Metagenome / Metatranscriptome Family F048835

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F048835
Family Type	Metagenome / Metatranscriptome
Number of Sequences	147
Average Sequence Length	43 residues
Representative Sequence	MHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRVPDA
Number of Associated Samples	123
Number of Associated Scaffolds	147

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.04 %
% of genes near scaffold ends (potentially truncated)	93.20 %
% of genes from short scaffolds (< 2000 bps)	93.20 %
Associated GOLD sequencing projects	118
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (87.755 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.605 % of family members)
Environment Ontology (ENVO)	Unclassified (23.129 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (40.136 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 45.59% Coil/Unstructured: 54.41%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 147 Family Scaffolds
PF01370	Epimerase	40.14
PF04909	Amidohydro_2	8.84
PF12695	Abhydrolase_5	2.72
PF13563	2_5_RNA_ligase2	2.72
PF11066	DUF2867	2.04
PF01230	HIT	1.36
PF00004	AAA	1.36
PF13207	AAA_17	1.36
PF01734	Patatin	1.36
PF01464	SLT	0.68
PF13365	Trypsin_2	0.68
PF01425	Amidase	0.68
PF03109	ABC1	0.68
PF03928	HbpS-like	0.68
PF00202	Aminotran_3	0.68
PF08352	oligo_HPY	0.68
PF14534	DUF4440	0.68
PF01066	CDP-OH_P_transf	0.68
PF13460	NAD_binding_10	0.68
PF00903	Glyoxalase	0.68
PF09982	DUF2219	0.68
PF01242	PTPS	0.68
PF04392	ABC_sub_bind	0.68
PF00072	Response_reg	0.68
PF02585	PIG-L	0.68

COG ID	Name	Functional Category	% Frequency in 147 Family Scaffolds
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	1.36
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	1.36
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	1.36
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.68
COG0558	Phosphatidylglycerophosphate synthase	Lipid transport and metabolism [I]	0.68
COG0661	Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family	Signal transduction mechanisms [T]	0.68
COG0720	6-pyruvoyl-tetrahydropterin synthase	Coenzyme transport and metabolism [H]	0.68
COG1183	Phosphatidylserine synthase	Lipid transport and metabolism [I]	0.68
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	0.68
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.68
COG5050	sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases	Lipid transport and metabolism [I]	0.68

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	87.76 %
Unclassified	root	N/A	12.24 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.76 %
Unclassified	root	N/A	12.24 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	87.76 %
Unclassified	root	N/A	12.24 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	14.29 %
Unclassified	root	N/A	12.24 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	9.52 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.08 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.68 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	14.29 %
Unclassified	root	N/A	12.24 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4.08 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.08 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.68 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.68 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	14.29 %
Unclassified	root	N/A	12.24 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3.40 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.72 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.68 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.68 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	12.24 %
Unclassified	root	N/A	12.24 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.72 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	2.04 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.36 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.68 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	12.24 %
Unclassified	root	N/A	12.24 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.72 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.04 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.36 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.68 %
unclassified Verrucomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales	0.68 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	12.24 %
