| Basic Information | |
|---|---|
| Family ID | F048836 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREFD |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.24 % |
| % of genes near scaffold ends (potentially truncated) | 95.92 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.626 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.449 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.259 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 8.45% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF01047 | MarR | 11.56 |
| PF02771 | Acyl-CoA_dh_N | 5.44 |
| PF00583 | Acetyltransf_1 | 3.40 |
| PF13460 | NAD_binding_10 | 3.40 |
| PF00571 | CBS | 2.72 |
| PF02452 | PemK_toxin | 2.72 |
| PF13271 | DUF4062 | 2.72 |
| PF13520 | AA_permease_2 | 2.72 |
| PF07883 | Cupin_2 | 2.04 |
| PF02913 | FAD-oxidase_C | 2.04 |
| PF01828 | Peptidase_A4 | 1.36 |
| PF08327 | AHSA1 | 1.36 |
| PF00903 | Glyoxalase | 1.36 |
| PF04149 | DUF397 | 1.36 |
| PF01545 | Cation_efflux | 0.68 |
| PF04185 | Phosphoesterase | 0.68 |
| PF01923 | Cob_adeno_trans | 0.68 |
| PF00768 | Peptidase_S11 | 0.68 |
| PF07161 | LppX_LprAFG | 0.68 |
| PF00406 | ADK | 0.68 |
| PF13391 | HNH_2 | 0.68 |
| PF05988 | DUF899 | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF03235 | DUF262 | 0.68 |
| PF06032 | DUF917 | 0.68 |
| PF01494 | FAD_binding_3 | 0.68 |
| PF13476 | AAA_23 | 0.68 |
| PF00535 | Glycos_transf_2 | 0.68 |
| PF03572 | Peptidase_S41 | 0.68 |
| PF01243 | Putative_PNPOx | 0.68 |
| PF00909 | Ammonium_transp | 0.68 |
| PF04542 | Sigma70_r2 | 0.68 |
| PF12256 | TcdB_toxin_midN | 0.68 |
| PF10722 | YbjN | 0.68 |
| PF13338 | AbiEi_4 | 0.68 |
| PF11066 | DUF2867 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 5.44 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 2.72 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 2.04 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.36 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.68 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.68 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.68 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.68 |
| COG3535 | Uncharacterized conserved protein, DUF917 family | Function unknown [S] | 0.68 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.68 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.68 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.68 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.68 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.68 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.68 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.68 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.68 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.63 % |
| Unclassified | root | N/A | 35.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10670476 | Not Available | 599 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100968379 | Not Available | 734 | Open in IMG/M |
| 3300005341|Ga0070691_10761088 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005435|Ga0070714_101386576 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005454|Ga0066687_10719467 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005539|Ga0068853_100370205 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300005617|Ga0068859_101254076 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005843|Ga0068860_100528094 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005892|Ga0075275_1047863 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300006804|Ga0079221_10246688 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300006871|Ga0075434_102294310 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009038|Ga0099829_11133955 | Not Available | 648 | Open in IMG/M |
| 3300009089|Ga0099828_11972185 | Not Available | 511 | Open in IMG/M |
