGGINPDSGKWSAPAANEVAP |
| Ga0318561_108002161 | 3300031679 | Soil | TLNDARCKGLTGRFTCGIIPHVGKWSAPAANEVAP |
| Ga0310686_1029683072 | 3300031708 | Soil | MIRIALNGARRKGHTGHFTCGITPRMGKWPAPAANEVAR |
| Ga0318500_104368583 | 3300031724 | Soil | MISIALINAVRKGQTGHFAGGITPGSGKWSAPAANELAP |
| Ga0306918_106309503 | 3300031744 | Soil | MISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVTP |
| Ga0318502_109549871 | 3300031747 | Soil | LVMISIALINAVRKGQTGHFVGGITPGSGKWSAPAANELAP |
| Ga0318492_104611092 | 3300031748 | Soil | MISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVAP |
| Ga0318554_102628634 | 3300031765 | Soil | PTDQGDLVMISIALINAVRKGQTGHFAGGITPGSGKWSAPAANELAP |
| Ga0318521_105060793 | 3300031770 | Soil | PTDQGDLVMISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVAP |
| Ga0318521_108778041 | 3300031770 | Soil | VFINAVRKGQTRHFASGITPGSGKWSAPAANEVAP |
| Ga0318546_106001691 | 3300031771 | Soil | MISIVFINAVRKGQTRHFASGITPGSGKWSAPAANELAP |
| Ga0318566_104909502 | 3300031779 | Soil | KPSSSPEPTDQGDLVMISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVAP |
| Ga0318557_102603914 | 3300031795 | Soil | IALISAVRKGQTRHFAGGINPASGKWSAPAANEVAP |
| Ga0318495_101923174 | 3300031860 | Soil | EPTDQGNLVMISIAPNHAVRKGQTGHFAGEIAPSQGKWSAPAANEVAP |
| Ga0306919_107802842 | 3300031879 | Soil | MISIALINAVRKGQTRHFAGGINPASGKWSAPAANEVAP |
| Ga0318551_100867925 | 3300031896 | Soil | DQGDLVMISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVAP |
| Ga0318551_106443873 | 3300031896 | Soil | IALINAVRKGQTGHFAGGITPGSGKWSAPAANELAP |
| Ga0310916_114797961 | 3300031942 | Soil | PSGKPSSSPEPTDQGDLVMISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVAP |
| Ga0306922_105517133 | 3300032001 | Soil | MISIAPNHAVRKGQTGHFAGEIAPSQGKWSAPAANEVAP |
| Ga0318563_1000104310 | 3300032009 | Soil | MINITLNGARRKGPTGRFTCGITPNIGKWAAPAAREVTR |
| Ga0318533_107490991 | 3300032059 | Soil | PSGKPSSSPEPTDQGDLVMISIALINAVRKGQTRHFAGGINPASGKWSAPAANEVAP |
| Ga0311301_117570692 | 3300032160 | Peatlands Soil | MIRIALNGARRKGHTAHFTCGITPTMGKWPAPAANGVAQ |
| Ga0307472_1009867652 | 3300032205 | Hardwood Forest Soil | MIHITLNDARCNSLTGRFTCGITPRMGKWSTPAANEVAP |
| Ga0306920_1037082381 | 3300032261 | Soil | GKPRSSPEPTDQGDLVMLSIALINAVRKGQTGHFAGGITPGSGKWSAPAANELAP |
| Ga0318519_105581523 | 3300033290 | Soil | ISIAPNHAVRKGQTGHFAGEITPSQGKWSAPAANEVAP |
| Ga0318519_107102321 | 3300033290 | Soil | MISIVFINAVRKGQTRHFASGITPGSGEWSAPAANELAP |
| ⦗Top⦘ |