Unclassified	root	N/A	12.24 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.72 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.04 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.36 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.68 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.68 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101447693	All Organisms → cellular organisms → Bacteria	733	Open in IMG/M
3300000955\|JGI1027J12803_107688717	All Organisms → cellular organisms → Bacteria → Proteobacteria	894	Open in IMG/M
3300003319\|soilL2_10054851	All Organisms → cellular organisms → Bacteria	1922	Open in IMG/M
3300004019\|Ga0055439_10202947	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300005174\|Ga0066680_10644546	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	658	Open in IMG/M
3300005175\|Ga0066673_10058543	All Organisms → cellular organisms → Bacteria	1965	Open in IMG/M
3300005176\|Ga0066679_10946349	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300005181\|Ga0066678_10936590	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	565	Open in IMG/M
3300005332\|Ga0066388_101480916	All Organisms → cellular organisms → Bacteria	1186	Open in IMG/M
3300005332\|Ga0066388_101972049	All Organisms → cellular organisms → Bacteria → Proteobacteria	1045	Open in IMG/M
3300005340\|Ga0070689_101338589	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300005345\|Ga0070692_10047698	All Organisms → cellular organisms → Bacteria	2217	Open in IMG/M
3300005459\|Ga0068867_101345578	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300005467\|Ga0070706_101417609	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300005468\|Ga0070707_101778262	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300005471\|Ga0070698_100059697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3851	Open in IMG/M
3300005518\|Ga0070699_100539082	All Organisms → cellular organisms → Bacteria	1062	Open in IMG/M
3300005518\|Ga0070699_100941253	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300005536\|Ga0070697_100337179	All Organisms → cellular organisms → Bacteria	1301	Open in IMG/M
3300005546\|Ga0070696_101426823	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300005546\|Ga0070696_101761513	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300005549\|Ga0070704_100072664	All Organisms → cellular organisms → Bacteria	2503	Open in IMG/M
3300005559\|Ga0066700_10103629	All Organisms → cellular organisms → Bacteria	1868	Open in IMG/M
3300005574\|Ga0066694_10344926	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300005586\|Ga0066691_10790230	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300005713\|Ga0066905_100043791	All Organisms → cellular organisms → Bacteria → Proteobacteria	2679	Open in IMG/M
3300005713\|Ga0066905_100105184	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1928	Open in IMG/M
3300005713\|Ga0066905_101933451	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300006032\|Ga0066696_10453060	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300006804\|Ga0079221_11588717	All Organisms → cellular organisms → Bacteria → Proteobacteria	529	Open in IMG/M
3300006847\|Ga0075431_100287366	All Organisms → cellular organisms → Bacteria	1664	Open in IMG/M
3300006847\|Ga0075431_101644365	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300006871\|Ga0075434_101373782	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300006880\|Ga0075429_100139509	All Organisms → cellular organisms → Bacteria	2122	Open in IMG/M
3300006904\|Ga0075424_101618069	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300007076\|Ga0075435_100594681	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300007258\|Ga0099793_10214047	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300009089\|Ga0099828_10862263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	810	Open in IMG/M
3300009089\|Ga0099828_11016709	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	738	Open in IMG/M
3300009089\|Ga0099828_11533102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	587	Open in IMG/M
3300009090\|Ga0099827_10847580	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	791	Open in IMG/M
3300009094\|Ga0111539_11532082	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300009143\|Ga0099792_11184899	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300009597\|Ga0105259_1127233	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	614	Open in IMG/M
3300009678\|Ga0105252_10556244	Not Available	529	Open in IMG/M
3300009792\|Ga0126374_10872867	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300009792\|Ga0126374_11090111	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	632	Open in IMG/M