| 3300009090|Ga0099827_11614866 | Not Available | 565 | Open in IMG/M |
| 3300009521|Ga0116222_1562479 | Not Available | 500 | Open in IMG/M |
| 3300009636|Ga0116112_1102624 | Not Available | 806 | Open in IMG/M |
| 3300009672|Ga0116215_1229143 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300009698|Ga0116216_10091677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerimonospora → Sphaerimonospora thailandensis | 1870 | Open in IMG/M |
| 3300009698|Ga0116216_10312994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300009824|Ga0116219_10367469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300009839|Ga0116223_10499801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300009839|Ga0116223_10503303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300010043|Ga0126380_11354293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300010046|Ga0126384_10687508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 905 | Open in IMG/M |
| 3300010048|Ga0126373_10074987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3066 | Open in IMG/M |
| 3300010048|Ga0126373_10888238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300010048|Ga0126373_11802540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300010361|Ga0126378_11210843 | Not Available | 853 | Open in IMG/M |
| 3300010373|Ga0134128_11534222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 733 | Open in IMG/M |
| 3300010376|Ga0126381_100336362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2082 | Open in IMG/M |
| 3300010376|Ga0126381_104749498 | Not Available | 523 | Open in IMG/M |
| 3300010379|Ga0136449_101085370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1276 | Open in IMG/M |
| 3300010379|Ga0136449_102183787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300010379|Ga0136449_103484652 | Not Available | 600 | Open in IMG/M |
| 3300010876|Ga0126361_11000744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 626 | Open in IMG/M |
| 3300010876|Ga0126361_11239233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2329 | Open in IMG/M |
| 3300011119|Ga0105246_11363790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300011269|Ga0137392_10136170 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300011271|Ga0137393_11268675 | Not Available | 625 | Open in IMG/M |
| 3300012189|Ga0137388_10735682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 916 | Open in IMG/M |
| 3300012189|Ga0137388_11083732 | Not Available | 737 | Open in IMG/M |
| 3300012209|Ga0137379_10757222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300012209|Ga0137379_11024067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300012211|Ga0137377_10811240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 868 | Open in IMG/M |
| 3300012351|Ga0137386_10117729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1889 | Open in IMG/M |
| 3300012357|Ga0137384_10739299 | Not Available | 798 | Open in IMG/M |
| 3300012357|Ga0137384_11098712 | Not Available | 637 | Open in IMG/M |
| 3300012359|Ga0137385_11176381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 628 | Open in IMG/M |
| 3300012944|Ga0137410_10387482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
| 3300015357|Ga0134072_10019443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1676 | Open in IMG/M |
| 3300016319|Ga0182033_10858543 | Not Available | 802 | Open in IMG/M |
| 3300016341|Ga0182035_11492977 | Not Available | 608 | Open in IMG/M |
| 3300016371|Ga0182034_10132853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha | 1843 | Open in IMG/M |
| 3300016422|Ga0182039_10262206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
| 3300017792|Ga0163161_11473217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300017932|Ga0187814_10278844 | Not Available | 637 | Open in IMG/M |
| 3300017940|Ga0187853_10330616 | Not Available | 684 | Open in IMG/M |
