| Basic Information | |
|---|---|
| Family ID | F048950 |
| Family Type | Metagenome |
| Number of Sequences | 147 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTLEELISAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 65.31 % |
| % of genes near scaffold ends (potentially truncated) | 27.89 % |
| % of genes from short scaffolds (< 2000 bps) | 89.12 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.76 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (81.633 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.456 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.76 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| c.49.2.0: automated matches | d5ik2g_ | 5ik2 | 0.89547 |
| f.5.1.0: automated matches | d1yc9a_ | 1yc9 | 0.89236 |
| a.47.2.1: t-snare proteins | d1fioa_ | 1fio | 0.88 |
| c.108.1.23: 5' nucleotidase-like | d4ohfa1 | 4ohf | 0.87857 |
| a.26.1.1: Long-chain cytokines | d1cnt1_ | 1cnt | 0.87854 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF08774 | VRR_NUC | 55.78 |
| PF01464 | SLT | 4.08 |
| PF01844 | HNH | 2.04 |
| PF02557 | VanY | 0.68 |
| PF05065 | Phage_capsid | 0.68 |
| PF05869 | Dam | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.60 % |
| Unclassified | root | N/A | 3.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002161|JGI24766J26685_10062231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300002408|B570J29032_109481093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300002835|B570J40625_100759438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 858 | Open in IMG/M |
| 3300002835|B570J40625_100811342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300003413|JGI25922J50271_10130048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300004240|Ga0007787_10270322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300004369|Ga0065726_15416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14472 | Open in IMG/M |
| 3300005581|Ga0049081_10058059 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300005662|Ga0078894_11101626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300005662|Ga0078894_11424756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300005942|Ga0070742_10115259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300006639|Ga0079301_1032759 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
| 3300006639|Ga0079301_1199004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300006802|Ga0070749_10092654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1794 | Open in IMG/M |
| 3300006802|Ga0070749_10131315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
| 3300006802|Ga0070749_10273121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300006802|Ga0070749_10285874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300006802|Ga0070749_10390069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300006802|Ga0070749_10655117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300006803|Ga0075467_10506138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300006803|Ga0075467_10555232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300006805|Ga0075464_10454581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300006805|Ga0075464_10923748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300007538|Ga0099851_1066510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1401 | Open in IMG/M |
| 3300007538|Ga0099851_1078320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
| 3300007538|Ga0099851_1178403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300007538|Ga0099851_1253250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300007538|Ga0099851_1366020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300007540|Ga0099847_1027982 | All Organisms → Viruses → Predicted Viral | 1817 | Open in IMG/M |
| 3300007540|Ga0099847_1056266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300007540|Ga0099847_1060218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