3300009806\|Ga0105081_1065723	Not Available	559	Open in IMG/M
3300009814\|Ga0105082_1052985	Not Available	690	Open in IMG/M
3300009816\|Ga0105076_1088269	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300009821\|Ga0105064_1092742	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300009836\|Ga0105068_1103425	Not Available	557	Open in IMG/M
3300010046\|Ga0126384_10838907	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300010046\|Ga0126384_11725023	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	593	Open in IMG/M
3300010047\|Ga0126382_10723986	Not Available	838	Open in IMG/M
3300010047\|Ga0126382_11474839	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300010048\|Ga0126373_12045423	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300010323\|Ga0134086_10220328	Not Available	714	Open in IMG/M
3300010359\|Ga0126376_12491743	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300010359\|Ga0126376_12813511	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	536	Open in IMG/M
3300010361\|Ga0126378_10422143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1447	Open in IMG/M
3300010361\|Ga0126378_11511355	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300010362\|Ga0126377_10598566	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300010366\|Ga0126379_13669902	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	514	Open in IMG/M
3300010376\|Ga0126381_100006292	All Organisms → cellular organisms → Bacteria	13115	Open in IMG/M
3300010376\|Ga0126381_101831165	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	876	Open in IMG/M
3300010398\|Ga0126383_10819884	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300012189\|Ga0137388_10234414	All Organisms → cellular organisms → Bacteria	1666	Open in IMG/M
3300012198\|Ga0137364_11062514	Not Available	610	Open in IMG/M
3300012199\|Ga0137383_10232121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1352	Open in IMG/M
3300012204\|Ga0137374_11118777	Not Available	559	Open in IMG/M
3300012204\|Ga0137374_11163357	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	543	Open in IMG/M
3300012210\|Ga0137378_11466805	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	594	Open in IMG/M
3300012351\|Ga0137386_11122663	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300012355\|Ga0137369_10740492	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300012358\|Ga0137368_10511651	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300012917\|Ga0137395_10118307	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1781	Open in IMG/M
3300012925\|Ga0137419_10623252	Not Available	868	Open in IMG/M
3300012944\|Ga0137410_10455579	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1039	Open in IMG/M
3300012948\|Ga0126375_10247091	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	1206	Open in IMG/M
3300012971\|Ga0126369_12684724	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300012972\|Ga0134077_10513787	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300012977\|Ga0134087_10674764	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300015054\|Ga0137420_1257658	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300015358\|Ga0134089_10140266	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300015372\|Ga0132256_100770858	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300015374\|Ga0132255_106143814	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300017654\|Ga0134069_1333405	Not Available	543	Open in IMG/M
3300017656\|Ga0134112_10240961	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300018000\|Ga0184604_10144341	All Organisms → cellular organisms → Bacteria → Proteobacteria	780	Open in IMG/M
3300018028\|Ga0184608_10533478	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300018063\|Ga0184637_10672647	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300018074\|Ga0184640_10422632	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300018078\|Ga0184612_10077027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1740	Open in IMG/M
3300018081\|Ga0184625_10360714	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300018089\|Ga0187774_10054546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1789	Open in IMG/M
3300018433\|Ga0066667_11900048	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	543	Open in IMG/M
3300018482\|Ga0066669_11723137	Not Available	576	Open in IMG/M
3300018482\|Ga0066669_12388544	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	506	Open in IMG/M