| 3300017943|Ga0187819_10136287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1463 | Open in IMG/M |
| 3300017970|Ga0187783_10876045 | Not Available | 647 | Open in IMG/M |
| 3300017972|Ga0187781_11237985 | Not Available | 550 | Open in IMG/M |
| 3300017995|Ga0187816_10045631 | Not Available | 1819 | Open in IMG/M |
| 3300020070|Ga0206356_11904339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300020582|Ga0210395_11205836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 556 | Open in IMG/M |
| 3300020583|Ga0210401_11172387 | Not Available | 627 | Open in IMG/M |
| 3300021171|Ga0210405_10714610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 773 | Open in IMG/M |
| 3300021178|Ga0210408_10755287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 763 | Open in IMG/M |
| 3300021178|Ga0210408_10976360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 656 | Open in IMG/M |
| 3300021402|Ga0210385_10423489 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300021404|Ga0210389_10998519 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021478|Ga0210402_11294735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 656 | Open in IMG/M |
| 3300021479|Ga0210410_11409640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300021560|Ga0126371_10450905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1432 | Open in IMG/M |
| 3300021560|Ga0126371_13357689 | Not Available | 541 | Open in IMG/M |
| 3300024254|Ga0247661_1017204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300025898|Ga0207692_11214936 | Not Available | 501 | Open in IMG/M |
| 3300025907|Ga0207645_10441199 | Not Available | 878 | Open in IMG/M |
| 3300025920|Ga0207649_10017381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4076 | Open in IMG/M |
| 3300025929|Ga0207664_11203114 | Not Available | 676 | Open in IMG/M |
| 3300025961|Ga0207712_10592967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 958 | Open in IMG/M |
| 3300025972|Ga0207668_10446261 | Not Available | 1103 | Open in IMG/M |
| 3300027096|Ga0208099_1000733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3699 | Open in IMG/M |
| 3300027648|Ga0209420_1058956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 1138 | Open in IMG/M |
| 3300027703|Ga0207862_1059099 | Not Available | 1155 | Open in IMG/M |
| 3300027725|Ga0209178_1188415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300027795|Ga0209139_10064421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1285 | Open in IMG/M |
| 3300027817|Ga0209112_10101750 | Not Available | 929 | Open in IMG/M |
| 3300027853|Ga0209274_10380666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300027854|Ga0209517_10023058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5628 | Open in IMG/M |
| 3300027905|Ga0209415_10103862 | All Organisms → cellular organisms → Bacteria | 3100 | Open in IMG/M |
| 3300028781|Ga0302223_10031707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1871 | Open in IMG/M |
| 3300028784|Ga0307282_10551940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300028867|Ga0302146_10145061 | Not Available | 958 | Open in IMG/M |
| 3300028867|Ga0302146_10429476 | Not Available | 503 | Open in IMG/M |
| 3300029951|Ga0311371_11458032 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300030058|Ga0302179_10331431 | Not Available | 670 | Open in IMG/M |
| 3300030399|Ga0311353_11159832 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300030490|Ga0302184_10003893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9271 | Open in IMG/M |
| 3300030490|Ga0302184_10160597 | Not Available | 968 | Open in IMG/M |
| 3300030618|Ga0311354_10429027 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300030706|Ga0310039_10354964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300030707|Ga0310038_10067915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium innocens | 1948 | Open in IMG/M |
