| Basic Information | |
|---|---|
| Family ID | F048850 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKKGIYYVPLFLILLFVMGGTFYVGDYLGFAMSTLAMLLLGEVYYLRFIK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 82.07 % |
| % of genes near scaffold ends (potentially truncated) | 27.21 % |
| % of genes from short scaffolds (< 2000 bps) | 80.27 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.72 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (58.503 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.782 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.13% β-sheet: 0.00% Coil/Unstructured: 44.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.2.6.1: HR1 repeat | d4nkgb_ | 4nkg | 0.85198 |
| a.2.19.1: Rabenosyn-5 Rab-binding domain-like | d1z0jb1 | 1z0j | 0.84897 |
| a.184.1.1: TorD-like | d2xola1 | 2xol | 0.84745 |
| a.281.1.1: YmcA-like | d2piha1 | 2pih | 0.84202 |
| a.24.9.1: alpha-catenin/vinculin | d1l7ca2 | 1l7c | 0.83881 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 44.22 |
| PF00012 | HSP70 | 7.48 |
| PF09414 | RNA_ligase | 1.36 |
| PF01713 | Smr | 1.36 |
| PF01223 | Endonuclease_NS | 0.68 |
| PF00293 | NUDIX | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 7.48 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.39 % |
| Unclassified | root | N/A | 30.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001836|RCM27_1094970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300001968|GOS2236_1093477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2244 | Open in IMG/M |
| 3300002206|metazooDRAFT_1324261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300002835|B570J40625_100037640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7320 | Open in IMG/M |
| 3300002835|B570J40625_100040158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6992 | Open in IMG/M |
| 3300002835|B570J40625_100067469 | All Organisms → Viruses → Predicted Viral | 4797 | Open in IMG/M |
| 3300002835|B570J40625_100735486 | Not Available | 877 | Open in IMG/M |
| 3300002835|B570J40625_100838148 | Not Available | 803 | Open in IMG/M |
| 3300004151|Ga0066602_10069215 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
| 3300005527|Ga0068876_10007868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7180 | Open in IMG/M |
| 3300005527|Ga0068876_10010688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6058 | Open in IMG/M |
| 3300005527|Ga0068876_10014485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5086 | Open in IMG/M |
| 3300005527|Ga0068876_10457046 | Not Available | 706 | Open in IMG/M |
| 3300005585|Ga0049084_10137497 | Not Available | 858 | Open in IMG/M |
| 3300005662|Ga0078894_10207542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1774 | Open in IMG/M |
| 3300005662|Ga0078894_10226089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1695 | Open in IMG/M |
| 3300005662|Ga0078894_10278750 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300005662|Ga0078894_10388143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
| 3300006802|Ga0070749_10112478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
| 3300007541|Ga0099848_1039754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1929 | Open in IMG/M |
| 3300007547|Ga0102875_1246974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300007548|Ga0102877_1146794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300007554|Ga0102820_1140010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300007557|Ga0102821_1122126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300007593|Ga0102918_1020861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1775 | Open in IMG/M |
| 3300007597|Ga0102919_1078795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300007620|Ga0102871_1221571 | Not Available | 525 | Open in IMG/M |