3300019879\|Ga0193723_1144505	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300020067\|Ga0180109_1313994	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300020579\|Ga0210407_10521312	Not Available	928	Open in IMG/M
3300021178\|Ga0210408_10853152	Not Available	711	Open in IMG/M
3300021560\|Ga0126371_13409169	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300022694\|Ga0222623_10159708	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	877	Open in IMG/M
3300025160\|Ga0209109_10439229	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300025918\|Ga0207662_10066410	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2173	Open in IMG/M
3300025923\|Ga0207681_11271631	All Organisms → cellular organisms → Bacteria	618	Open in IMG/M
3300025930\|Ga0207701_10952230	All Organisms → cellular organisms → Bacteria	717	Open in IMG/M
3300026297\|Ga0209237_1096052	All Organisms → cellular organisms → Bacteria	1314	Open in IMG/M
3300026298\|Ga0209236_1266043	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300026314\|Ga0209268_1131912	Not Available	618	Open in IMG/M
3300026322\|Ga0209687_1242921	Not Available	557	Open in IMG/M
3300026331\|Ga0209267_1069713	All Organisms → cellular organisms → Bacteria	1539	Open in IMG/M
3300026377\|Ga0257171_1087394	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300026530\|Ga0209807_1017519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3509	Open in IMG/M
3300026530\|Ga0209807_1074245	All Organisms → cellular organisms → Bacteria	1518	Open in IMG/M
3300026536\|Ga0209058_1029678	All Organisms → cellular organisms → Bacteria	3396	Open in IMG/M
3300026536\|Ga0209058_1136433	All Organisms → cellular organisms → Bacteria	1184	Open in IMG/M
3300026547\|Ga0209156_10487555	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300027643\|Ga0209076_1065225	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1034	Open in IMG/M
3300027880\|Ga0209481_10576030	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300027909\|Ga0209382_10285865	All Organisms → cellular organisms → Bacteria	1863	Open in IMG/M
3300027910\|Ga0209583_10236601	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	799	Open in IMG/M
3300027957\|Ga0209857_1012517	All Organisms → cellular organisms → Bacteria → Proteobacteria	1705	Open in IMG/M
3300027957\|Ga0209857_1087327	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300028380\|Ga0268265_10325071	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1395	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10052646	All Organisms → cellular organisms → Bacteria	1064	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10134229	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10185115	Not Available	580	Open in IMG/M
3300031226\|Ga0307497_10704660	Not Available	521	Open in IMG/M
(restricted) 3300031237\|Ga0255334_1033845	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	578	Open in IMG/M
3300031474\|Ga0170818_115562428	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300031547\|Ga0310887_10309049	All Organisms → cellular organisms → Bacteria	904	Open in IMG/M
3300031668\|Ga0318542_10074907	All Organisms → cellular organisms → Bacteria	1592	Open in IMG/M
3300031740\|Ga0307468_101307620	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300031779\|Ga0318566_10007621	All Organisms → cellular organisms → Bacteria	4316	Open in IMG/M
3300031781\|Ga0318547_10934894	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300031911\|Ga0307412_12165688	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	517	Open in IMG/M
3300032180\|Ga0307471_101366334	All Organisms → cellular organisms → Bacteria	869	Open in IMG/M
3300032180\|Ga0307471_103133791	Not Available	586	Open in IMG/M
3300032205\|Ga0307472_100624514	All Organisms → cellular organisms → Bacteria	955	Open in IMG/M
3300032205\|Ga0307472_102664469	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300032205\|Ga0307472_102693333	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	508	Open in IMG/M
3300033550\|Ga0247829_10505905	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1001	Open in IMG/M
3300034114\|Ga0364938_099155	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300034659\|Ga0314780_128062	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	89.80%
Host-Associated	Host-Associated	10.20%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.63%
Plants	Host-Associated → Plants	10.20%
Aquatic	Environmental → Aquatic	8.16%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	80.95%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.16%