| 3300030739|Ga0302311_10557028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 778 | Open in IMG/M |
| 3300031231|Ga0170824_123523472 | Not Available | 576 | Open in IMG/M |
| 3300031234|Ga0302325_10490032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 1863 | Open in IMG/M |
| 3300031234|Ga0302325_10903192 | Not Available | 1225 | Open in IMG/M |
| 3300031234|Ga0302325_11113932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1062 | Open in IMG/M |
| 3300031525|Ga0302326_12546127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300031544|Ga0318534_10642467 | Not Available | 601 | Open in IMG/M |
| 3300031561|Ga0318528_10661561 | Not Available | 559 | Open in IMG/M |
| 3300031682|Ga0318560_10111875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1421 | Open in IMG/M |
| 3300031708|Ga0310686_110971989 | Not Available | 893 | Open in IMG/M |
| 3300031708|Ga0310686_112408344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 692 | Open in IMG/M |
| 3300031708|Ga0310686_112862259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2988 | Open in IMG/M |
| 3300031713|Ga0318496_10016860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3557 | Open in IMG/M |
| 3300031713|Ga0318496_10256392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya | 964 | Open in IMG/M |
| 3300031736|Ga0318501_10425445 | Not Available | 719 | Open in IMG/M |
| 3300031747|Ga0318502_10081967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1759 | Open in IMG/M |
| 3300031748|Ga0318492_10010745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3739 | Open in IMG/M |
| 3300031751|Ga0318494_10731155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300031768|Ga0318509_10773969 | Not Available | 531 | Open in IMG/M |
| 3300031770|Ga0318521_10100379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1592 | Open in IMG/M |
| 3300031770|Ga0318521_10181550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya | 1208 | Open in IMG/M |
| 3300031788|Ga0302319_10706592 | Not Available | 1021 | Open in IMG/M |
| 3300031792|Ga0318529_10304712 | Not Available | 742 | Open in IMG/M |
| 3300031793|Ga0318548_10441118 | Not Available | 638 | Open in IMG/M |
| 3300031795|Ga0318557_10597301 | Not Available | 506 | Open in IMG/M |
| 3300031821|Ga0318567_10209014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1091 | Open in IMG/M |
| 3300031835|Ga0318517_10353304 | Not Available | 664 | Open in IMG/M |
| 3300031846|Ga0318512_10020336 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
| 3300031941|Ga0310912_10458087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 994 | Open in IMG/M |
| 3300031954|Ga0306926_10408884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
| 3300031954|Ga0306926_12943418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300031959|Ga0318530_10170986 | Not Available | 887 | Open in IMG/M |
| 3300032001|Ga0306922_11239904 | Not Available | 757 | Open in IMG/M |
| 3300032039|Ga0318559_10058051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1638 | Open in IMG/M |
| 3300032041|Ga0318549_10563872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella capetownensis | 511 | Open in IMG/M |
| 3300032055|Ga0318575_10301863 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300032060|Ga0318505_10230193 | Not Available | 871 | Open in IMG/M |
| 3300032091|Ga0318577_10062596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
| 3300032091|Ga0318577_10269382 | Not Available | 815 | Open in IMG/M |
| 3300032160|Ga0311301_10204519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3374 | Open in IMG/M |
| 3300032180|Ga0307471_102442017 | Not Available | 661 | Open in IMG/M |
| 3300032895|Ga0335074_11394435 | Not Available | 568 | Open in IMG/M |
| 3300032896|Ga0335075_10272352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1924 | Open in IMG/M |
| 3300032896|Ga0335075_10402232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. TFC3 | 1455 | Open in IMG/M |
| 3300032896|Ga0335075_11739497 | Not Available | 504 | Open in IMG/M |
| 3300032898|Ga0335072_10014044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Thermocatellispora → Thermocatellispora tengchongensis | 11380 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.20% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.20% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.04% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.36% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_106704761 | 3300001593 | Forest Soil | MKIIEGGLRVAASDVANFLACQQLTQLDLGAARGALRPPH |
| JGIcombinedJ26739_1009683791 | 3300002245 | Forest Soil | MRIVEGRVRVAASDVANFLACQELTQLDLRAARGVLRPP |
| Ga0070691_107610882 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDIGFRDLVRR |
| Ga0070714_1013865762 | 3300005435 | Agricultural Soil | VKIISGRLRLSASDVANFLACQHLTRLDLLQAHGELRPPHASDISFAALVER |
| Ga0066687_107194671 | 3300005454 | Soil | MKITEGRVRLAASDVANFLACRRLTQLDLARARGELRPPREFDVGFQDLVRRGEV |
| Ga0068853_1003702053 | 3300005539 | Corn Rhizosphere | MKISEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDIGFR |
| Ga0068859_1012540762 | 3300005617 | Switchgrass Rhizosphere | MKISEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPRE |
| Ga0068860_1005280941 | 3300005843 | Switchgrass Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDIGF |
| Ga0075275_10478631 | 3300005892 | Rice Paddy Soil | VKITGDRLRLSASDVANFLACQHLTRLDVLRAHGRLQPPQVYDLGFEDLVKRGE |
| Ga0079221_102466881 | 3300006804 | Agricultural Soil | MKVTDGRVRVAASDVANFLACRRLTQLDLARARGELRPPREFDIGF |
| Ga0075434_1022943101 | 3300006871 | Populus Rhizosphere | MKVTDGRVRVAASDVANFLACRRLTQLDLARARGELRPPHARDLGF |
| Ga0099829_111339551 | 3300009038 | Vadose Zone Soil | MKITDSRVRLSASDVANYLACQHLSRVYLQRALGTLRPPHEFEIRFQDLVQRGEAHE |
| Ga0099828_119721851 | 3300009089 | Vadose Zone Soil | MKITGAHLRLAASDVANFLACRRLTQLDLLRARGELRPPREF |
| Ga0099827_116148662 | 3300009090 | Vadose Zone Soil | MKITGAHLRLAASDVANFLACRRLTQLDLLRARGELRPP |
| Ga0116222_15624792 | 3300009521 | Peatlands Soil | MRGQKMKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREFD |
| Ga0116112_11026241 | 3300009636 | Peatland | VKFAGERLRLSASDVANFVACQHMTRLDLLEARGTLHRPRRFDVG |
| Ga0116215_12291431 | 3300009672 | Peatlands Soil | VRLAASDVANFLACRRLTQLDLLRARGELRPPREFDIGFQDL |
| Ga0116216_100916772 | 3300009698 | Peatlands Soil | MMIIEGRVRLAASDVANFLACRRLTQLDLLRARGELRP* |
| Ga0116216_103129942 | 3300009698 | Peatlands Soil | MKIIAGRVRVAASDVANFLDCRRLTQLDLLRAQRELEPP |
| Ga0116219_103674692 | 3300009824 | Peatlands Soil | MKIIEGRVRVSASDVANFLACQELTQLDLRAAQRTLRPSRDSLE |
| Ga0116223_104998011 | 3300009839 | Peatlands Soil | MKIIEGRVRVSASDVANFLACQELTQLDLRAAQRTLRPSRDSLERSRAQAR |
| Ga0116223_105033031 | 3300009839 | Peatlands Soil | MKITEGRVRVAASDVANFLACRRLMQLDLLRARGS |
| Ga0126380_113542931 | 3300010043 | Tropical Forest Soil | VRLERNGRLRLSASDVANFLACGHLTRLDLLHARGELDPPYAFDSGF |
| Ga0126384_106875081 | 3300010046 | Tropical Forest Soil | MRITEGRLRVSASDVANFLACRQLTQLDLQAAQRTLRPPYA |
| Ga0126373_100749871 | 3300010048 | Tropical Forest Soil | VRVIDGRVRLAASDVANFLACRHLTRLDLLRARGVIEPPHQYDAGF |
| Ga0126373_108882383 | 3300010048 | Tropical Forest Soil | VRIIDGRVRLAASDVANFLACRHLTRLDLLRARGVIEPPHQYDAGFEDLVKRGW |
| Ga0126373_118025402 | 3300010048 | Tropical Forest Soil | VRIIDQRVRLAASDVANFLACRHLTRLDLLRARGVIEPPHQYDAGF |
| Ga0126378_112108433 | 3300010361 | Tropical Forest Soil | VRIIDGQVRLSASDVANFLACRHLTRLELLHARDLINPPYFNDAGFDDIVK |
| Ga0134128_115342222 | 3300010373 | Terrestrial Soil | MKVTDGRVRVAASDVANFLACRRLTQLDLARARGELRPPREFDIGF* |
| Ga0126381_1003363624 | 3300010376 | Tropical Forest Soil | VRVIDGRVRLAASDVANFLACRHLTRLDLLRARGVI |
| Ga0126381_1047494981 | 3300010376 | Tropical Forest Soil | MRVIDGQVRLSASDVANFLACRHLTRLELLHARRVIDPPYFSDAGFD |