| 3300007540|Ga0099847_1069739 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300007540|Ga0099847_1119707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300007540|Ga0099847_1134591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300007540|Ga0099847_1194693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300007540|Ga0099847_1195824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300007541|Ga0099848_1110457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300007541|Ga0099848_1137812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300007541|Ga0099848_1172658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300007541|Ga0099848_1325937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300007542|Ga0099846_1050091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1584 | Open in IMG/M |
| 3300007681|Ga0102824_1006657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3272 | Open in IMG/M |
| 3300007734|Ga0104986_1727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26290 | Open in IMG/M |
| 3300007960|Ga0099850_1073413 | All Organisms → Viruses → Predicted Viral | 1432 | Open in IMG/M |
| 3300007960|Ga0099850_1119759 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300007960|Ga0099850_1224080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300008266|Ga0114363_1058404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1509 | Open in IMG/M |
| 3300008266|Ga0114363_1094413 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300008266|Ga0114363_1175931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300008450|Ga0114880_1127272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300008450|Ga0114880_1202877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300009059|Ga0102830_1131080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300009085|Ga0105103_10362622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300009451|Ga0127402_1087116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300009466|Ga0126448_1069476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300009466|Ga0126448_1081880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300009470|Ga0126447_1145847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300009474|Ga0127390_1105026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300010299|Ga0129342_1137040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300010316|Ga0136655_1034145 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
| 3300010316|Ga0136655_1063811 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300010316|Ga0136655_1172065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300010354|Ga0129333_10488598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300010354|Ga0129333_10783674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300010368|Ga0129324_10033347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2445 | Open in IMG/M |
| 3300010370|Ga0129336_10355574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300010370|Ga0129336_10684816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300011335|Ga0153698_1249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24740 | Open in IMG/M |
| 3300013004|Ga0164293_10636367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300017747|Ga0181352_1089786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300019784|Ga0181359_1080019 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
| 3300020513|Ga0208090_1041450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300020543|Ga0208089_1027556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300021952|Ga0213921_1005872 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300021952|Ga0213921_1047897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300021956|Ga0213922_1000748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13814 | Open in IMG/M |
| 3300021961|Ga0222714_10394160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300022053|Ga0212030_1009746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| 3300022063|Ga0212029_1011573 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300022176|Ga0212031_1055909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300022179|Ga0181353_1031407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
| 3300022179|Ga0181353_1101821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300022198|Ga0196905_1091095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300022200|Ga0196901_1036597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1890 | Open in IMG/M |
| 3300022200|Ga0196901_1106565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
| 3300023174|Ga0214921_10024945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6139 | Open in IMG/M |
| 3300024346|Ga0244775_10004418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14577 | Open in IMG/M |
| 3300025543|Ga0208303_1013510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2457 | Open in IMG/M |
| 3300025543|Ga0208303_1056515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300025543|Ga0208303_1064495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300025646|Ga0208161_1074166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300025646|Ga0208161_1119103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300025647|Ga0208160_1032112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1584 | Open in IMG/M |
| 3300025647|Ga0208160_1096985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300025655|Ga0208795_1047520 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300025655|Ga0208795_1104339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300025687|Ga0208019_1059285 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300025687|Ga0208019_1207406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300025889|Ga0208644_1290156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300027114|Ga0208009_1008703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2572 | Open in IMG/M |
| 3300027499|Ga0208788_1048827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300027525|Ga0208437_1020614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300027578|Ga0255075_1092572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300027659|Ga0208975_1083174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300027805|Ga0209229_10077972 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
| 3300028025|Ga0247723_1099077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300031539|Ga0307380_10033335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5907 | Open in IMG/M |
| 3300031539|Ga0307380_10341610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300031565|Ga0307379_10778178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300031565|Ga0307379_11457727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300031566|Ga0307378_10694579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300031669|Ga0307375_10663746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300031673|Ga0307377_10403851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
| 3300031951|Ga0315904_10482096 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300032116|Ga0315903_11016159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300033816|Ga0334980_0047325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1823 | Open in IMG/M |
| 3300033816|Ga0334980_0089919 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300033981|Ga0334982_0466762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300033993|Ga0334994_0243089 | Not Available | 946 | Open in IMG/M |
| 3300033993|Ga0334994_0529353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300033993|Ga0334994_0543121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300033995|Ga0335003_0019612 | All Organisms → Viruses → Predicted Viral | 3634 | Open in IMG/M |
| 3300033996|Ga0334979_0130493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1537 | Open in IMG/M |
| 3300034012|Ga0334986_0215447 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300034012|Ga0334986_0470867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300034021|Ga0335004_0604521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300034061|Ga0334987_0374915 | Not Available | 911 | Open in IMG/M |
| 3300034061|Ga0334987_0524241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300034062|Ga0334995_0072200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2713 | Open in IMG/M |
| 3300034062|Ga0334995_0129476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
| 3300034062|Ga0334995_0146591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1710 | Open in IMG/M |
| 3300034066|Ga0335019_0106525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1875 | Open in IMG/M |
| 3300034073|Ga0310130_0027524 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300034096|Ga0335025_0439628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300034101|Ga0335027_0039086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3912 | Open in IMG/M |
| 3300034101|Ga0335027_0059408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3053 | Open in IMG/M |
| 3300034101|Ga0335027_0238734 | Not Available | 1264 | Open in IMG/M |
| 3300034103|Ga0335030_0447218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300034106|Ga0335036_0474627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300034106|Ga0335036_0651486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300034112|Ga0335066_0535811 | Not Available | 615 | Open in IMG/M |
| 3300034112|Ga0335066_0645598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300034118|Ga0335053_0638880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300034119|Ga0335054_0497894 | Not Available | 682 | Open in IMG/M |
| 3300034120|Ga0335056_0618450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300034122|Ga0335060_0440788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300034272|Ga0335049_0541742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 33.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.44% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 4.76% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 3.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.72% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.72% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.04% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.04% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.36% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.36% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.68% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.68% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.68% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24766J26685_100622312 | 3300002161 | Freshwater And Sediment | MTIDELISAIERLQSIYDRMDDEDQREGKQYVRWAIKHLADKVWSASL* |
| B570J29032_1094810932 | 3300002408 | Freshwater | MTLEELITNIERLQSVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL* |
| B570J40625_1007594381 | 3300002835 | Freshwater | MTLEELITNIERLQTVYNSMVDPEQHEARQYVRWAIKHLADKTYMAS |
| B570J40625_1008113421 | 3300002835 | Freshwater | NIERLQVVYNSMVDPEQHEARQYVRWAIKQLADKTYMASL* |
| JGI25922J50271_101300481 | 3300003413 | Freshwater Lake | MTLEELITNIERLQSVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0007787_102703222 | 3300004240 | Freshwater Lake | MTLEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0065726_1541620 | 3300004369 | Saline | MAIEDLITAIERLQAVYSAMDDDQREAKQYVRWAIKHLADKCFMAAL* |
| Ga0049081_100580592 | 3300005581 | Freshwater Lentic | MTLDELISAIERLQSIYDRMDEEDQREAKQYVRWAIKHLADKVWSASL* |
| Ga0078894_111016262 | 3300005662 | Freshwater Lake | MTLEELITNIERLQIVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL* |
| Ga0078894_114247561 | 3300005662 | Freshwater Lake | MTLEELITNIERLQTVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL* |
| Ga0070742_101152592 | 3300005942 | Estuarine | MTLDELISAIERLQSIYDRMDNEDQREAKQFVRWAIKHLADKVWSASL* |
| Ga0079301_10327593 | 3300006639 | Deep Subsurface | MTLEELITNIERLQAVYNSMIDPEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0079301_11990041 | 3300006639 | Deep Subsurface | IERLQSIYDRMDDEDQREAKQFVRWAIKHLADKVWSASL* |
| Ga0070749_100926542 | 3300006802 | Aqueous | MTLEELVSAIERLQTVYNVMDDDQHEAKQYVRWAIKHLADKAYMASL* |
| Ga0070749_101313152 | 3300006802 | Aqueous | MTLEELISAIERLQAVYDSIEDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0070749_102731213 | 3300006802 | Aqueous | LEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0070749_102858741 | 3300006802 | Aqueous | MTLDELISAIERLQSIYDRMDNEDQREAKQFVRWAIKHLADKAWSASL* |
| Ga0070749_103900692 | 3300006802 | Aqueous | MTLEELISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0070749_106551172 | 3300006802 | Aqueous | MTLDELINAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL* |
| Ga0075467_105061382 | 3300006803 | Aqueous | MTLEELISAIERLQSIYDRMDNEDQREAKQFVRWAIKHLADKVWSAAL* |
| Ga0075467_105552322 | 3300006803 | Aqueous | AIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL* |
| Ga0075464_104545811 | 3300006805 | Aqueous | MTLEELITAIERLQTVYNSMIDEEQHEAKRYIRWAIKHLSDKTYMAAL* |
| Ga0075464_109237482 | 3300006805 | Aqueous | MTLDELISAIERLQSIYDRMDNEDQRESKQFVRWAIKHLADKVWSSAL* |
| Ga0099851_10665102 | 3300007538 | Aqueous | MTLEEMISAIERLQAVYDLMVDQEQHEAKQYVRWAIKHLADKTYMAAL* |
| Ga0099851_10783203 | 3300007538 | Aqueous | MRMTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0099851_11784033 | 3300007538 | Aqueous | MTLEELINAIERLQAVYDSMVDQEQHDAKQYIRWAIKHLADKTYMAAL* |
| Ga0099851_12532502 | 3300007538 | Aqueous | MTLEELISAIERLQAVYDCIVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0099851_13660201 | 3300007538 | Aqueous | KQSDWSIAMTLEELISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0099847_10279823 | 3300007540 | Aqueous | MDIKDLITAIERLQVVYSAMDDDQHEAKQYVRWAIKHLADKCYMAAL* |
| Ga0099847_10562662 | 3300007540 | Aqueous | VTLDELISAIERLQAVYDTMQEDQHEAKQYIRWAIKHLSDKTYFAAL* |
| Ga0099847_10602184 | 3300007540 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKIY |
| Ga0099847_10697393 | 3300007540 | Aqueous | MTLDELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0099847_11197073 | 3300007540 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADK |
| Ga0099847_11345912 | 3300007540 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL* |
| Ga0099847_11946931 | 3300007540 | Aqueous | ISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKIYMAAL* |
| Ga0099847_11958243 | 3300007540 | Aqueous | MTLEELISAIERLQAVYDSIGDQEQHETKQYIRWAIKHLADKTY |
| Ga0099848_11104572 | 3300007541 | Aqueous | MTLEELINAIERLQAVYDLMVDSEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0099848_11378122 | 3300007541 | Aqueous | MDIENLITAIERLQAVYSAMDDDDQREAKQYVRWAIKHLADKCYMAAL* |
| Ga0099848_11726582 | 3300007541 | Aqueous | MTLEELISAIERLQAVYDSIADQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0099848_13259371 | 3300007541 | Aqueous | MTLEELICAIERLQAVYDSIIDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0099846_10500911 | 3300007542 | Aqueous | ISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0102824_10066574 | 3300007681 | Estuarine | MTLDELISAIERLQSIYDRMDDEDQREAKQFVRWAIKHLADKVWSASL* |
| Ga0104986_172727 | 3300007734 | Freshwater | MTLDELISAIERLQSIYDRMNEDDQREAKQCVRWAIKHLADKTYMASL* |
| Ga0099850_10734133 | 3300007960 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0099850_11197592 | 3300007960 | Aqueous | MTLEELINAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL* |
| Ga0099850_12240802 | 3300007960 | Aqueous | MTLDELINAIERLQAVYDLMVDQEQHEAKQYVRWAIKHLADKTYMAAL* |
| Ga0114363_10584043 | 3300008266 | Freshwater, Plankton | MTLDELISAIERLQSIYDRMDNEDQREAKQFVRWAIKHLAYKVWSAAL* |
| Ga0114363_10944132 | 3300008266 | Freshwater, Plankton | MTLEELITNIERLQVVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL* |
| Ga0114363_11759311 | 3300008266 | Freshwater, Plankton | EMTLEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0114880_11272723 | 3300008450 | Freshwater Lake | LISAIERLQSIYDRMDDEDQREAKQFVRWAIKHLADKVWSASL* |
| Ga0114880_12028771 | 3300008450 | Freshwater Lake | MTLDELISAIERLQSIYDRMDDEDQREAKQFVRWAIKHLADKVWS |
| Ga0102830_11310801 | 3300009059 | Estuarine | IERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL* |
| Ga0105103_103626222 | 3300009085 | Freshwater Sediment | MEMTLLEMISAIERLQALYNTINDGEQHEAKQYVRWAIKHLADKIYFEVI* |
| Ga0127402_10871162 | 3300009451 | Meromictic Pond | MTLEELISAIERLQSVYDSIVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0126448_10694762 | 3300009466 | Meromictic Pond | MTLEELINAIERLQAVYDSMVDQEQNDAKQYVRWAIKHLADKTYMAAL* |
| Ga0126448_10818802 | 3300009466 | Meromictic Pond | MTLNELISAIERLQSIYDRMDNEDQREAKQFVRWAIKHLADKVWSAAL* |
| Ga0126447_11458472 | 3300009470 | Meromictic Pond | QAVYDSIVDQEQHETEQYIRWAIKHLADKTYMAAL* |
| Ga0127390_11050262 | 3300009474 | Meromictic Pond | MTLEELITNIERLQTVYNSMVDPEQHEARQYVRWAIKHLADKVWSAAL* |
| Ga0129342_11370403 | 3300010299 | Freshwater To Marine Saline Gradient | MTLEELICAIERLQAVYDSMVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0136655_10341454 | 3300010316 | Freshwater To Marine Saline Gradient | MTLEELISAIERLQAVYDSIVDQEQHEAKQYIRWAIKHLADKTYMAAL* |
| Ga0136655_10638111 | 3300010316 | Freshwater To Marine Saline Gradient | IKDLITAIERLQVVYSAMDDDQHEAKQYVRWAIKHLADKCYMAAL* |
| Ga0136655_11720652 | 3300010316 | Freshwater To Marine Saline Gradient | MTLEELICAIERLQAVYDSMVDSEQHETKQYIRWAIKHLADKTYMAAM* |
| Ga0129333_104885982 | 3300010354 | Freshwater To Marine Saline Gradient | MTLEELITNIERLQVVYNSMVDPEQHEARQYVRWAIKQLADKTYMASL* |
| Ga0129333_107836742 | 3300010354 | Freshwater To Marine Saline Gradient | MTLEELITNIERLQAVYNSMVDPEQHESRQYVRWAIKHLADKTYMAAL* |
| Ga0129324_100333475 | 3300010368 | Freshwater To Marine Saline Gradient | MTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKIYMAAL* |
| Ga0129336_103555741 | 3300010370 | Freshwater To Marine Saline Gradient | MTLEELLSAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADKTYMAAL* |
| Ga0129336_106848162 | 3300010370 | Freshwater To Marine Saline Gradient | MTLEELINAIERLQAVYDLMVEEDQREAKQYVRWAIKHLADKTYMAAL* |
| Ga0153698_124918 | 3300011335 | Freshwater | MTLEELISAIERLQTVYNSMVEEDQREAKQYVRWAIKRLADKAYMAAL* |
| Ga0164293_106363672 | 3300013004 | Freshwater | MEMTLEEMITAIERLQAVYNLMVEEDQREAKQYVRWAIKNLADKAYMAAL* |
| Ga0181352_10897861 | 3300017747 | Freshwater Lake | WTQKGKEMTLEELITNIERLQSVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL |
| Ga0181359_10800193 | 3300019784 | Freshwater Lake | MTLEELINAIERLQAVYDSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0208090_10414502 | 3300020513 | Freshwater | MTLEELITNIERLQTVYNSMVDPEQHEARQYVRWAIKHLADKT |
| Ga0208089_10275562 | 3300020543 | Freshwater | MTLEELITNIERLQVVYNSMVDPEQHEARQYVRWAIKQLADKTYMASL |
| Ga0213921_10058723 | 3300021952 | Freshwater | MTLDELISAIERLQAVYDVMSDEDQSEARTKIRWAIKHLADKAWSAAL |
| Ga0213921_10478972 | 3300021952 | Freshwater | MNLEELISAIERLQAVYDAMTDEDQSEARTKIRWAIKHLADKAWSASL |
| Ga0213922_100074823 | 3300021956 | Freshwater | MFMMLWSFTMTLDELISAIERLQAVYDVMSDEDQSEARTKIRWAIKHLADKAWSAAL |
| Ga0222714_103941602 | 3300021961 | Estuarine Water | MTLDELINAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0212030_10097463 | 3300022053 | Aqueous | MTLEEMISAIERLQAVYDLMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0212029_10115732 | 3300022063 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0212031_10559092 | 3300022176 | Aqueous | MTLEELISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLA |
| Ga0181353_10314074 | 3300022179 | Freshwater Lake | MTLEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYI |
| Ga0181353_11018212 | 3300022179 | Freshwater Lake | MTLEELITNIERLQSVYNSMVDPEQHEARQYVRWAIKHLADKTYMALL |
| Ga0196905_10910952 | 3300022198 | Aqueous | MTLEELINAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0196901_10365974 | 3300022200 | Aqueous | MPGMRMTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0196901_11065653 | 3300022200 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0214921_100249455 | 3300023174 | Freshwater | MTLEELITNIERLQVVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL |
| Ga0244775_1000441822 | 3300024346 | Estuarine | MTLEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0208303_10135102 | 3300025543 | Aqueous | MTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKIYMAAL |
| Ga0208303_10565152 | 3300025543 | Aqueous | MTLDELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0208303_10644953 | 3300025543 | Aqueous | MRMTLEELISAIERLQAVYDSMVDQEQHEARQYVRWAIKHLADKTYMA |
| Ga0208161_10741662 | 3300025646 | Aqueous | MDIKDLITAIERLQVVYSAMDDDQHEAKQYVRWAIKHLADKCYMAAL |
| Ga0208161_11191032 | 3300025646 | Aqueous | MTLEELICAIERLQAVYDSIIDQEQHETKQYIRWAIKHLADKTYMAAL |
| Ga0208160_10321124 | 3300025647 | Aqueous | ISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADKTYMAAL |
| Ga0208160_10969851 | 3300025647 | Aqueous | MTLEELISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLAD |
| Ga0208795_10475204 | 3300025655 | Aqueous | MTLEELISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADK |
| Ga0208795_11043392 | 3300025655 | Aqueous | MISAIERLQAVYDLMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0208019_10592853 | 3300025687 | Aqueous | MTLEELISAIERLQAVYDSIEDQEQHETKQYIRWAIKHLADKTYMAAL |
| Ga0208019_12074062 | 3300025687 | Aqueous | MTLEELINAIERLQAVYDLMVDSEQHETKQYIRWAIKHLADKTYMAAL |
| Ga0208644_12901562 | 3300025889 | Aqueous | MTLEELVSAIERLQTVYNVMDDDQHEAKQYVRWAIKHLADKAYMASL |
| Ga0208009_10087036 | 3300027114 | Deep Subsurface | MTLEELITNIERLQSVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0208788_10488272 | 3300027499 | Deep Subsurface | MTLEELITNIERLQAVYNSMIDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0208437_10206143 | 3300027525 | Estuarine | MTLDELISAIERLQSIYDRMDDEDQREAKQFVRWAIKHLADKVWSASL |
| Ga0255075_10925722 | 3300027578 | Freshwater | EMTLEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0208975_10831742 | 3300027659 | Freshwater Lentic | MTLDELISAIERLQSIYDRMDEEDQREAKQYVRWAIKHLADKVWSASL |
| Ga0209229_100779723 | 3300027805 | Freshwater And Sediment | MTIDELISAIERLQSIYDRMDDEDQREGKQYVRWAIKHLADKVWSASL |
| Ga0247723_10990772 | 3300028025 | Deep Subsurface Sediment | MTLEELITNIERLQIVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0307380_100333353 | 3300031539 | Soil | MDIKDLITAIERLQAVYDSMVDQEQHEAKQYVRWAIKHLADKCYMAAL |
| Ga0307380_103416103 | 3300031539 | Soil | MTLDELINAIERLQTVYDSMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0307379_107781782 | 3300031565 | Soil | GKQSDWGIAMTLEELISAIERLQAVYDSIADQEQHETKQYIRWAIKHLADKTYMAAL |
| Ga0307379_114577272 | 3300031565 | Soil | MTLEELISAIERLQAVYDSIVDQEQHETKQYVRWAIKHLADKTYMAAL |
| Ga0307378_106945793 | 3300031566 | Soil | MTLEELISAIERLQAVYDCMVDQEQHEAKQYVRWAIKHLADKTYMAAL |
| Ga0307375_106637463 | 3300031669 | Soil | MTLEELISAIERLQAVYDSIADQEQHETKQYIRWAIKHLADKT |
| Ga0307377_104038511 | 3300031673 | Soil | MTLEELISAIERLQAVYDSIVDQEQHETKQYIRWAIKHLADKTY |
| Ga0315904_104820963 | 3300031951 | Freshwater | TLDELISAIERLQSIYDRMDNEDQREAKQFVRWAIKHLADKVWSASL |
| Ga0315903_110161592 | 3300032116 | Freshwater | MTLEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTY |
| Ga0334980_0047325_583_729 | 3300033816 | Freshwater | MTLDELISAIERLQGIYDRMDNEDQREAKQFVRWAIKHLADKVWSAAL |
| Ga0334980_0089919_494_646 | 3300033816 | Freshwater | MEMTLEEMITAIERLQAVYNSMVEEDQREAKQYVRWAIKNLADKAYMAAL |
| Ga0334982_0466762_323_463 | 3300033981 | Freshwater | MDELITNIERLQTVYNSMVDPEQHEARQYVRWAIKQLADKTYMASL |
| Ga0334994_0243089_580_732 | 3300033993 | Freshwater | MEMSLEEMISAIERLQAVYDLMVDDEQRETKQSLRRAISTLASKAYVAAL |
| Ga0334994_0529353_2_154 | 3300033993 | Freshwater | MEMTLGEMITAIERLQAVYNSMVEEDQREAKQYVRWAIKNLADKTYMAAL |
| Ga0334994_0543121_2_127 | 3300033993 | Freshwater | SAIERLQAVYNTINDGEQHEAKQYVRWAIKHLADKIYFEVI |
| Ga0335003_0019612_698_844 | 3300033995 | Freshwater | MTLDELITNIERLQTVYNSMVDPEQHEARQYVRWAIKQLADKTYMASL |
| Ga0334979_0130493_686_838 | 3300033996 | Freshwater | MEMTLEEMITAIERLQAVYNLMVEEDQREAKQYVRWAIKNLADKAYMAAL |
| Ga0334986_0215447_956_1063 | 3300034012 | Freshwater | QAVYDLMVEEDQREAKQYVRWAIKHLADKTYMAAL |
| Ga0334986_0470867_493_621 | 3300034012 | Freshwater | INAIERLQAVYDLMVEEDQREAKQYVRWAIKHLADKTYMAAL |
| Ga0335004_0604521_245_391 | 3300034021 | Freshwater | MTLEEMISAIERLQAVYNSMVEEDQREARQYVRWAIKNLADKTYMAAL |
| Ga0334987_0374915_454_606 | 3300034061 | Freshwater | MEMTLEELITAIERLQAVYNSMVEEDQREAKQYVRWAIKNLADKAYMAAL |
| Ga0334987_0524241_577_717 | 3300034061 | Freshwater | LEELITNIERLQAVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0334995_0072200_561_713 | 3300034062 | Freshwater | MEMTLLEMISAIERLQAVYNTINDGEQHEAKQYVRWAIKHLADKIYFEVI |
| Ga0334995_0129476_1285_1431 | 3300034062 | Freshwater | MTLEEMISAIERLQAVYNLMVEEDQREARQYVRWAIKNLADKTYMAAL |
| Ga0334995_0146591_1257_1409 | 3300034062 | Freshwater | MEMTLEEMITAIERLQAVYNSMVEEDQREAKQYVRWAIKNLADKMYIAAL |
| Ga0335019_0106525_307_453 | 3300034066 | Freshwater | MTLEELISAIERLQAVYDAIVDQEQHEAKQYIRWAIKHLADKTYMASL |
| Ga0310130_0027524_931_1077 | 3300034073 | Fracking Water | MTLEELITNIERLQAVYNSMVDPEQHETRQYVRWAIKHLADKTYMAAL |
| Ga0335025_0439628_483_635 | 3300034096 | Freshwater | MEMTLEEMITAIERLQAVYNLMVEEDQREAKQYVRWAIKNLADKMYIAAL |
| Ga0335027_0039086_474_620 | 3300034101 | Freshwater | MTLEELITNIERLQIVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL |
| Ga0335027_0059408_1082_1228 | 3300034101 | Freshwater | MTLEELINAIERLQAVYDLMVEEDQREAKQYVRWAIKHLADKTYMASL |
| Ga0335027_0238734_943_1095 | 3300034101 | Freshwater | MEMTLEEMISAIERLQAVYDLMVDDEQRETKQSLRRAISTLASKAYVAAL |
| Ga0335030_0447218_164_316 | 3300034103 | Freshwater | MEMTLLEMICAIERLQALYNTINDGEQHEAKQYVRWAIKHLADKIYFEVI |
| Ga0335036_0474627_256_408 | 3300034106 | Freshwater | MEMTLLEMISAIERLQALYNTINDGEQHEAKQYVRWAIKHLADKIYFEVI |
| Ga0335036_0651486_90_251 | 3300034106 | Freshwater | VAGEEMTLEELINAIERLQAVYDAMVEEDQREAKQYVRWAIKHLADKTYMAAL |
| Ga0335066_0535811_491_613 | 3300034112 | Freshwater | AIERLQAVYNSMVEEDQREAKQYVRWAIKNLADKAYMAAL |
| Ga0335066_0645598_93_239 | 3300034112 | Freshwater | MKLEEMISAIERLQAVYNLMVEEDQREAKQYVRWAIKNLADKTYMAAL |
| Ga0335053_0638880_490_606 | 3300034118 | Freshwater | MTLEELITNIERLQSVYNSMVDPEQHEARQYVRWAIKHL |
| Ga0335054_0497894_2_118 | 3300034119 | Freshwater | ERLQAVYNLMVEEDQREARQYVRWAIKNLADKTYMAAL |
| Ga0335056_0618450_446_556 | 3300034120 | Freshwater | LQAVYNLMVEEDQREAKQYVRWAIKNLADKAYMAAL |
| Ga0335060_0440788_573_680 | 3300034122 | Freshwater | QSVYNSMVDPEQHEARQYVRWAIKHLADKTYMAAL |
| Ga0335049_0541742_590_733 | 3300034272 | Freshwater | TLEELITNIERLQTVYNSMVDPEQHEARQYVRWAIKHLADKTYMASL |
| ⦗Top⦘ |