Sediment	Environmental → Aquatic → Sediment	6.80%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.04%
Freshwater	Environmental → Aquatic → Freshwater	0.68%
Marine	Environmental → Aquatic → Marine	0.68%
Floodplain	Environmental → Terrestrial → Floodplain	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	60.54%
Loam	Environmental → Terrestrial → Soil → Loam	12.24%
Sand	Environmental → Terrestrial → Soil → Sand	7.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.80%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.36%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.36%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.68%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.68%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.65%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	15.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.16%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	7.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.80%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.40%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.04%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.36%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.68%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.68%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.68%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.68%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.68%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	11.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.80%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.12%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	4.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.08%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.08%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.08%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.40%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.40%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	2.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.04%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.36%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.36%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.68%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.68%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.68%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.68%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.68%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.68%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.68%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.68%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.68%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009597	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009806	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60	Environmental	Open in IMG/M
3300009814	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60	Environmental	Open in IMG/M
3300009816	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10	Environmental	Open in IMG/M
3300009821	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30	Environmental	Open in IMG/M
3300009836	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300020067	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026314	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026377	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300027957	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031237 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034114	Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17	Environmental	Open in IMG/M
3300034659	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1014476932	3300000364	Soil	GIVNGVSDMHVERDGKENRFTVRYLAVYAKSGADWRMIAWQSTRQD*
JGI1027J12803_1076887173	3300000955	Soil	IVNGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD*
soilL2_100548513	3300003319	Sugarcane Root And Bulk Soil	MHVENAGKEQRFTIRYLAVYAKSGGRWQMTAWQSTKVSDA*
Ga0055439_102029472	3300004019	Natural And Restored Wetlands	DGVSEMRVERDGKEQRFTVRYLAVYVQAGLRWRMIAWQSTRQPDA*
Ga0066680_106445462	3300005174	Soil	NGVSDMHVENAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA*
Ga0066673_100585431	3300005175	Soil	MHVENAGKEQRFTIRYLAVYAKTGDHWRMIAWQSTRVPEA*
Ga0066679_109463491	3300005176	Soil	MHVENAGKEQRFTIRYLAVYAKTGDHWRMIAWQSTRLDA*
Ga0066678_109365902	3300005181	Soil	VSDMHVENAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA*
Ga0066388_1014809161	3300005332	Tropical Forest Soil	GVSEMHVERDGKAQRFTVRYLAVYAKAGDRWRMLAWQSTRVPDA*