| Ga0136449_1010853701 | 3300010379 | Peatlands Soil | MKFAGDRLRLSASDVANFVACQHMTRLDLLEARGALHRPREFDL |
| Ga0136449_1021837871 | 3300010379 | Peatlands Soil | VRLAASDVANFLACQRLTQLDLLRARGELRPPREFDVGFQELVRREHDIRDVS* |
| Ga0136449_1034846521 | 3300010379 | Peatlands Soil | VRLDKGQLRLAASDVANFVACGHLTRLDLLHAWGEIQPPRAFDVGFQDLVARGEAHEAAVLQR |
| Ga0126361_110007442 | 3300010876 | Boreal Forest Soil | MKVIGGRVRLAASDVANFLACRRLTQLDLLRARGELRAPREFDVGFEELVRRG |
| Ga0126361_112392333 | 3300010876 | Boreal Forest Soil | MKITEGRARLAASDDANFLACRRLTQLDLLMARKELEPSREA* |
| Ga0105246_113637902 | 3300011119 | Miscanthus Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREFDIGF |
| Ga0137392_101361701 | 3300011269 | Vadose Zone Soil | MKITDSRVRLSASDVANYLACQRLTRLDLQRALGTLRPPHEFDIGFQD |
| Ga0137393_112686753 | 3300011271 | Vadose Zone Soil | MQMKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRP |
| Ga0137388_107356821 | 3300012189 | Vadose Zone Soil | MKITDSRVRLSASDVANYLACQHLSRLDLQRALGTLRPPHEFDIGFQDLVQ |
| Ga0137388_110837321 | 3300012189 | Vadose Zone Soil | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREFD |
| Ga0137379_107572221 | 3300012209 | Vadose Zone Soil | MKITEGRVRVSASDVANFLACQQLTQLDLQAARRT |
| Ga0137379_110240672 | 3300012209 | Vadose Zone Soil | MKIIEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREF |
| Ga0137377_108112401 | 3300012211 | Vadose Zone Soil | VKITEGRLRLSASDVANYLACQHLTRLDLRRAQGTLRPPRE |
| Ga0137386_101177294 | 3300012351 | Vadose Zone Soil | MKIAEGRLRVSASDVANFLACRRLTQLDLLRARGELRPPHA |
| Ga0137384_107392992 | 3300012357 | Vadose Zone Soil | MKITEGRLRLAASDVANFLACRRLTQLDLLRARGELRPPREFD |
| Ga0137384_110987121 | 3300012357 | Vadose Zone Soil | MKITEGRLRLSASDVANYLACQHLTRLDLQMAQGTLRPPREFDIGFQD |
| Ga0137385_111763811 | 3300012359 | Vadose Zone Soil | VKITEGRLRLSASDVANYLACQHLTRLDLRRAQGTLRPPREFDIGFQDL |
| Ga0137410_103874821 | 3300012944 | Vadose Zone Soil | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGKLR |
| Ga0134072_100194431 | 3300015357 | Grasslands Soil | MKISEGRVRLAASDVANFLACRRLTQLDLLRARGELR |
| Ga0182033_108585431 | 3300016319 | Soil | VKITDSQVRLSASDVANFLACQHLTRLDLLRARGELAPPRRFDVGFQDLIK |
| Ga0182035_114929772 | 3300016341 | Soil | VKITGGRLRLSASDVANFLACQHLTRLDLLQAREQLHPPHEFD |
| Ga0182034_101328533 | 3300016371 | Soil | VKITGGRLRLSASDVANFLACQHLTRLDLLRARGQLHPP |
| Ga0182039_102622062 | 3300016422 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGE |
| Ga0163161_114732171 | 3300017792 | Switchgrass Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDIGFRDLV |
| Ga0187814_102788441 | 3300017932 | Freshwater Sediment | VRIIDGRVRLAASDVANFLACRHLTRLDLLHARGLISPPHVYDAGFEDLVKRGE |
| Ga0187853_103306162 | 3300017940 | Peatland | VKFAGERLRLSASDVANFVACQHMTRLDLLEARGTLHRPRRFDVGFEDLVQ |
| Ga0187819_101362873 | 3300017943 | Freshwater Sediment | MKAIEGRLRVSASDVANFLACQQLTQLDLQRARGELRPPHARDLGLDEL |
| Ga0187783_108760452 | 3300017970 | Tropical Peatland | VRIIDGQVRLAASDVANFLACRHLTRLDLLHARKLIDPPRFYDAGFEDL |
| Ga0187781_112379851 | 3300017972 | Tropical Peatland | VRIIDGQVRLAASDVANFLACRHLTRLDLLRARGVIEPPRFYD |
| Ga0187816_100456311 | 3300017995 | Freshwater Sediment | VRIIDGQVRLAASDVANFLACRHLTRLDLLRARGVISPPYFS |
| Ga0206356_119043391 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREFDIGFQDLV |
| Ga0210395_112058361 | 3300020582 | Soil | MKFTEGRLRLAASDVANFLACRRLTQLDLLMARDELEPPRKYDIGFQDLVRR |
| Ga0210401_111723872 | 3300020583 | Soil | MRIVEGRVRVAASDVANFLACQELTQLDLRAARRTLRPPHPRDLGLEDLV |
| Ga0210405_107146101 | 3300021171 | Soil | MKITEGRLRLAASDVANFLACRRLTQLDLLMARDELEPPRKYDIGFQDLVRGGEV |
| Ga0210408_107552871 | 3300021178 | Soil | MKITEGRVRLAASDVANFLACRRLTQMDLLRARGELR |
| Ga0210408_109763601 | 3300021178 | Soil | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGGLRPPREFDIGFQDLVRRGEVH |
| Ga0210385_104234893 | 3300021402 | Soil | VKVIDSGLRLSASDVANFLACQHLTRLDLLAARGELKPPREVDVGFLDL |