| 3300007624|Ga0102878_1149669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300007629|Ga0102895_1196868 | Not Available | 523 | Open in IMG/M |
| 3300007634|Ga0102901_1125391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300007634|Ga0102901_1239309 | Not Available | 509 | Open in IMG/M |
| 3300007972|Ga0105745_1199563 | Not Available | 629 | Open in IMG/M |
| 3300007974|Ga0105747_1096517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300007992|Ga0105748_10057925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1507 | Open in IMG/M |
| 3300008052|Ga0102893_1157172 | Not Available | 663 | Open in IMG/M |
| 3300008107|Ga0114340_1121527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300008113|Ga0114346_1000357 | Not Available | 63775 | Open in IMG/M |
| 3300008113|Ga0114346_1120331 | Not Available | 1170 | Open in IMG/M |
| 3300008113|Ga0114346_1136089 | Not Available | 1070 | Open in IMG/M |
| 3300008113|Ga0114346_1213665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300008267|Ga0114364_1017421 | All Organisms → Viruses → Predicted Viral | 3067 | Open in IMG/M |
| 3300008267|Ga0114364_1021215 | Not Available | 2693 | Open in IMG/M |
| 3300008267|Ga0114364_1025129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2404 | Open in IMG/M |
| 3300008267|Ga0114364_1061416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
| 3300008267|Ga0114364_1112122 | Not Available | 827 | Open in IMG/M |
| 3300008267|Ga0114364_1139062 | Not Available | 690 | Open in IMG/M |
| 3300008267|Ga0114364_1185419 | Not Available | 528 | Open in IMG/M |
| 3300008996|Ga0102831_1033350 | All Organisms → Viruses → Predicted Viral | 1742 | Open in IMG/M |
| 3300008996|Ga0102831_1180822 | Not Available | 698 | Open in IMG/M |
| 3300009059|Ga0102830_1171256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300009082|Ga0105099_10270905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300009085|Ga0105103_10551494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300009085|Ga0105103_10764708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300009086|Ga0102812_10775560 | Not Available | 531 | Open in IMG/M |
| 3300009149|Ga0114918_10014498 | Not Available | 6130 | Open in IMG/M |
| 3300009152|Ga0114980_10033472 | All Organisms → Viruses → Predicted Viral | 3170 | Open in IMG/M |
| 3300009158|Ga0114977_10034442 | All Organisms → Viruses → Predicted Viral | 3170 | Open in IMG/M |
| 3300009169|Ga0105097_10746896 | Not Available | 555 | Open in IMG/M |
| 3300009183|Ga0114974_10741040 | Not Available | 531 | Open in IMG/M |
| 3300010354|Ga0129333_10421492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300010370|Ga0129336_10683098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300012012|Ga0153799_1011580 | Not Available | 1926 | Open in IMG/M |
| 3300013004|Ga0164293_10008779 | Not Available | 8508 | Open in IMG/M |
| 3300013004|Ga0164293_10064454 | Not Available | 2903 | Open in IMG/M |
| 3300014309|Ga0075317_1073326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300017722|Ga0181347_1192384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300017747|Ga0181352_1038438 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
| 3300017747|Ga0181352_1117828 | Not Available | 718 | Open in IMG/M |
| 3300017754|Ga0181344_1051307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300017754|Ga0181344_1076164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300017754|Ga0181344_1192699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300017754|Ga0181344_1196843 | Not Available | 566 | Open in IMG/M |
| 3300017766|Ga0181343_1113397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300017766|Ga0181343_1187548 | Not Available | 569 | Open in IMG/M |
| 3300019784|Ga0181359_1010229 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
| 3300019784|Ga0181359_1045971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1687 | Open in IMG/M |
| 3300020048|Ga0207193_1146909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1990 | Open in IMG/M |
| 3300020074|Ga0194113_10103808 | All Organisms → Viruses → Predicted Viral | 2481 | Open in IMG/M |
| 3300020151|Ga0211736_10763042 | All Organisms → Viruses → Predicted Viral | 2941 | Open in IMG/M |
| 3300020159|Ga0211734_10178476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300020161|Ga0211726_10002274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300020504|Ga0208484_1016850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300020506|Ga0208091_1007664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
| 3300020506|Ga0208091_1030765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300020519|Ga0208223_1030913 | Not Available | 682 | Open in IMG/M |
| 3300020527|Ga0208232_1011996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1322 | Open in IMG/M |
| 3300020530|Ga0208235_1015340 | Not Available | 956 | Open in IMG/M |
| 3300020535|Ga0208228_1026802 | Not Available | 949 | Open in IMG/M |
| 3300020549|Ga0207942_1002334 | All Organisms → Viruses → Predicted Viral | 3221 | Open in IMG/M |
| 3300020556|Ga0208486_1014143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300020559|Ga0208083_1074110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300020560|Ga0208852_1058382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300020564|Ga0208719_1093960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300021376|Ga0194130_10106492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1813 | Open in IMG/M |
| 3300021960|Ga0222715_10352870 | Not Available | 818 | Open in IMG/M |
| 3300021963|Ga0222712_10073216 | Not Available | 2469 | Open in IMG/M |
| 3300022179|Ga0181353_1121474 | Not Available | 624 | Open in IMG/M |
| 3300022179|Ga0181353_1135904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300022407|Ga0181351_1043790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1884 | Open in IMG/M |
| 3300022407|Ga0181351_1059144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
| 3300024262|Ga0210003_1001196 | Not Available | 22973 | Open in IMG/M |
| 3300025763|Ga0255250_1091406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300027144|Ga0255102_1019867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
| 3300027147|Ga0255113_1030388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300027285|Ga0255131_1015651 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300027285|Ga0255131_1063303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300027286|Ga0255129_1054891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300027295|Ga0255126_1045315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
| 3300027368|Ga0255133_1054169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300027732|Ga0209442_1080751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300027733|Ga0209297_1000543 | Not Available | 23829 | Open in IMG/M |
| 3300027759|Ga0209296_1377960 | Not Available | 537 | Open in IMG/M |
| 3300027772|Ga0209768_10212477 | Not Available | 862 | Open in IMG/M |
| 3300027793|Ga0209972_10086673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1601 | Open in IMG/M |
| 3300027804|Ga0209358_10110371 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300027804|Ga0209358_10448206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300027805|Ga0209229_10010166 | All Organisms → Viruses → Predicted Viral | 3965 | Open in IMG/M |
| 3300027899|Ga0209668_10260756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300027899|Ga0209668_10353649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300027899|Ga0209668_11102050 | Not Available | 534 | Open in IMG/M |
| 3300027900|Ga0209253_11143003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300031758|Ga0315907_10633255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300031758|Ga0315907_11145818 | Not Available | 549 | Open in IMG/M |