Ga0066388_1019720491	3300005332	Tropical Forest Soil	SEMHVERDGKEQRFNVGYLAVYTQANARWRMIDWQSTRQPDE*
Ga0070689_1013385891	3300005340	Switchgrass Rhizosphere	DMHVERDGKENRFTVRYLAVYAKTGERWRMIAWQSTRQD*
Ga0070692_100476984	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	HGVSDMHVERDGKENRFTVRYLAVYAKAGERWRMIAWQSTRQD*
Ga0068867_1013455781	3300005459	Miscanthus Rhizosphere	MHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD*
Ga0070706_1014176091	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	GVVNGVSEMHVENAGKEQRFTVRYLAIYTKVGEQWRMLAWQSTRLPDA*
Ga0070707_1017782621	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	VSEMHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD*
Ga0070698_1000596977	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	RARVHGGVGVVTGVSEMHVESGGKEQRFTVRYLAVYAKSGEHWRMIAWQSTRQPDT*
Ga0070699_1005390821	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	VNGVSEMHVENAGKEQRFTVRYLAVYAKAGERWRMIAWQSTRQPDA*
Ga0070699_1009412531	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	EMHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD*
Ga0070697_1003371793	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	SDMHVERDGKENRFTVRYLAVYAKAGERWRMIAWQSTRQD*
Ga0070696_1014268231	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	VSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQE*
Ga0070696_1017615131	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	GVSEMHVENAGKEQRFTVRYLAVYTKVGGPWRMLAWQSTRLPDA*
Ga0070704_1000726644	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	LVNGLSEMHVENGGKEQKFTVRYLAVYTKTGNEWRMIAWQSTRVPD*
Ga0066700_101036294	3300005559	Soil	AGKEQRFTVRYLAVYAKIAERWRMIAWQSTRQPDT*
Ga0066694_103449261	3300005574	Soil	ENAGKEQRFTVRYLAVYAKAGERWRMIAWQSTRQPDA*
Ga0066691_107902301	3300005586	Soil	GVSEMHVDNAGKEQRFTVRYLAVYAKIAERWRMIAWQSTRQPDA*
Ga0066905_1000437911	3300005713	Tropical Forest Soil	EMHVERDGKEQRFTVRYLAVYAKAGDRWRLIAWQSTRQPDA*
Ga0066905_1001051841	3300005713	Tropical Forest Soil	SEMHVERDGKEQRFNVGYLAVYTQADARWRMIDWPSTRQPDE*
Ga0066905_1019334512	3300005713	Tropical Forest Soil	VNGVSDMHVERDGKENRFTVRYLAVYAKAGSDWRMIAWQSTRQD*
Ga0066696_104530601	3300006032	Soil	RRARVHGNVGIVNGVSEMHVENAGKEQRFTIRYLAVYAKAGDNWRMIAWQSTRLDA*
Ga0079221_115887171	3300006804	Agricultural Soil	MHVENAGKEQRFTVRYLAVYAKTGGQWRMLAWQSTRQPDA*
Ga0075431_1002873663	3300006847	Populus Rhizosphere	GVSDMHVERDGKENRFTVRYLAVYGKSGADWRMIAWQSTKQE*
Ga0075431_1016443651	3300006847	Populus Rhizosphere	GVSEMHVENAGKEQRFTVRYLAIYAKIGEHWRMLAWQSTRVPDA*
Ga0075434_1013737822	3300006871	Populus Rhizosphere	GVSDMHVERDGKENRFTVRYLAVYAKSGADWRMIAWQSTRQD*
Ga0075429_1001395093	3300006880	Populus Rhizosphere	VENAGKEQRFTVRYVAVYTKAGGQWRMIAWQSTRLPDA*
Ga0075424_1016180691	3300006904	Populus Rhizosphere	ENAGKEQRFTIRYLAVYARGAGGWQMTAWQSTKVPDA*
Ga0075435_1005946813	3300007076	Populus Rhizosphere	GKEQRFTVRYLAVYTKSGEAWRMIAWQSTRVPDA*
Ga0099793_102140471	3300007258	Vadose Zone Soil	GVSEMHVERDGKEQRFTVRYLAVYAKAGGHWRMIAWQSTRQD*
Ga0099828_108622632	3300009089	Vadose Zone Soil	GKEQRFTVRYLAVYAKAGEHWRMIAWQSTRQPEAGE*
Ga0099828_110167092	3300009089	Vadose Zone Soil	ERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRQPEAQG*
Ga0099828_115331021	3300009089	Vadose Zone Soil	VSEMHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTREPEAQG*
Ga0099827_108475802	3300009090	Vadose Zone Soil	MHVERDGTEQRFTVRYLAVHAMAGEHWRLVAWQSTRQPDV*
Ga0111539_115320821	3300009094	Populus Rhizosphere	GVSEMHVENAGKEQRFTVRYLAVYAKTGEAWRMIAWQSTRVPDA*
Ga0099792_111848992	3300009143	Vadose Zone Soil	IVNGVSEMHVENAGKEQRFTIRYLAVYANAGDTWRMIAWQSTRVPDA*
Ga0105259_11272332	3300009597	Soil	SEMHVERDGKEQRFTVRYLAVYAKAGEQWRMIAWQSTRVD*
Ga0105252_105562442	3300009678	Soil	VNGVSEMHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD*
Ga0126374_108728672	3300009792	Tropical Forest Soil	VGVVTGVSEMHVEREGKEQRFTVRYLAVYARTGEHWRMIAWQSTRVPD*
Ga0126374_110901112	3300009792	Tropical Forest Soil	VNGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD*
Ga0105081_10657231	3300009806	Groundwater Sand	VERDGKEQRFTVRYLAVYVKTAAQWRMIAWQSTKVPEA*
Ga0105082_10529852	3300009814	Groundwater Sand	MHVERDGKEQRFTVRYLAVYAKAGEQWRMIAWQSTRQD*
Ga0105076_10882691	3300009816	Groundwater Sand	GKEQRFTVRYLAVYAKAGGEWRMIAWQSTRQPDG*
Ga0105064_10927422	3300009821	Groundwater Sand	RRARVHGTVGVVNGVSDMHVERDGKEQRFTVRYLAVYAKAGDHWRMIAWQSTRQD*
Ga0105068_11034252	3300009836	Groundwater Sand	SKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPDA*
Ga0126384_108389071	3300010046	Tropical Forest Soil	MHVERDGKENRFTVRYLAVYAKTGADWRMIAWQSTRQD*
Ga0126384_117250232	3300010046	Tropical Forest Soil	GGVGIVNGVSDMHVERDGKENRFTVRYLAVYGKTGAEWRMIAWQSTRQD*