| Ga0210389_109985193 | 3300021404 | Soil | VRVIDIGLRLSASDVANFLACQHLTRLDLLAARGELKPPREVDVGFL |
| Ga0210402_112947351 | 3300021478 | Soil | MKITEGRLRLAASDVANFLACRRLTQLDLLLARAELEPPRKYDIGFPAL |
| Ga0210410_114096402 | 3300021479 | Soil | MKVTDGRVRLAASDVANFLACRRLTQLDLARARGELRPPREF |
| Ga0126371_104509051 | 3300021560 | Tropical Forest Soil | VRIIDGQVRLSASDVANFLACRHLTRLELLHARDL |
| Ga0126371_133576892 | 3300021560 | Tropical Forest Soil | MRIDGEQVRLSASDVANFLACRHLTRLDLLRARGVISPP |
| Ga0247661_10172041 | 3300024254 | Soil | MKISEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDIG |
| Ga0207692_112149361 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLQAGRLRLSASDVANFLACHHLTRLDMLSAQGKLRPPHAYDAGF |
| Ga0207645_104411992 | 3300025907 | Miscanthus Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLAWARGEMRPPREFDIGFRDLV |
| Ga0207649_100173811 | 3300025920 | Corn Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPP |
| Ga0207664_112031141 | 3300025929 | Agricultural Soil | VKIISGRLRLSASDVANFLACQHLTRLDLLHARGELQPRHVYDIGFASL |
| Ga0207712_105929673 | 3300025961 | Switchgrass Rhizosphere | MKITEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDIG |
| Ga0207668_104462612 | 3300025972 | Switchgrass Rhizosphere | MKISEGRVRLAASDVANFLACRRLTQLDLAWARGELRPPREFDI |
| Ga0208099_10007333 | 3300027096 | Forest Soil | MKIIEGRVRVAASDVANFLACQELTQLDLRAARGTLRPPHPVDLGF |
| Ga0209420_10589561 | 3300027648 | Forest Soil | MKIVEGRVRVAASDVANFLACQELTQLDLRAARGALRPPHPVDLGFEDLV |
| Ga0207862_10590991 | 3300027703 | Tropical Forest Soil | VKIADGRLRLSASNIANFLACQHLTRLDLLRARGELRPPREFDIGFADLI |
| Ga0209178_11884152 | 3300027725 | Agricultural Soil | MKVTDGRVRVAASDVANFLACRRLTQLDLARARGELRPPHARDL |
| Ga0209139_100644211 | 3300027795 | Bog Forest Soil | MRIVEGRVRVAASDVANFLACQELTQLDLRAARRTLRP |
| Ga0209112_101017502 | 3300027817 | Forest Soil | MRFAGDRLRVSASDVANFLACQRLTSLDLRRASGELKPP |
| Ga0209274_103806662 | 3300027853 | Soil | MKIIEGHVRLAASDVANFLACQRLTQLDLLRARGEL |
| Ga0209517_100230581 | 3300027854 | Peatlands Soil | MKITEGRVRLAASDVANFLACRRLTQLDLLRAGAVLE |
| Ga0209415_101038623 | 3300027905 | Peatlands Soil | MKIIEGRVRLAASDVANFLACRRLTQLDLLRARGELRP |
| Ga0302223_100317074 | 3300028781 | Palsa | MKIIGGRVRLAASDVANFLACRRLTQLDLLRARGE |
| Ga0307282_105519401 | 3300028784 | Soil | MKITEGRVRLAASDVANFLACRRLTQLDLLRARGELRPPREF |
| Ga0302146_101450611 | 3300028867 | Bog | VKFAGERLRLSASDVANFVACQHMTRLDLLEARGTL |
| Ga0302146_104294762 | 3300028867 | Bog | MKFAGDRLRLSASDVANFVACQHMTRLDLLEAQGRLH |
| Ga0311371_114580321 | 3300029951 | Palsa | MKIIGGRVRLAASDVANFLACRRLTQLDLLRARGELR |
| Ga0302179_103314311 | 3300030058 | Palsa | MKIIGGRVRLAASDVANFLACRRLTQLDLLRARGELRPPR |
| Ga0311353_111598323 | 3300030399 | Palsa | MKFAEDRLRLSASDVANFVACQHTTRLDLLEARGRLHRPRRFDV |
| Ga0302184_1000389313 | 3300030490 | Palsa | MKIIGGRVRLAASDVANFLACQRLTQLDLLRARGELRPPREYDVGFAEL |
| Ga0302184_101605971 | 3300030490 | Palsa | MQVTGGRVRVSASDVANFLACRRLTQLDLRRARGELRPPREFDVGFQELV |
| Ga0311354_104290274 | 3300030618 | Palsa | MKFAEDRLRLSASDVANFVACQHTTRLDLLEARGRLHRPRRFDVGFEDLVQR |
| Ga0310039_103549641 | 3300030706 | Peatlands Soil | MKIIEGRVRVSASDVANFLACQELTQLDLRAAQRT |
| Ga0310038_100679151 | 3300030707 | Peatlands Soil | MKIIAGRVRVAASDVANFLDCRRLTQLDLLRAQRELEPPR |
| Ga0302311_105570283 | 3300030739 | Palsa | MKIVGGRVRLSASDVANFLACRRLTQLDLARARGELRPPREFDV |
| Ga0170824_1235234721 | 3300031231 | Forest Soil | VKVDAGRLRLAASDVANFLACGHLTRLDMLAARGQLRPPQEYDVGFQDLVARGE |
| Ga0302325_104900321 | 3300031234 | Palsa | MKITSGQLRLSASDVSNFLACQQLTQLDLQAARGERRPTRDYDIGFQDLVRRG |
| Ga0302325_109031921 | 3300031234 | Palsa | MKITEGRLRLSASDVANFLACQQLTQLDLQAARRERRPAR |
| Ga0302325_111139323 | 3300031234 | Palsa | MKIIEGTLRVAASDVTNFLACQELTQLDLRKARGT |
| Ga0302326_125461271 | 3300031525 | Palsa | MKVIEGTLRVAASDVANFLACQELTQLDLRRARGTLQPPHPRDLGF |
| Ga0318534_106424672 | 3300031544 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARGELDPPYASDLGFRELVERGE |
| Ga0318528_106615611 | 3300031561 | Soil | VKIPGGRLRLSASDVANFLACQHLTRLDLLRARGELR |
| Ga0318560_101118752 | 3300031682 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPPYVSDLGFREL |
| Ga0310686_1109719891 | 3300031708 | Soil | MKITESRLRLSASDVANYLACQHLTQLDLQMAQGRLRPPHEFDI |
| Ga0310686_1124083441 | 3300031708 | Soil | VWLDGGRLRLSASDVANFVACGHLTRLDLLRARGEIRPPREF |
| Ga0310686_1128622594 | 3300031708 | Soil | VKLEAGRLRVAASDVANFLACGHLTRLDLLSARGQLRPPDE |
| Ga0318496_100168601 | 3300031713 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPPY |
| Ga0318496_102563922 | 3300031713 | Soil | VRITGGRLRLSASDVANFLACQHLTRLDLLRARGQLHPPHEFD |
| Ga0318501_104254451 | 3300031736 | Soil | VRLAASDVANFLACRHLTRLDLLRARGVIDPPHLYDAGFE |
| Ga0318502_100819671 | 3300031747 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGELHPPYESDLGFQELVE |
| Ga0318492_100107453 | 3300031748 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPPYASDLGFRELVERGEAHER |
| Ga0318494_107311551 | 3300031751 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPPYVSDLGFRELVERGEAHERAVLD |
| Ga0318509_107739691 | 3300031768 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGELHPPYESDLGFQELVERGE |
| Ga0318521_101003791 | 3300031770 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARGEL |
| Ga0318521_101815501 | 3300031770 | Soil | VKITGGRLRLSASDVANFLACQHLTRLDLLRARGQLHPPHEFD |
| Ga0302319_107065922 | 3300031788 | Bog | VKFAGERLRLSASDVANFVACQHMTRLDLLEARGT |
| Ga0318529_103047121 | 3300031792 | Soil | VKIPGGRLRLSASDVANFLACQHLTRLDLLRARGELRPPHEFDIGFTDLAE |
| Ga0318548_104411181 | 3300031793 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGELHPLYESD |
| Ga0318557_105973012 | 3300031795 | Soil | VKIPGGRLRLSASDVANFLACQHLTRLDLLRARGELRPPHE |
| Ga0318567_102090142 | 3300031821 | Soil | MRVIEGRPLRLAASDVANFLACQQLTQLDLQAARGELR |
| Ga0318517_103533042 | 3300031835 | Soil | VRITGGRLRLSASDVANFLACQHLTRLDLLRARGQLHPPHEFDIGFADLIERGD |
| Ga0318512_100203361 | 3300031846 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGELHPPHEFDIG |
| Ga0310912_104580872 | 3300031941 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPPYVSDLGFRELVERGEAHERAV |
| Ga0306926_104088841 | 3300031954 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGELHPPYESDLGFQELVER |
| Ga0306926_129434182 | 3300031954 | Soil | VRITEGRLRLAASDVAGFLACQQLTRLELLRARGELRPPRAADLGFEELIDFITA |
| Ga0318530_101709862 | 3300031959 | Soil | VRIIEGRVRLAASDVANFLACRHLTRLDLLRARGVIDPPHQY |
| Ga0306922_112399043 | 3300032001 | Soil | MKISESGLRLAASDVANFLACRHLTRLDLRMAQGTLRPPHEADIG |
| Ga0318559_100580513 | 3300032039 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPP |
| Ga0318549_105638722 | 3300032041 | Soil | MKIIEDRVRVAASDVANFLACQQLTQLDLQRARGTLRPPHARDLG |
| Ga0318575_103018631 | 3300032055 | Soil | VKITGGRLRLSASDVANFLACQHLTRLDLLRARGQLHPPHEFDI |
| Ga0318505_102301931 | 3300032060 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLRARGELHPPYE |
| Ga0318577_100625961 | 3300032091 | Soil | MRITGDGVRLAASDVANFLACQHLTRLDLLMARAELYPPYVSDLGFRE |
| Ga0318577_102693822 | 3300032091 | Soil | VKIPGGRLRLSASDVANFLACQHLTRLDLLRARGELRPPHEFDIGFTDLAERGN |
| Ga0311301_102045191 | 3300032160 | Peatlands Soil | VSVSDVANFLACQQLTQLDLRAAREELRPPQAVDLG |
| Ga0307471_1024420171 | 3300032180 | Hardwood Forest Soil | MKMTEGQVRVSASDVANFLACQQLTQLDLQAARRTLRPPHARDL |
| Ga0335074_113944351 | 3300032895 | Soil | MKIVEDRVRVAASDVANFLACQVLTQLDLRAAWGALEPPQAVDLGFED |
| Ga0335075_102723524 | 3300032896 | Soil | MRIDGEQVRLSASDVANFLACRHLTRLELLNARRL |
| Ga0335075_104022321 | 3300032896 | Soil | MKIDAGQLRLSASDVANFLACRHLTRLELLRARGVIRPPFANDA |
| Ga0335075_117394972 | 3300032896 | Soil | MKIDGGQLRLSASDVANFLACRHLTRLELLRARGVTWPPFAYDAGFEDLVAR |
| Ga0335072_100140441 | 3300032898 | Soil | VRLDGERLRLSASDVANFVACGHLTRLDLLRARGEIRPPRAFDLGFKDLVARGE |
| ⦗Top⦘ |