| 3300031772|Ga0315288_10833407 | Not Available | 846 | Open in IMG/M |
| 3300031784|Ga0315899_11765626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300031857|Ga0315909_10310048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300031857|Ga0315909_10512147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300031951|Ga0315904_10451295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
| 3300031951|Ga0315904_11257679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300031951|Ga0315904_11362433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300031999|Ga0315274_12068504 | Not Available | 508 | Open in IMG/M |
| 3300032092|Ga0315905_10000017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 153130 | Open in IMG/M |
| 3300032092|Ga0315905_10213136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1895 | Open in IMG/M |
| 3300032116|Ga0315903_10873766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300032263|Ga0316195_10168348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
| 3300033418|Ga0316625_100528801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300033482|Ga0316627_101996808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300033816|Ga0334980_0180120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300034061|Ga0334987_0001373 | Not Available | 23318 | Open in IMG/M |
| 3300034092|Ga0335010_0187007 | Not Available | 1277 | Open in IMG/M |
| 3300034092|Ga0335010_0350612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300034102|Ga0335029_0343792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300034272|Ga0335049_0343921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300034280|Ga0334997_0679548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300034283|Ga0335007_0059042 | All Organisms → Viruses → Predicted Viral | 2936 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.05% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.20% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.80% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.72% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.04% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.36% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.36% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.36% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.36% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.36% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.68% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.68% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.68% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.68% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.68% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.68% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300014309 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020504 | Freshwater microbial communities from Lake Mendota, WI - 09AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020559 | Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027368 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10949701 | 3300001836 | Marine Plankton | MKKGIYYLPLFLMILFVMVGTFYSGDYLGFSTSTIAMLLLGEVYYLRFIK* |
| GOS2236_10934772 | 3300001968 | Marine | MKKGIYYLPLFIILLFIIFGSFYVENYLSLFMGTTSFLLLCEVYYLRFIK* |
| metazooDRAFT_13242611 | 3300002206 | Lake | MKKGIYYLPLFLMILFTMIGTYYIGDYLAFGTSTLTMFLLCEVYYLRFLK* |
| B570J40625_10003764010 | 3300002835 | Freshwater | MKKGIYYLPLFLILLFVMAGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK* |
| B570J40625_1000401589 | 3300002835 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLLLGEIYYLRFIK* |
| B570J40625_1000674695 | 3300002835 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFIK* |
| B570J40625_1007354861 | 3300002835 | Freshwater | SRIWTMKKGIYYVPLFLILLFVMGGTFYVEDRLGFVMSTLAMLLLGEVYYLRFIK* |
| B570J40625_1008381481 | 3300002835 | Freshwater | MKKGIYYIPLFLILLFIMVGTFYVSNYLGFVMSTISMLLLGEVYYLRFIK* |
| Ga0066602_100692152 | 3300004151 | Freshwater | MKKGIYYLPLFLLISFTIVGTFYVGDYLGFASSTLSMLLLCEVYYLRFLK* |
| Ga0068876_100078687 | 3300005527 | Freshwater Lake | MKKGIYYLPLFLLILFTMVGTFYIGDYLGFGMSTLSILLLGEIYYLRFIK* |
| Ga0068876_100106882 | 3300005527 | Freshwater Lake | MKKGIYYVPLFIIILFIMGGTMYIGDRLSFIMSTLAMVLLCEIYYLRFLK* |
| Ga0068876_100144854 | 3300005527 | Freshwater Lake | MKKGIYYVPLFLILLFVMVGTFYVSDYLGFAMSSLALLLLGEVYYLRFLK* |
| Ga0068876_104570463 | 3300005527 | Freshwater Lake | MKKGIYYVPLFLILLFVMGGTFYVGDRLSFVMSTLAIVLLCEIYYLRFIK* |
| Ga0049084_101374972 | 3300005585 | Freshwater Lentic | KGIYYLPLCLVLLFVMVGTFYVGDYLGFVMSIISILLLGEVYYLRFIK* |
| Ga0078894_102075422 | 3300005662 | Freshwater Lake | MKKGIYYVPLFLILLFVMGGTFYVGDVLSFVMSTLAMLLLSEIYYLRFIK* |
| Ga0078894_102260892 | 3300005662 | Freshwater Lake | MKKGIYYVPLFLIVLFIMGGTIYIGDRLGFVMSTLAMLLLCEIYYLKFLK* |
| Ga0078894_102787502 | 3300005662 | Freshwater Lake | MKKGIYYLPLFLILLFVMGGTFYVGDVMSFVMSTLATLLLGEIYYLRFIK* |
| Ga0078894_103881432 | 3300005662 | Freshwater Lake | MKKGIYYVPLFLILLFVMAGTFYVGDYLGFGTSTMAMLLLGEVYYLRFIK* |
| Ga0070749_101124782 | 3300006802 | Aqueous | MKKGIYYLPLFLILLFVMAVTFYVGDYLGFAMSSLATLLLGEVYYLRFIK* |
| Ga0099848_10397545 | 3300007541 | Aqueous | MKKGIYYLPLFLIVLFIMGSTMYVGDQLGFVTSTLVLLLLCEVYYLRFLK* |
| Ga0099848_12738473 | 3300007541 | Aqueous | LILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK* |
| Ga0102875_12469742 | 3300007547 | Estuarine | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEVYYLRFLK* |
| Ga0102877_11467942 | 3300007548 | Estuarine | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFLK* |
| Ga0102820_11400101 | 3300007554 | Estuarine | MKKGIYYVPLFLILLFVMAGTFYVEDRLGFIMSTLALL |
| Ga0102821_11221262 | 3300007557 | Estuarine | MKKGIYYVPLFIIILFIMVGTFYVGDYLGFGTSTMAMLLLGEVYYLRFIK* |
| Ga0102918_10208611 | 3300007593 | Estuarine | MKKGIYYLPLFLILLFVMAGTFYVSDYLGFAMSSLAMLLLGEVY* |
| Ga0102919_10787952 | 3300007597 | Estuarine | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLSMLLLGEVYYLRFIK* |
| Ga0102871_12215713 | 3300007620 | Estuarine | MKKGIYYVPLFIIILFIMGGTMYVGDRLSFVMSTLAMVLLCEIYYLRFLK* |
| Ga0102878_11496691 | 3300007624 | Estuarine | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAML |
| Ga0102895_11968681 | 3300007629 | Estuarine | PLFLILLFVMGGTFYVGDYLGFAMSTLAMLLLGEVYYLRFIK* |
| Ga0102901_11253911 | 3300007634 | Estuarine | MKKGIYYLPLFLILLFVMAGTFYVSDYLGFAMSSLAMLLLGEV |
| Ga0102901_12393091 | 3300007634 | Estuarine | MKKGIYYVPLFLIVLFIMVGTFYVGDYLGFGTSTMAMLLLGEVYYLRFIK* |
| Ga0105745_11995633 | 3300007972 | Estuary Water | MKKGIYYIPLFLILLFIMVWTFYVSNYLGFVMSTISMLLLGEVYYLRFLK* |
| Ga0105747_10965172 | 3300007974 | Estuary Water | MKKGIYYIPLFLILLFIMVWTFYVSNYLGFVMSTISMLLLGEVYYLRFIK* |
| Ga0105748_100579253 | 3300007992 | Estuary Water | MKKGIYYLPLFLILLFVMGGTFYVEDRLGFAMSTLAMLLLGEVYYLRFIK* |
| Ga0102893_11571722 | 3300008052 | Estuarine | MKKGIYYVPLFLILLFIMGGTMYIGDRLGFVMSTLAMLLLCEVYYLRFLK* |
| Ga0114340_11215272 | 3300008107 | Freshwater, Plankton | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK* |
| Ga0114346_100035757 | 3300008113 | Freshwater, Plankton | MKKGIYYLPLFLLILFTMVGTFYIGDYLGFGMSTLSILLLGEKQ* |
| Ga0114346_11203313 | 3300008113 | Freshwater, Plankton | TMKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK* |
| Ga0114346_11360891 | 3300008113 | Freshwater, Plankton | KGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEVYYLRFLK* |
| Ga0114346_12136652 | 3300008113 | Freshwater, Plankton | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAM |
| Ga0114364_10174214 | 3300008267 | Freshwater, Plankton | MKKGIYYLPLFLILLFVIGGTFYVGDYLGFSMSVMAMLLLCEVYYLRFLK* |
| Ga0114364_10212152 | 3300008267 | Freshwater, Plankton | MKKGIYYLPLFLILLFVMGGTSYAVDRLSFVMSTLAMLLLGEVYYLRFIK* |
| Ga0114364_10251293 | 3300008267 | Freshwater, Plankton | MKKGIYYVPLFLILLFVMGGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK* |
| Ga0114364_10614164 | 3300008267 | Freshwater, Plankton | MKKGIYYVPLFLIVLFIMGGTMYIGNRLGFVMSTLVMLLLCEVYYLRFLK* |
| Ga0114364_11121221 | 3300008267 | Freshwater, Plankton | RKSRICTMKKGIYYLPLFLIVLFVTWGTYYIENYLGFTMSIISMLLLCEIYYLRFLK* |
| Ga0114364_11390622 | 3300008267 | Freshwater, Plankton | MKKGIYYVPLFLILLFVMGGTFYVGDYLGFAMSSLAMLLLGEVYYLRFIK* |
| Ga0114364_11854192 | 3300008267 | Freshwater, Plankton | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLSMLLLGEVYYLRFLK* |
| Ga0102831_10333505 | 3300008996 | Estuarine | MKKGIYYLPLFLILLFIMGGTFYVGDVMSFVMSTMAMLLLCEVYYLRFIK* |
| Ga0102831_11808222 | 3300008996 | Estuarine | MKKGIYYVPLFLILLFVMGGTLYVEDRLGFVMSTLAMLLLGEVYYLRFIK* |
| Ga0102830_11712562 | 3300009059 | Estuarine | MKKGIYYLPLFLILLFVMGGTFYVNDVLSFVMSTMSMLLLCEVYYLRFIK*R |
| Ga0102814_104799363 | 3300009079 | Estuarine | LILLFVMVGTFYVSDYLGFAMSSLALLLLGEVYYLRFLK* |
| Ga0105099_102709052 | 3300009082 | Freshwater Sediment | MKKGIYYVPLFLMILFVMVGTFYDGDYLGFGTSTMSMLLLGEVYYLRFIK* |
| Ga0105103_105514941 | 3300009085 | Freshwater Sediment | MKKGIYYLALFFILLFVMAGTFYVSDYLGFAMSSLAMLLLGEVYY |
| Ga0105103_107647082 | 3300009085 | Freshwater Sediment | MKKGIYYLPLFLILLFVMVGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK* |
| Ga0102812_107755603 | 3300009086 | Estuarine | MEKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLSMLLLGEVYYLRFIK* |
| Ga0114918_1001449810 | 3300009149 | Deep Subsurface | MKKGIYYLPLCLILLFIMVGTFYVGDYLGFVMSIISMLLLGEVYYLRFIK* |
| Ga0114980_100334725 | 3300009152 | Freshwater Lake | MKKGIYYVPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK* |
| Ga0114977_100344425 | 3300009158 | Freshwater Lake | MKKGIYYVPLFLILLFVMGGTFYVGDYLGFAMSTLAMLLLGEVYYLRFIK* |
| Ga0105097_107468961 | 3300009169 | Freshwater Sediment | RICTMKKGIYYLPLFLILLFVMGGTFYVGDYLGFAMSSLSMLLLGEVYYLRFIK* |
| Ga0114974_107410403 | 3300009183 | Freshwater Lake | YYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFLK* |
| Ga0129333_104214922 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGIYYLPLFLILLFVMAGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK* |
| Ga0129336_106830982 | 3300010370 | Freshwater To Marine Saline Gradient | MKKGIYYLPLFLLILFTMVGTFYIGDYLGFGMSTLSILLLGEIYYLRFLK* |
| Ga0153799_10115801 | 3300012012 | Freshwater | MKKGIYYLPLCLILLFVMVGTFYVGDYLGFVMSIISILLLGEVYYLRFIK* |
| Ga0164293_1000877912 | 3300013004 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVEDRLSFVMSTLAIVLLCEIYYLRFIK* |
| Ga0164293_100644541 | 3300013004 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYVGDRLSFVMSTLAMVLLCEIYYLRFLK* |
| Ga0075317_10733261 | 3300014309 | Natural And Restored Wetlands | MKKGIYYLPLFLMILLVMVGTFYSGDYLGFAMSSLAMLLLGEVYYLRFLK* |
| Ga0181347_11923842 | 3300017722 | Freshwater Lake | MKKGNYYLPLFLILLFVMGGTFYVEDRLGFVMSTLSMLLLGEVYYLRFIKXRSLV |
| Ga0181352_10384383 | 3300017747 | Freshwater Lake | MKKGIYYIPLFIMTLIIMVGSYYIDNYLSFANSVIVMLLLCEVYYLRFL |
| Ga0181352_11178281 | 3300017747 | Freshwater Lake | MKKGIYYVPLFLILIFIMGGTFYVSDYLGFAMSSLALLLLGEVYYLRFLK |
| Ga0181344_10513072 | 3300017754 | Freshwater Lake | MKKGIYYVPLFLILLFVIGGTFYVEDRLGFAMSTLAMLLLGEVYYLRFIKXRSLV |
| Ga0181344_10761642 | 3300017754 | Freshwater Lake | MKKGIYYLPLFLILLFVMGGTFYVSDVLSFAMSTMAMLLLCEVYYLRFLK |
| Ga0181344_11926992 | 3300017754 | Freshwater Lake | MKKGIYYVPLFLIVLFIMGGTIYIGDRLGFVMSTLAMLLLCEIYYLKFLKXRSLV |
| Ga0181344_11968432 | 3300017754 | Freshwater Lake | MKKGIYYLPLFLILLFVMGGTFYVGDVMSFVMSTLATLLLGEIYYLRFIK |
| Ga0181343_11133972 | 3300017766 | Freshwater Lake | MKKGIYYVPLFLMILFVMVGTFYDGDYLGFGMSSLAMLLLGEVYYLRFLK |
| Ga0181343_11875481 | 3300017766 | Freshwater Lake | KSRIWTMKKGIYYLPLFLILLFVMGGTFYVGDVMSFVMSTLATLLLGEIYYLRFIK |
| Ga0181359_10102293 | 3300019784 | Freshwater Lake | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLLLGEIYYLRFIK |
| Ga0181359_10459712 | 3300019784 | Freshwater Lake | MKKGIYYIPLFLILLFIMVWTFYVSNYLGFVMSTISMLLLGEVYYLRFIK |
| Ga0207193_11469092 | 3300020048 | Freshwater Lake Sediment | MKKGIYYLPLFLILLFVMVGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK |
| Ga0194113_101038083 | 3300020074 | Freshwater Lake | MKKGIYYLPLFLIILFTMAGAFYCGEYLGFATSTLSLLLLGEVYYLRFLK |
| Ga0211736_107630423 | 3300020151 | Freshwater | MKKGIYYVPLFLIIFFTMVGTFYCGDYLGFATSTLSMLLLGEVYYLRFIK |
| Ga0211734_101784762 | 3300020159 | Freshwater | MKKGIYYLPLFLLILFIMVGTFYCGDYLGFATSTLSMLLLGEVYYLRFIK |
| Ga0211726_100022742 | 3300020161 | Freshwater | MKKGIYYLPLFLLILFIMVGTFYCGDYLGFAMSTLSMLLLGEVYYLRFIK |
| Ga0208484_10168502 | 3300020504 | Freshwater | MKKGIYYLPLFLILLFVMAGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIKXKN |
| Ga0208091_10076642 | 3300020506 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFLK |
| Ga0208091_10307653 | 3300020506 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVEDRLSFVMSTLAIVLLCEI |
| Ga0208223_10309133 | 3300020519 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVEDRLGFVMSTLAMLLLGEVYYLRFIK |
| Ga0208232_10119964 | 3300020527 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFIK |
| Ga0208235_10153403 | 3300020530 | Freshwater | KKKNKMKKGIYYVPLFLILLFVMGGTFYVEDRLSFVMSTLAIVLLCEIYYLRFIK |
| Ga0208228_10268023 | 3300020535 | Freshwater | PLFLILLFVMAGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK |
| Ga0207942_10023346 | 3300020549 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVEDRLSFVMSTLAIVLLCEIYYLRFIK |
| Ga0208486_10141432 | 3300020556 | Freshwater | MKKGIYYVPLFIIILFIMGGTMYVGDRLSFVMSTLAMVLLCEIYYLRFLK |
| Ga0208083_10741102 | 3300020559 | Freshwater | MKKGIYYVPLFLILLFVMGGTLYVEDRLGFVMSTLAMLLLGEVYYLRFIKXRSLV |
| Ga0208852_10583822 | 3300020560 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFIKXL |
| Ga0208719_10939602 | 3300020564 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLLLGEIYYLRFIKXRSLV |
| Ga0194130_101064921 | 3300021376 | Freshwater Lake | MKKGIYYLPLFLIILFTMAGAFYCGEYLGFATSTLSLLLLGEVY |
| Ga0222715_103528702 | 3300021960 | Estuarine Water | MKKGIYYLPLFLIVLFIMGSTMYVGDQLGFVTSTLVLLLLCEVYYLRFLK |
| Ga0222712_100732162 | 3300021963 | Estuarine Water | MKKGIYYLPLFLILLFVMGGTFYVGDYLGFGTSTMAMLLLGEVYYLRFIK |
| Ga0181353_11214742 | 3300022179 | Freshwater Lake | MKKGIYYVPLFLIVLFIMGGTMYVGDRLSFVMSTLAMVLLCEIYYLRFLK |
| Ga0181353_11359042 | 3300022179 | Freshwater Lake | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRF |
| Ga0181351_10437902 | 3300022407 | Freshwater Lake | MKKGIYYVPLFLILLFVMAGTFYVGDYLGFGTSTMAMLLLGEVYYLRFIK |
| Ga0181351_10591442 | 3300022407 | Freshwater Lake | MKKGIYYVPLFIIILFIMGGTFYIEDRIGFIMSTLTFVLLCEVYYLRFLK |
| Ga0210003_100119636 | 3300024262 | Deep Subsurface | MKKGIYYLPLCLILLFIMVGTFYVGDYLGFVMSIISMLLLGEVYYLRFIK |
| Ga0255250_10914061 | 3300025763 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLL |
| Ga0255102_10198673 | 3300027144 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLLLGEI |
| Ga0255113_10303882 | 3300027147 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLL |
| Ga0255131_10156511 | 3300027285 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLLL |
| Ga0255131_10633032 | 3300027285 | Freshwater | MKKGIYYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFLKXL |
| Ga0255129_10548912 | 3300027286 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLA |
| Ga0255126_10453151 | 3300027295 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALL |
| Ga0255133_10541691 | 3300027368 | Freshwater | MKKGIYYVPLFLILIFIMGGTFYVGDRLSFVMSTLALLLLGEIYYLRFI |
| Ga0209442_10807513 | 3300027732 | Freshwater Lake | MKKGIYYIPLFLILLFIMVGTFYVSNYLGFVMSTISMLLLGEVYYLRFIK |
| Ga0209297_10005438 | 3300027733 | Freshwater Lake | MKKGIYYVPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK |
| Ga0209296_13779603 | 3300027759 | Freshwater Lake | YYVPLFLIVLFIMGGTMYIGDRLGFVMSTLAMLLLCEIYYLRFLK |
| Ga0209768_102124772 | 3300027772 | Freshwater Lake | MKKGIYYLPLCLILLFVMVGTFYVGDYLGFVMSIISILLLGEVYYLRFIK |
| Ga0209972_100866732 | 3300027793 | Freshwater Lake | MKKGIYYVPLFLILLFVMVGTFYVSDYLGFAMSSLALLLLGEVYYLRFLKXL |
| Ga0209358_101103712 | 3300027804 | Freshwater Lake | MKKGIYYIPLFIMTLIIMVGSYYIDNYLSFANSVIVMLLLCEVYYLRFLK |
| Ga0209358_104482062 | 3300027804 | Freshwater Lake | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK |
| Ga0209229_100101666 | 3300027805 | Freshwater And Sediment | MKKGIYYVPLFLILLFVMGGTFYVGDRLSFVMSTLAIVLLCEIYYLRFIK |
| Ga0209668_102607561 | 3300027899 | Freshwater Lake Sediment | MKKGIYYLPLFLILLFVMGGTFYVEDRLGFAMSTLAMLLLGEVYYLRFIK |
| Ga0209668_103536493 | 3300027899 | Freshwater Lake Sediment | MKKGIYYVPLFLMILFVMVGTFYDGDYLGFGTSTMSMLLLGEVYYLRFLK |
| Ga0209668_111020503 | 3300027899 | Freshwater Lake Sediment | IYYLPLFLILLFVMGGTFYVGDRLSFVMSTLAMLLLGEVYYLRFIK |
| Ga0209253_111430032 | 3300027900 | Freshwater Lake Sediment | MKKGIYYVPLFLILLFVMGGTFYVGDVMSFVMSTLATLLLGEIYYLRFIK |
| Ga0315907_106332553 | 3300031758 | Freshwater | MKKGIYYLPLFLLILFTMVGTFYIGDYLGFGMSTLSILLLGEIYYLRFIK |
| Ga0315907_111458183 | 3300031758 | Freshwater | MKKGIYYLPLFLILLFVMAGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK |
| Ga0315288_108334072 | 3300031772 | Sediment | KMKKGIYYIPLFLILLFIMVWTFYVSNYLGFVMSTISMLLLGEVYYLRFIK |
| Ga0315899_117656262 | 3300031784 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK |
| Ga0315909_103100482 | 3300031857 | Freshwater | MKKGIYYLPLFLILLFVIAGTFYVGDYLGFAMSSLAMLLLGEVYYLRFLK |
| Ga0315909_105121472 | 3300031857 | Freshwater | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYL |
| Ga0315904_104512951 | 3300031951 | Freshwater | MKKGIYYVPLFLIVLFIMGGTFYIEDRIGFIMSTLTFVLLC |
| Ga0315904_112576792 | 3300031951 | Freshwater | MKKGIYYLPLFLILLFVMGGTFYVGDYLGFAMSTLSMLLLGEVYYLRFLK |
| Ga0315904_113624332 | 3300031951 | Freshwater | MKKGIYYLPLFLILLFVMAGTFYVSDYLGFAMSSLAMLLLG |
| Ga0315274_120685041 | 3300031999 | Sediment | KKGIYYIPLFLILLFIMVWTFYVSNYLGFVMSTISMLLLGEVYYLRFIK |
| Ga0315905_10000017116 | 3300032092 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVEDRLGFAMSTLSLLLLGEVYYLRFLK |
| Ga0315905_102131361 | 3300032092 | Freshwater | MKKGIYYLPLFLILLFVMGGTFYVEDRLGFVMSTLSILLLCEIYYLRFIK |
| Ga0315903_108737662 | 3300032116 | Freshwater | MKKGIYYLPLFLLILFIMVGTFYCGDYLGFAMSTLSMLLLGEVYYLRFIKXL |
| Ga0316195_101683482 | 3300032263 | Sediment | MKKGIYYLPLFLILLFVICGTFYVGDYLGFGTSTMAMLLLGEVYYLRFLK |
| Ga0316625_1005288012 | 3300033418 | Soil | MKKGIYYLPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIKXL |
| Ga0316627_1019968081 | 3300033482 | Soil | MKKGIYYVPLFLILLFVMGGTFYVGDYLGFAMSSLAMLLLGEVYYLRF |
| Ga0334980_0180120_311_463 | 3300033816 | Freshwater | MKKGIYYLPLFLILLFVMGGTFYVEDRLGFVMSTLSMLLLGEVYYLRFIK |
| Ga0334987_0001373_4582_4734 | 3300034061 | Freshwater | MKKGIYYVPLFLIIFFTMVGTFYCGDYLSFATSTLSMLLLGEVYYLRFIK |
| Ga0335010_0187007_1138_1275 | 3300034092 | Freshwater | YYVPLFLILLFVMGGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK |
| Ga0335010_0350612_684_824 | 3300034092 | Freshwater | MKKGIYYVPLFIIILFIMGGTMYVGDRLSFVMSTLAMVLLCEIYYLR |
| Ga0335029_0343792_3_134 | 3300034102 | Freshwater | MKKGIYYLPLFLIVLFVTWGTYYIENYLGFTVSIISMLLLCEIY |
| Ga0335049_0343921_650_802 | 3300034272 | Freshwater | MKKGIYYVPLFLILLFVMGGTFYVGDVLSFVMSTLAILLLSEIYYLRFIK |
| Ga0334997_0679548_197_349 | 3300034280 | Freshwater | MKKGIYYLPLFLILLFVMVGTFYVSDYLGFAMSSLAMLLLGEVYYLRFIK |
| Ga0335007_0059042_1326_1478 | 3300034283 | Freshwater | MKKGIYYLPLFLIVLFVTWGTYYIENYLGFTMSIISMLLLCEIYYLRFLK |
| ⦗Top⦘ |