Ga0126382_107239862	3300010047	Tropical Forest Soil	NTGKEQRFTVRYLAIYTKIGEQWRMLAWQSTRVPDA*
Ga0126382_114748391	3300010047	Tropical Forest Soil	VGGVGIVNGVSDMHVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTRQD*
Ga0126373_120454231	3300010048	Tropical Forest Soil	MHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD*
Ga0134086_102203281	3300010323	Grasslands Soil	MHVENAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA*
Ga0126376_124917432	3300010359	Tropical Forest Soil	GLVDGVSEMHVERDGKEQRFTVRYLAVYAKATDRWRMIAWQSTRVPDA*
Ga0126376_128135111	3300010359	Tropical Forest Soil	GKEQHFTVRYLAVYAKIADRWQMTAWQSTKVPDA*
Ga0126378_104221431	3300010361	Tropical Forest Soil	GVSDMHVERDGKENRFTVRCLAVYAKAGADWRMIAWQSTRQD*
Ga0126378_115113552	3300010361	Tropical Forest Soil	VSDMHVENAGKEQRFTVRYLAVYAKAGDRWRMIAWQSTRQPDA*
Ga0126377_105985662	3300010362	Tropical Forest Soil	VNGVSDMHVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTRQD*
Ga0126379_136699021	3300010366	Tropical Forest Soil	NGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD*
Ga0126381_1000062921	3300010376	Tropical Forest Soil	YVENAGKEQHFTIRYLAVYAKIADRWQMTAWQSTKVPDA*
Ga0126381_1018311653	3300010376	Tropical Forest Soil	VENAGKEQRFTIRYLAVYAKIAGRWQMTAWQSTKVPDA*
Ga0126383_108198842	3300010398	Tropical Forest Soil	PRDRRVRVVGGVGIVNGVSDMHVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTRQD*
Ga0137388_102344143	3300012189	Vadose Zone Soil	VHGGIGVVNGVSEMHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTREPEAQG*
Ga0137364_110625142	3300012198	Vadose Zone Soil	GKEQRFTIRYLAVYAKAGEQWRMLAWQSTRQPDV*
Ga0137383_102321213	3300012199	Vadose Zone Soil	GKEQRFTIRYLAVYAKAGDNWRMIAWQSTRVPDA*
Ga0137374_111187772	3300012204	Vadose Zone Soil	VNGVSEMHVERDGKEQRFTVRYLAVYAKSGQNWRMIAWQSTRVD*
Ga0137374_111633572	3300012204	Vadose Zone Soil	GGIGVVNGVSEMHVESGGKEQRFTVRYLAVYAKSGEQWRMIAWQSTRQPDA*
Ga0137378_114668052	3300012210	Vadose Zone Soil	RDGKENRFTVRYLAVYAKSGADWRMIAWQSTRQD*
Ga0137386_111226631	3300012351	Vadose Zone Soil	MHVELDGKENRFTVRYLAVYAKAGADWRMVAWQSTKQD*
Ga0137369_107404921	3300012355	Vadose Zone Soil	RRARVHGGVGIVNGVSDMHVERDGKENRFTVRYLAAYAKVGDHWRMIAWQSTRQD*
Ga0137368_105116513	3300012358	Vadose Zone Soil	HVESGGKEQRFTVRYLAVYAKSGEQWRMIAWQSTRQPDA*
Ga0137395_101183073	3300012917	Vadose Zone Soil	GVSDMHVENAGKEQRFTIRYLAVYAKAGENWRMIAWQSTRMPDA*
Ga0137419_106232522	3300012925	Vadose Zone Soil	VHGGVGVVTGVSEMHVESGGKEQRFTVRYLAVYAKTGEHWRMIAWQSTRPPDA*
Ga0137410_104555793	3300012944	Vadose Zone Soil	MHVESGGKEQRFTVRYLAVYAKTGEHWRMIAWQSTRQPDA*
Ga0126375_102470912	3300012948	Tropical Forest Soil	GKEQHFTIRYLAVYAKIADRWQMTAWQSTKVPDA*
Ga0126369_126847242	3300012971	Tropical Forest Soil	DMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQE*
Ga0134077_105137872	3300012972	Grasslands Soil	ERDGKENRFTVRYLAVYAKTGADWRMIAWQSTKLDS*
Ga0134087_106747641	3300012977	Grasslands Soil	GKEQRFTIRYLAVYARGAGGWQMTAWQSTKVPDA*
Ga0137420_12576581	3300015054	Vadose Zone Soil	VHGGIGIVNGVSEMHVENAGKEQRFTIRYLAVYAKAGDTWRMIAWQSTRVPDV*
Ga0134089_101402662	3300015358	Grasslands Soil	VSDMHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRVPDA*
Ga0132256_1007708582	3300015372	Arabidopsis Rhizosphere	NVGIVNGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD*
Ga0132255_1061438141	3300015374	Arabidopsis Rhizosphere	DMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQD*
Ga0134069_13334052	3300017654	Grasslands Soil	GAVGIVDGISEMHVENAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA
Ga0134112_102409612	3300017656	Grasslands Soil	ARVHGNVGVVNGVSDMHVERDGKEQRFTVRYLAVYAKAGGHWRMIAWQSTRQD
Ga0184604_101443411	3300018000	Groundwater Sediment	NAGKEQRFTVRYLAVYAKSGNAWRMIAWQSTRVPDA
Ga0184608_105334782	3300018028	Groundwater Sediment	RGIAPRERRARVHDGVGLVHGVSDMHVERDGEENRFTVRYLAVYAKAGEHWRMITWQSTRQD
Ga0184637_106726471	3300018063	Groundwater Sediment	NGVSEMHVERDGKEQRFTVRYLAVYAKAGEHWRMFAWQSTRQPD
Ga0184640_104226321	3300018074	Groundwater Sediment	AGKEQRFTVRYLAVYAKAGAAWRMIAWQSTRVPDA
Ga0184612_100770273	3300018078	Groundwater Sediment	SDMHVERDGKENRFTVRYLAVYAKAGDHWRMIAWQSTRQD
Ga0184625_103607142	3300018081	Groundwater Sediment	VSDMHVERDGKEQRFTVRYLAVCAKAGDHWRMIAWQSTRQD
Ga0187774_100545461	3300018089	Tropical Peatland	MHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQE
Ga0066667_119000482	3300018433	Grasslands Soil	DMHVENAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA
Ga0066669_117231372	3300018482	Grasslands Soil	ERDGKEQRFTVRYLAVYAKAGGLWRMTAWQSTRVPDA
Ga0066669_123885442	3300018482	Grasslands Soil	ENAGKEQRFTIRYLAVYARIADRWQMTAWQSTKVPDAA
Ga0193723_11445052	3300019879	Soil	GVGLVHGVSDMHVERDGKENRFTVRYLAVYAKAGEHWRMIAWQSTRQD
Ga0180109_13139941	3300020067	Groundwater Sediment	HVESGGKEQRFTVRYLAVYAKTGEQWRMIAWQSTRLE
Ga0210407_105213122	3300020579	Soil	VSEMHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA
Ga0210408_108531521	3300021178	Soil	RGIAPRERRARVHGAVGIVNGVSEMHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA
Ga0126371_134091692	3300021560	Tropical Forest Soil	VNGVSEMHIERDGKEQRFTVRYLAVYALAGERWRMIAWQSTRVPDA
Ga0222623_101597082	3300022694	Groundwater Sediment	NRVSEMHVENAGKEQRFTVRYLAVYARAGQAWRMIAWQSTRVPDA
Ga0209109_104392292	3300025160	Soil	MNEKDVLHGISEMHVESAGKEQRFTVRYLAVYAKAGENWRMIAWQSTRVPDA
Ga0207662_100664104	3300025918	Switchgrass Rhizosphere	GGKEQRFTIRYLAVYTKIANRWQMTAWQSTKVPDA
Ga0207681_112716311	3300025923	Switchgrass Rhizosphere	RVHDGVGLVHGVSDMHVERDGKENRFTVRYLAVYAKAGERWRMIAWQSTRQD
Ga0207701_109522302	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	NGVSEMHVENAGKEQHFTVRFLAVYVKSGEQWRMLAWQSTRQPDA
Ga0209237_10960522	3300026297	Grasslands Soil	MHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRVPDA
Ga0209236_12660432	3300026298	Grasslands Soil	MHVERDGKENRFTVRYLAVYAKAGADWRMVAWQSTKQD
Ga0209268_11319122	3300026314	Soil	NAGKEQRFTVRYLAVYTRTGEQWRMLAWQSTRQPDA
Ga0209687_12429211	3300026322	Soil	VRVHGDVGIVDGISEMHVDNAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA
Ga0209267_10697131	3300026331	Soil	VNGVSEMHVDNAGKEQRFTVRYLAVYAKIAERWRMIAWQSTRQPDA
Ga0257171_10873941	3300026377	Soil	RVHGNVGVVNGVSDMHVERDGKENRFTVRYLAVYAKAGDHWRMIAWQSTRQD
Ga0209807_10175194	3300026530	Soil	DNAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA
Ga0209807_10742453	3300026530	Soil	VDNAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA
Ga0209058_10296784	3300026536	Soil	RAGKENRFTVRYLAVYAKTGADWRMIAWQSTKLDS
Ga0209058_11364331	3300026536	Soil	VHGDVGIVNGVSEMHVERDGKEQRFTVRYLAVYAKAGGHWRMIAWQSTRQD
Ga0209156_104875551	3300026547	Soil	NAGKEQRFTIRYLAVYAKAGDTWRMIAWQSTRLDA
Ga0209076_10652253	3300027643	Vadose Zone Soil	VNGVSEMHVENAGKEQRFTVRYLAVYAKVGERWRMIAWQSTRQPDA
Ga0209481_105760302	3300027880	Populus Rhizosphere	EMQVERDGKAQRFTVRYLAVYARAAGRWRMIAWQSTRVPDA
Ga0209382_102858652	3300027909	Populus Rhizosphere	MHVERDGKENRFTVRYLAVYAKAGANWRMIAWQSTKQE
Ga0209583_102366012	3300027910	Watersheds	MHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA
Ga0209857_10125173	3300027957	Groundwater Sand	RGSKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPDA
Ga0209857_10873272	3300027957	Groundwater Sand	RVHGTVGVVNGVSDMHVERDGKEQRFTVRYLAVYAKAGDHWRMIAWQSTRQD
Ga0268265_103250713	3300028380	Switchgrass Rhizosphere	HVERDGKENRFTVRYLAVYAKSGADWRMVAWQSTKQD
(restricted) Ga0255310_100526461	3300031197	Sandy Soil	SEMHVENAGREQRFTVRYLAVYGKKPEGWRMIAWQSTRVPD
(restricted) Ga0255310_101342291	3300031197	Sandy Soil	GIVNGVSDMHVERDGKENRFTVRYLAVYTKAGADWRMIAWQSTRQD
(restricted) Ga0255310_101851151	3300031197	Sandy Soil	VGVVNGVSEMHVENAGKEQRFAVRYLAVYAKAGEHWRMIAWQSTRQPDT
Ga0307497_107046602	3300031226	Soil	MSYVPGKEQHFMYLAVYAKIADRWRMTAWQSTKVADA
(restricted) Ga0255334_10338452	3300031237	Sandy Soil	VNGVSEMHVENAGKEQRFTVRYLAVYAKAGERWRMIAWQSTRQPDA
Ga0170818_1155624281	3300031474	Forest Soil	VSEMHVENAGKEQHFTVRYLAVYAKSGEQWRMIAWQSTRQPDA
Ga0310887_103090491	3300031547	Soil	MHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQD
Ga0318542_100749074	3300031668	Soil	VERDGRENRFTVRYLAVYAKAGADWRMIAWQSTKLE
Ga0307468_1013076201	3300031740	Hardwood Forest Soil	VSDMHVERDGKENRFTVRYLAVYAKSGADWRMVAWQSTKQD
Ga0318566_100076211	3300031779	Soil	VENAGKDQHFTIRYLAVYAKIADRWQMTAWQSTKVPDA
Ga0318547_109348942	3300031781	Soil	HVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTKQE
Ga0307412_121656881	3300031911	Rhizosphere	ENAGKEQKFTIRYLAIYAKSGGQWRMTAWQSTKVPE
Ga0307471_1013663341	3300032180	Hardwood Forest Soil	VNGVSEMHVENAGKEQRFTIRYLAVYAKAGDNWRMIAWQSTRVPEA
Ga0307471_1031337911	3300032180	Hardwood Forest Soil	VGIVNGVSEMHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA
Ga0307472_1006245142	3300032205	Hardwood Forest Soil	RARVHGGIGVVNGVSEMHVENAGKEQYFTVRYLAVYVKSGEQWRMLAWQSTRQPDA
Ga0307472_1026644691	3300032205	Hardwood Forest Soil	DGKEQHFTVRYLAVYAKAGEHWRLIAWQSTRQPDA
Ga0307472_1026933331	3300032205	Hardwood Forest Soil	VENAGKEQRFTVRYLAVYAKAGATWRMTAWQSTKVPDA
Ga0247829_105059053	3300033550	Soil	HVENAGKEQRFTVRYLAVYAKTGEAWRMIAWQSTRVPDA
Ga0364938_099155_446_562	3300034114	Sediment	MHVERDGKEQRFTVRYLAVYAKAGEQWRMIAWQSTRQE
Ga0314780_128062_2_115	3300034659	Soil	HVERDGKENRFTVRYLAVYGKSGADWRMIAWQSTKQE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters