 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F048925 |
| Family Type | Metagenome |
| Number of Sequences | 147 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FVLAMLGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.50 % |
| % of genes near scaffold ends (potentially truncated) | 78.23 % |
| % of genes from short scaffolds (< 2000 bps) | 76.87 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.830 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (29.252 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.476 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.156 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF12957 | DUF3846 | 4.76 |
| PF03237 | Terminase_6N | 4.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.83 % |
| All Organisms | root | All Organisms | 25.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 29.25% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 25.85% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.72% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.72% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.04% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.04% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.04% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.04% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 2.04% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.36% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.36% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.36% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.36% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.68% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102130731 | 3300000101 | Marine | MILVGFIIVMLGFITFIHSGEHRMLGLLISFGGFASMFVGVPDHE* |
| DelMOSum2011_101338173 | 3300000115 | Marine | AMLGVITFVHSGDHKMLGILISFAGVMSMFGGLPDNA* |
| DelMOSpr2010_102361721 | 3300000116 | Marine | GVITFVHSGDHKMLGILISFAGVMSMFGGLPDNA* |
| DelMOWin2010_102430171 | 3300000117 | Marine | FIVAMLGIITAIHSEHHVLGLLISFGGVMAMFGGLPD* |
| JGI20159J14440_101722071 | 3300001353 | Pelagic Marine | LGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| JGI20158J14315_102150072 | 3300001355 | Pelagic Marine | FVLAMLGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| JGI24003J15210_100940911 | 3300001460 | Marine | LGFITFIHSGEHRMLGLLICFGGVAAMFGGLPHND* |
| KVRMV2_1004103933 | 3300002231 | Marine Sediment | VMLGFITFIHSGEHRILGLLICFGGVMAMFGGLPDYE* |
| KVRMV2_1011457911 | 3300002231 | Marine Sediment | LGVITFVHGGEHSMLGLLICFSGLLSMLQGLPNHE* |
| KVWGV2_107269011 | 3300002242 | Marine Sediment | TGFILAMLGVITFIHSDHNILGILILFSGVMSVFAGLPDYE* |
| Ga0075466_11048171 | 3300006029 | Aqueous | VLAMLGVITFVHSGDHKMLGILISFAGVMSMFGGLPDNA* |
| Ga0098038_11372901 | 3300006735 | Marine | GFVLAMLGIITFVHSGEHQTLGILIMFSGVVSMFGGLPDNA* |
| Ga0098038_12392432 | 3300006735 | Marine | AMLGVIVFIHGQHYEVGILISFAGICSIFGGLPHYE* |
| Ga0098037_11640241 | 3300006737 | Marine | MLGVIVFIHGEHYEVGVLISFAGICSMFGGLPHYE* |
| Ga0098042_11599542 | 3300006749 | Marine | LGVIVFIHGEHYEVGILISFAGICSMFGGLPHYE* |
| Ga0098048_12297222 | 3300006752 | Marine | LGFITFIHSGDHRILGLLICFGGVASMFAGLPDNE* |
| Ga0075467_102835544 | 3300006803 | Aqueous | FIIVFLGFITFIHSGDHRMLGLLIMFGGLMSMFGGLPHNE* |
| Ga0075476_102597742 | 3300006867 | Aqueous | MVLTGFVLAMLGIITFVHSGEHQTLGILIMFSGVVSMFGGVTE* |
| Ga0075476_103433431 | 3300006867 | Aqueous | MVLTGFVLAMLGIITFVHSGEHQTLGILIMFSGVVSMFGGLPYAE* |
| Ga0070750_104392391 | 3300006916 | Aqueous | AMLGIITAVHSEHHMLGLMISFAGVVSMFGGLPDNA* |
| Ga0070746_104169753 | 3300006919 | Aqueous | FVLAMLGVITFVHSGDHKMLGILISFAGVMSMFGGLPDNA* |
| Ga0070748_12468573 | 3300006920 | Aqueous | AMLGVITAIHSEHHMLGLMISFAGVVSMFGGLPDNA* |
| Ga0098060_10955751 | 3300006921 | Marine | GVITFVHSGDHKMLGVLISFAGVVSMFGGLPDNA* |
| Ga0098060_11788783 | 3300006921 | Marine | LGFITFIHSGEHRMLGLLIMFGGIMSMFGGLPNAE* |
| Ga0098045_10985181 | 3300006922 | Marine | MLGIITFVHSGEHQMLGILISFAGVVSMFGGLPTHE* |
| Ga0098041_10453384 | 3300006928 | Marine | VGFALALLGVIVFVHSNDHALMGILISFAGVVSMFGGLPHYE* |
| Ga0098041_11283821 | 3300006928 | Marine | ALAMLGVIVFIHGQHYEVGILISFAGICSIFGGLPTYE* |
| Ga0098041_12044463 | 3300006928 | Marine | VLAMLGVIVFIHSNDHALMGVLISFAGVVSMFGGLPDNA* |
| Ga0098041_12810211 | 3300006928 | Marine | VLAMLGLITFVHSDHQTLGILISFAGVMSMFGGLPDNA* |
| Ga0098036_10795623 | 3300006929 | Marine | CGFALMFLGVITFFHGGEHFMLGILICFAGVVSMFQGLPHHE* |
| Ga0075468_102325621 | 3300007229 | Aqueous | FIIVFLGFITFIHSGDHRMLGLLIMFGGLMSMFGGLPHND* |
| Ga0075460_102485073 | 3300007234 | Aqueous | MLGVIVFIHGEHYPIGVLISFAGIVSMFAALPDNA* |
| Ga0099849_12955132 | 3300007539 | Aqueous | LGVITAIHSEHHMLGLMISFAGVVSMFGGLPDNA* |
| Ga0070751_13473531 | 3300007640 | Aqueous | TGFVLAMLGVIVFIHGQHYEIGVLISFGGVMAMFGGLPYYE* |
| Ga0102855_11338391 | 3300007647 | Estuarine | MVLTGFVLAMLGIITFVHSDHNTLGILISFAGVMSMFGGLPDNA* |
| Ga0110931_10786083 | 3300007963 | Marine | AMLGIITFVHSGEHQTLGILIMFSGVVSMFGGLPDNA* |
| Ga0110931_11484791 | 3300007963 | Marine | GFILAMLGVIVCIHGQHYEVGILISFAGICSIFGGLPRYE* |
| Ga0110931_12101923 | 3300007963 | Marine | VLVGFVLAMLGIITFMHSEHYVIGILISFSGICSMFGGLPNYE* |
| Ga0105748_105569672 | 3300007992 | Estuary Water | VGFIIAMLGIITAIHSDHHMLGLMISFAGVVSMFGGLPDNA* |
| Ga0114916_10806121 | 3300008221 | Deep Ocean | IIAMLGIITVVHSEHHMLGLMISFAGVVSMFGGLPD* |
| Ga0102963_12641722 | 3300009001 | Pond Water | LAMLGLITFIHSDHQTLGVLILFGGVMSMFGGLPNHGTSS* |
| Ga0115549_12215741 | 3300009074 | Pelagic Marine | ILVGFIIAMLGVITAIHSEHHMLGLMISFAGVVSMFGGLPDNA* |
| Ga0102814_107389232 | 3300009079 | Estuarine | MLGVITFIHSGEHRILGLLISFAGVVSMFGGLPDNA* |
| Ga0115548_10855831 | 3300009423 | Pelagic Marine | GFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0115546_11334271 | 3300009435 | Pelagic Marine | FVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0115560_13433821 | 3300009447 | Pelagic Marine | MVLTGFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0115554_13966161 | 3300009472 | Pelagic Marine | GFVLAMLGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0115568_102834813 | 3300009498 | Pelagic Marine | LGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0115572_106846682 | 3300009507 | Pelagic Marine | LMVLTGFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0115567_107712142 | 3300009508 | Pelagic Marine | VLTGFVLAMLGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA* |
| Ga0098043_11861742 | 3300010148 | Marine | GFALAMLGVIVFIHGQHYEVGILISFAGICSIFGGLPHYE* |
| Ga0098043_11939052 | 3300010148 | Marine | VLTGFVLAMLGLITFVHSDHQTLGILISFAGVMSMFGGLPDNA* |
| Ga0098043_11955212 | 3300010148 | Marine | ALLGVIVFVHSNDHALMGILISFAGVVSMFGGLPHYE* |
| Ga0098049_11627911 | 3300010149 | Marine | MVLTGFVLAMLGIITFMHSDHHTLGILIMFGGVMSMFGGLPDNA* |
| Ga0098049_12036973 | 3300010149 | Marine | VGFIVVMLGFITFIHSGEHRMLGLLIMFGGIMSMFGGLPNAE* |
| Ga0098059_13815412 | 3300010153 | Marine | LGVITAVYSEHHMLGLMISFGGAMSLFMGLPDNA* |
| Ga0098059_14157562 | 3300010153 | Marine | GFVLAMLGVITFMHSEHYVIGILISFSGICSMFGGLPNYE* |
| Ga0129348_13060642 | 3300010296 | Freshwater To Marine Saline Gradient | LAMLGVIVFIHGEHYPIGVLISFAGVLSMFAALPDNA* |
| Ga0163180_103990733 | 3300012952 | Seawater | VLAMLGIITFVHSDHNTLGILISFAGVMSVFGGLPDNA* |
| Ga0163179_103394884 | 3300012953 | Seawater | AMLGVIVFIHGQHYEVGILISFAGICSIFGGLPTYE* |
| Ga0163179_120764282 | 3300012953 | Seawater | MVLTGFVLAMLGVITFVHGGEHQMLGILITFAGVVSIFGGLPNNA* |
| Ga0181369_10717361 | 3300017708 | Marine | ALLGVIVFVHSNDHALMGILISFAGVVSMFGGLPTHE |
| Ga0181369_11172241 | 3300017708 | Marine | VLVGFIVVMLGFITFIHSGEHRMLGLLIMFGGIMSMFGGLPNAE |
| Ga0181412_10435591 | 3300017714 | Seawater | LMMVLVGFIVVMLGFITFIHSGEHRMLGLLIMFGGVAAMFGGLPDNA |
| Ga0181390_11678181 | 3300017719 | Seawater | LAMLGIITFVHSDLNTLGILISFAGVMSVFGGLPDNA |
| Ga0181388_10347291 | 3300017724 | Seawater | FIIAMLGIITAVHSEYHMLGLMISFGGMMSMFVGLPDNA |
| Ga0181396_10708441 | 3300017729 | Seawater | FVLAMLGVIVFIHGEHYSIGILISFAGVMSMFGGLPDNA |
| Ga0181416_10012656 | 3300017731 | Seawater | LGFITFIHSGEHRILGLLILFAGVMSMFGGIPDAE |
| Ga0181415_10971853 | 3300017732 | Seawater | LAMLGVIVFVHSGEHQMLGILISFAGVVSMFGGLPDNA |
| Ga0181426_10251854 | 3300017733 | Seawater | MVLTGFVLAMLGVITFVHSGEHQTLGILIMFSGVVSMFGGLPHA |
| Ga0181426_10368391 | 3300017733 | Seawater | VLVGFVLALLGVIVFIHGQHYEVGILISFAGICSIFGGLPHYE |
| Ga0187222_11325401 | 3300017734 | Seawater | TGFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0187218_11352071 | 3300017737 | Seawater | MVLTGFILAFLGVLVFIHGQHYEVGILISFAGVLSMFQGLPKYN |
| Ga0181428_10155614 | 3300017738 | Seawater | IIAMLGIITTVHSEYHMLGLMISFGGMMSMFVGLPDNA |
| Ga0181428_11014243 | 3300017738 | Seawater | FIVVMLGFITFIHSGEHRMLGLLIMFGGLMSMFGGLPNAE |
| Ga0181433_11501952 | 3300017739 | Seawater | GFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0181433_11604092 | 3300017739 | Seawater | FLGFITFIHSGEHRMLGLLIMFGGVMSMFGGLPDNA |
| Ga0181418_10132201 | 3300017740 | Seawater | IVMLGFITFIHSGEHRILGLLILFAGVMSMFGGIPDAE |
| Ga0181418_10816941 | 3300017740 | Seawater | AMLGVITFVHSGEHQMLGILISFAGVVSMFGGLPNYE |
| Ga0181397_10435444 | 3300017744 | Seawater | VLTGFVLAMLGVIVFVHSGEHQMLGILISFAGVVSMFGGLPDNA |
| Ga0181397_10738804 | 3300017744 | Seawater | FVLAMLGVITFVHSDHNTLGILISFAGVMSMFGGLPDNA |
| Ga0181427_11717123 | 3300017745 | Seawater | FIIVMLGFITFIHSGEHRMLGILITFGGVMSMFGGLPNAE |
| Ga0181389_11191611 | 3300017746 | Seawater | VGFIIAMLGVITAIHSEHHMLGLMISFGGAMSMFGGLPDNA |
| Ga0181389_11277451 | 3300017746 | Seawater | VGFIIAMLGIITAVHSEYHMLGLMISFAGVVSMFGGLPDNA |
| Ga0181405_11133733 | 3300017750 | Seawater | VLAMLGVIVFVHSGEHQMLGILISFAGVVSMFGGLPDNA |
| Ga0181400_10787573 | 3300017752 | Seawater | VVMLGFITYIHSGEHRMLGLLIMFGGLMSMFGGLPNAE |
| Ga0181411_12111141 | 3300017755 | Seawater | ILVGFIIAMLGIITAVHSEYHMLGLMISFGGMMSMFVGLPDNA |
| Ga0181420_12188871 | 3300017757 | Seawater | FVLALLGVIVCIHGQHYEVGILISFAGICSIFGGLPHYE |
| Ga0181409_12108901 | 3300017758 | Seawater | TGFVLAMLGVIVFVHSGEHQMLGILISFAGVVSMFGGLPDNA |
| Ga0181408_10742041 | 3300017760 | Seawater | VLTGFVLAMLGIITFVHSDHNTLGILISFAGVVSMFGGLPDNA |
| Ga0181410_10753174 | 3300017763 | Seawater | LMVLTGFVLAMLGVITFVHSGEHQTLGILIMFSGVVSMFGGLPHA |
| Ga0181410_10812791 | 3300017763 | Seawater | MVLTGFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0187221_11237421 | 3300017769 | Seawater | LVGFIIAMLGIITAVHSEYHMLGLMISFGGMMSMFVGLPDNA |
| Ga0187217_12489501 | 3300017770 | Seawater | AMLGVITFVHSDHNTLGILISFAGVMSMFGGLPDNA |
| Ga0187217_12764781 | 3300017770 | Seawater | LVGVIVVMLGFITFIHSGEHRMLGLLIMFGGVAAMFGGLPDNA |
| Ga0181394_11094874 | 3300017776 | Seawater | AMLGLITFVHSDHQTLGILISFAGVMSMFGGLPDNA |
| Ga0181423_13129431 | 3300017781 | Seawater | GFILAFLGVLVFIHGQHYEVGILISFAGVLSMFQGLPKYN |
| Ga0181423_13639962 | 3300017781 | Seawater | LVGFIVVMLGFITFIHSGEHRMLGILITFGGVMSMFGGLPNAE |
| Ga0211576_100228193 | 3300020438 | Marine | MILTGFILAMLGVIVFIHGQHIEVGILISFAGVVSMFGGLPDNA |
| Ga0211577_100407541 | 3300020469 | Marine | LVGFIIAMLGVITAIHSEHHMLGLMISFAGVVSMCGGLPDNA |
| Ga0213869_104134921 | 3300021375 | Seawater | IIAMLGIITAVHSEHHMLGLMISFAGVVSMFGGLPDNA |
| Ga0213868_101646654 | 3300021389 | Seawater | LAMLGVIVFIHGEHYEVGILISFSGIVSMFAGVPHYE |
| Ga0212021_11242381 | 3300022068 | Aqueous | IVFLGFITFIHSGDHRMLGLLIMFGGLMSMFGGLPHND |
| Ga0224906_10136891 | 3300022074 | Seawater | MILTGFILAMLGVIVFIHGQHIEVGILISFAGVVSMFGG |
| Ga0224906_10876491 | 3300022074 | Seawater | LMVLTGFVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0224906_11227263 | 3300022074 | Seawater | MLGVITAIHSEHHMLGLMISFAGVVSMFGGLPDNA |
| Ga0196887_11271881 | 3300022178 | Aqueous | FVLAMLGVITFVHSGDHKMLGILISFAGVMSMFGGLPDNA |
| Ga0196891_10060334 | 3300022183 | Aqueous | LTGFVLAMLGIITFVHSGEHQTLGILIMFSGVVSMFGGLPYAE |
| Ga0196901_11027111 | 3300022200 | Aqueous | VLTGFVLAILGVIVFIHGEHYEVGILISFSGIVSMFAGVPHYE |
| (restricted) Ga0233444_103006571 | 3300024264 | Seawater | LGFITFIHSGEHRMLGLLIMFGGVAAMFGGLPDNA |
| Ga0208667_10185871 | 3300025070 | Marine | LGFITFIHSGEHRMLGLLIMFGGIMSMFGGLPNAE |
| Ga0207896_10242521 | 3300025071 | Marine | AMLGIITAVHSEHHLLGLGISFAGILAMFGGLPDNA |
| Ga0207896_10726362 | 3300025071 | Marine | GFVLAMLGVIVCIHGQHYEVGILISFAGICSIFGGLPTYE |
| Ga0208792_10433644 | 3300025085 | Marine | LTGFVLAMLGVIVFIHGEHFEVGVLIFFAGIVSVFGGLPHYE |
| Ga0208157_10337931 | 3300025086 | Marine | MLGFITFIHSGEHRMLGLLIMFGGIMSMFGGLPNAE |
| Ga0208434_10099294 | 3300025098 | Marine | MVLTGFVLAMLGVITFVHSGDHKMLGILISFAGVVLSMFGGLPNAE |
| Ga0208159_11019371 | 3300025101 | Marine | VGFALAFLGVIVFIHGQHYEVGILISFAGICSMFGGLPHYE |
| Ga0208158_11250083 | 3300025110 | Marine | FVLALLGVIVFIHGQHYEVGILISFAGICSIFGGLPTYE |
| Ga0208158_11498651 | 3300025110 | Marine | VLAMLGLITFVHSDHQTLGILISFAGVMSMFGGLPDNA |
| Ga0209535_12065912 | 3300025120 | Marine | TGFVLAMLGVIVFIHGEHYSIGILISFAGVMSMFGGLPDNA |
| Ga0208919_10872493 | 3300025128 | Marine | MVLTGFVLAMLGIITFVHSGEHQTLGILIMFSGVVSMFGGLPDNA |
| Ga0209336_101297211 | 3300025137 | Marine | LGFITFIHSGEHRMLGLLICFGGVAAMFGGLPDNA |
| Ga0209756_11368491 | 3300025141 | Marine | MVLVGFIVVMLGFITFIHSGEHRMLGLLIMFGGIMSMFGGLPNAE |
| Ga0209645_11233754 | 3300025151 | Marine | MIVMLGFITFIHSGEHRMLGLLICFAGVVSMFGGLPDYE |
| Ga0209645_11852883 | 3300025151 | Marine | VGFMLAFLGVITFIHAGDHRILGLLISFAGVVTMFGGLPSYE |
| Ga0209337_12142453 | 3300025168 | Marine | VGFIIAMLGVITAIHSEHHMLGLMISFAGVVSMFGGLPDNA |
| Ga0208449_10719814 | 3300025280 | Deep Ocean | LGVITFVHGGEHSMLGILICFAGVLSVFQGLPNHE |
| Ga0208181_10735501 | 3300025300 | Deep Ocean | FVLALLGVIVFIHGEHYEVGILISFAGICSIFGGLPDNA |
| Ga0209306_11615521 | 3300025680 | Pelagic Marine | AMLGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0208899_11503253 | 3300025759 | Aqueous | GFVLAMLGVITFVHSGDHKMLGILISFAGVMSMFGGLPDNA |
| Ga0208425_10559023 | 3300025803 | Aqueous | LVGFVLAMLGIITFVHSGEHQTLGILIMFSGVVSMFGGLPYAE |
| Ga0209199_12067061 | 3300025809 | Pelagic Marine | LAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0209193_10200125 | 3300025816 | Pelagic Marine | LGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0209832_10829403 | 3300025830 | Pelagic Marine | FVLAMLGVITFVHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0209308_101836461 | 3300025869 | Pelagic Marine | TGFVLAMLGVITFIHSGDHKMLGILISFAGVVSMFGGLPDNA |
| Ga0209951_10167091 | 3300026138 | Pond Water | FVLAMLGLITFIHSDHQTLGVLILFGGVMSMFGGLPNHGTSS |
| Ga0209071_11747452 | 3300027686 | Marine | LVGFIIAMLGIITAVHSEHHMLGLMISFAGVVSMFGGLPD |
| Ga0209501_103156143 | 3300027844 | Marine | LMMILVGFIIVMLGFITFIHSGEYRILGLLISFAGVMAMFGGLPD |
| Ga0256383_1076121 | 3300028448 | Seawater | TGFILAMLGVITFIHSDHNILGILILFSGVMSMFAGLPDYE |
| Ga0183757_10378303 | 3300029787 | Marine | FVLAMLGVIVFIHGEHYTIGILISFAGVMSMFGGLPDNA |
| Ga0307489_113775893 | 3300031569 | Sackhole Brine | FIIAMLGIITAIHSEHHLLGLGISFAGILAMFGGLPDND |
| Ga0308009_102149061 | 3300031612 | Marine | IAMLGIITAVHSEHHLLGLMISFAGVVSMFGGLPD |
| Ga0307984_10371671 | 3300031658 | Marine | FIILMLGAITFLHSGEHQTLGILISFAGVMSMFGGLPQ |
| Ga0307984_11849471 | 3300031658 | Marine | IIEMLGVITAMGSEHHMLGLMISFAGVVSMMMGLPDNA |
| Ga0315330_101906424 | 3300032047 | Seawater | VGFILAMLGVITFVHSGEHQMLGILISFAGVVSMFGGLPNYE |
| Ga0315315_102937434 | 3300032073 | Seawater | GFIIAMLGIITAVHSEYHMLGLMISFGGMMSMFVGLPDNA |
| Ga0315315_106563944 | 3300032073 | Seawater | ILVGFIIAMLGIITAVHSEHHMLGLMISFAGVVSMFGGLPDNA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |