NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F048817

Metagenome Family F048817

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048817
Family Type Metagenome
Number of Sequences 147
Average Sequence Length 41 residues
Representative Sequence RRHPARGEPGIPPLLTNPRAFAQATWRHALFGYVLGRLA
Number of Associated Samples 132
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.32 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.796 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.129 % of family members)
Environment Ontology (ENVO) Unclassified
(27.891 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.980 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.82%    β-sheet: 0.00%    Coil/Unstructured: 64.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF03060NMO 10.20
PF12681Glyoxalase_2 4.08
PF13539Peptidase_M15_4 3.40
PF01636APH 2.72
PF00296Bac_luciferase 2.72
PF08241Methyltransf_11 2.72
PF01243Putative_PNPOx 2.04
PF07883Cupin_2 2.04
PF08494DEAD_assoc 1.36
PF13328HD_4 1.36
PF12697Abhydrolase_6 1.36
PF09362DUF1996 1.36
PF00196GerE 1.36
PF08338DUF1731 0.68
PF00561Abhydrolase_1 0.68
PF04828GFA 0.68
PF00999Na_H_Exchanger 0.68
PF02230Abhydrolase_2 0.68
PF01510Amidase_2 0.68
PF00590TP_methylase 0.68
PF07690MFS_1 0.68
PF13442Cytochrome_CBB3 0.68
PF03851UvdE 0.68
PF10502Peptidase_S26 0.68
PF01391Collagen 0.68
PF13378MR_MLE_C 0.68
PF00326Peptidase_S9 0.68
PF07366SnoaL 0.68
PF13365Trypsin_2 0.68
PF00211Guanylate_cyc 0.68
PF02627CMD 0.68
PF08281Sigma70_r4_2 0.68
PF00903Glyoxalase 0.68
PF12705PDDEXK_1 0.68
PF13624SurA_N_3 0.68
PF13354Beta-lactamase2 0.68
PF028262-Hacid_dh_C 0.68
PF01717Meth_synt_2 0.68
PF03631Virul_fac_BrkB 0.68
PF01595CNNM 0.68
PF12706Lactamase_B_2 0.68
PF05974DUF892 0.68
PF13398Peptidase_M50B 0.68
PF07332Phage_holin_3_6 0.68
PF06897DUF1269 0.68
PF01894UPF0047 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 10.20
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 10.20
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.72
COG1201Lhr-like helicaseReplication, recombination and repair [L] 1.36
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.68
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.68
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.68
COG4294UV DNA damage repair endonucleaseReplication, recombination and repair [L] 0.68
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.68
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.68
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.68
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.68
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.68
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.68
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.68
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.68
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.68
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.68
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.68
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.80 %
UnclassifiedrootN/A10.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002407|C687J29651_10111655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium908Open in IMG/M
3300003911|JGI25405J52794_10148115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300003996|Ga0055467_10088033All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300004463|Ga0063356_104118121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300004463|Ga0063356_105255485Not Available556Open in IMG/M
3300004479|Ga0062595_101537874All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005186|Ga0066676_10613535All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005330|Ga0070690_101523249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300005343|Ga0070687_101197071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300005356|Ga0070674_100697174All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005445|Ga0070708_101066305All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300005455|Ga0070663_101770321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300005518|Ga0070699_101558985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300005526|Ga0073909_10503638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales586Open in IMG/M
3300005530|Ga0070679_100942514All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300005535|Ga0070684_101109037All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300005548|Ga0070665_100636991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1079Open in IMG/M
3300005558|Ga0066698_10975566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300005563|Ga0068855_101900224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium603Open in IMG/M
3300005578|Ga0068854_100933146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300005578|Ga0068854_102078330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300005614|Ga0068856_100891191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300005840|Ga0068870_10833304Not Available647Open in IMG/M
3300005937|Ga0081455_10272007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1228Open in IMG/M
3300005937|Ga0081455_10408667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300006032|Ga0066696_11121037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300006059|Ga0075017_100355814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1091Open in IMG/M
3300006845|Ga0075421_102190528All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006876|Ga0079217_11404373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300006881|Ga0068865_101515166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300007004|Ga0079218_10374224All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300007004|Ga0079218_12700490Not Available592Open in IMG/M
3300009081|Ga0105098_10669726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300009089|Ga0099828_10766236All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300009089|Ga0099828_11550055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300009137|Ga0066709_103688443All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009137|Ga0066709_104077747All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300009148|Ga0105243_10120612All Organisms → cellular organisms → Bacteria2210Open in IMG/M
3300009156|Ga0111538_10318926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1967Open in IMG/M
3300009162|Ga0075423_11626613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300009162|Ga0075423_12737782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300009789|Ga0126307_10821173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300009987|Ga0105030_129223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300010037|Ga0126304_10603091All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300010043|Ga0126380_11693192All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010329|Ga0134111_10354511All Organisms → cellular organisms → Bacteria → Terrabacteria group621Open in IMG/M
3300010337|Ga0134062_10626881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300010362|Ga0126377_12439821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300010373|Ga0134128_11106935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300010376|Ga0126381_102908274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300010400|Ga0134122_11295901All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300010401|Ga0134121_10825946All Organisms → cellular organisms → Bacteria → Terrabacteria group893Open in IMG/M
3300011270|Ga0137391_10908241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300011400|Ga0137312_1042815All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300011991|Ga0120153_1023714All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300011991|Ga0120153_1036303Not Available977Open in IMG/M
3300012014|Ga0120159_1025200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2124Open in IMG/M
3300012043|Ga0136631_10323963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082616Open in IMG/M
3300012043|Ga0136631_10431823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300012093|Ga0136632_10086933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1446Open in IMG/M
3300012186|Ga0136620_10064096All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300012186|Ga0136620_10480805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300012201|Ga0137365_11020906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300012353|Ga0137367_10405551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300012356|Ga0137371_10511977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300012358|Ga0137368_10031174All Organisms → cellular organisms → Bacteria4823Open in IMG/M
3300012530|Ga0136635_10005193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4083Open in IMG/M
3300012680|Ga0136612_10003804All Organisms → cellular organisms → Bacteria7092Open in IMG/M
3300012897|Ga0157285_10294622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300012908|Ga0157286_10386235Not Available539Open in IMG/M
3300012955|Ga0164298_10811839All Organisms → cellular organisms → Bacteria → Terrabacteria group670Open in IMG/M
3300012957|Ga0164303_10891259All Organisms → cellular organisms → Bacteria → Terrabacteria group622Open in IMG/M
3300012984|Ga0164309_10384058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1042Open in IMG/M
3300012985|Ga0164308_11787638Not Available572Open in IMG/M
3300012987|Ga0164307_10716019Not Available786Open in IMG/M
3300012987|Ga0164307_11584284Not Available554Open in IMG/M
3300012989|Ga0164305_10705093All Organisms → cellular organisms → Bacteria → Terrabacteria group825Open in IMG/M
3300013102|Ga0157371_11588761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium512Open in IMG/M
3300013308|Ga0157375_12118775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium669Open in IMG/M
3300013308|Ga0157375_13718992All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300013772|Ga0120158_10305582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300014031|Ga0120173_1004736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1939Open in IMG/M
3300014166|Ga0134079_10067868All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300014965|Ga0120193_10054707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300015358|Ga0134089_10409870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300015371|Ga0132258_13766865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1033Open in IMG/M
3300015372|Ga0132256_101901988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300016357|Ga0182032_11180109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300018051|Ga0184620_10108867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300018056|Ga0184623_10015024Not Available3385Open in IMG/M
3300018061|Ga0184619_10051981Not Available1784Open in IMG/M
3300018422|Ga0190265_12804103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300018481|Ga0190271_12483457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300019362|Ga0173479_10005503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3044Open in IMG/M
3300019767|Ga0190267_10122837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1081Open in IMG/M
3300019878|Ga0193715_1074989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300021057|Ga0196981_1066260Not Available552Open in IMG/M
3300021078|Ga0210381_10227030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha cephalotaxi658Open in IMG/M
3300021362|Ga0213882_10404534All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300021445|Ga0182009_10425026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300021560|Ga0126371_11509234All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300022756|Ga0222622_10159376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1463Open in IMG/M
3300024290|Ga0247667_1071470All Organisms → cellular organisms → Bacteria → Terrabacteria group639Open in IMG/M
3300025908|Ga0207643_10118463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1566Open in IMG/M
3300025911|Ga0207654_10356274All Organisms → cellular organisms → Bacteria → Terrabacteria group1008Open in IMG/M
3300025919|Ga0207657_10343178All Organisms → cellular organisms → Bacteria → Terrabacteria group1178Open in IMG/M
3300025921|Ga0207652_10978657All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300025929|Ga0207664_11281863All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300025932|Ga0207690_11202690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium633Open in IMG/M
3300025933|Ga0207706_10938625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059729Open in IMG/M
3300025935|Ga0207709_10972862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales693Open in IMG/M
3300025944|Ga0207661_10754130All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300025949|Ga0207667_11610019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium618Open in IMG/M
3300026088|Ga0207641_12032207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300026089|Ga0207648_10962230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300027561|Ga0209887_1122130All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300027638|Ga0208612_1111387Not Available700Open in IMG/M
3300027821|Ga0209811_10261031All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028589|Ga0247818_11174858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300028590|Ga0247823_11415993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium521Open in IMG/M
3300028710|Ga0307322_10093632All Organisms → cellular organisms → Bacteria → Terrabacteria group767Open in IMG/M
3300028715|Ga0307313_10076372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1004Open in IMG/M
3300028717|Ga0307298_10042191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1237Open in IMG/M
3300028719|Ga0307301_10070393All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300028771|Ga0307320_10183100All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300028778|Ga0307288_10298273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300028791|Ga0307290_10367844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300028793|Ga0307299_10125862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300028793|Ga0307299_10200553All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300028807|Ga0307305_10418903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300028811|Ga0307292_10194336All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300028811|Ga0307292_10203407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium814Open in IMG/M
3300028814|Ga0307302_10139278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1172Open in IMG/M
3300028819|Ga0307296_10389212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300028828|Ga0307312_10980637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300028880|Ga0307300_10194510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300028884|Ga0307308_10184713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Limosilactobacillus999Open in IMG/M
3300028884|Ga0307308_10323235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300028885|Ga0307304_10195390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia863Open in IMG/M
3300031366|Ga0307506_10487243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300031450|Ga0272433_10490095Not Available507Open in IMG/M
3300031901|Ga0307406_11999327All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031939|Ga0308174_11701461Not Available542Open in IMG/M
3300031943|Ga0310885_10148715All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300031996|Ga0308176_11480594All Organisms → cellular organisms → Bacteria → Terrabacteria group723Open in IMG/M
3300032205|Ga0307472_101209076Not Available722Open in IMG/M
3300034125|Ga0370484_0107402All Organisms → cellular organisms → Bacteria731Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.13%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand4.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.76%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.04%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.04%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.04%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.04%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.36%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.36%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.68%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.68%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert0.68%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.68%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.68%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.68%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.68%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.68%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009987Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014031Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300021057Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13CEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027638Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C687J29651_1011165513300002407SoilYLIDRYHPARGEPGVPPLLTNPRAFAQATWRHALFGTMRGRLA*
JGI25405J52794_1014811523300003911Tabebuia Heterophylla RhizosphereDRHHPARGEPGVASLFHPRAFGQATVRHAVFGLVLGRIGK*
Ga0055467_1008803333300003996Natural And Restored WetlandsPARGTRGVPPLLTNPRAFAQATWRHALFGALLGRLARSPGDRDG*
Ga0063356_10411812123300004463Arabidopsis Thaliana RhizospherePARGEEGIPPLLGNRRAFAQATWRHALFALLLGRLLSGATDTSRR*
Ga0063356_10525548523300004463Arabidopsis Thaliana RhizospherePASGEAGVPANLLSNERAFAQAAVRHALFGVVLGRLAAGR*
Ga0062595_10153787413300004479SoilDRRHPARGEAGVAPMLSVRGFAQETVRHALFGVVLGRLAR*
Ga0066676_1061353523300005186SoilDRHHPARGEPGIPPLFTNPRAFAQATWRHAVFGFVLARMA*
Ga0070690_10152324923300005330Switchgrass RhizosphereCFFIDRFHPARGQEGVPPLLTNPRAFGQATWRHAIFGVILGRLA*
Ga0070687_10119707123300005343Switchgrass RhizosphereIDRYHPARGEPGIPPLLTNPRAFVQATWRHALFGAVLGRLAA*
Ga0070674_10069717423300005356Miscanthus RhizosphereDRYHPARGEPGVQHVFSLRAFGQATLRHALFGLVLGRLAE*
Ga0070708_10106630513300005445Corn, Switchgrass And Miscanthus RhizosphereVDRFHPRRGEPGVPPLLGNPRAFGQATARHALFGWLLGRLAA*
Ga0070663_10177032113300005455Corn RhizosphereLCFFIDRFHPARGQEGVPPLLTNTRAFGQATWRHAIFGVILGRLA*
Ga0070699_10155898513300005518Corn, Switchgrass And Miscanthus RhizosphereFADRYHPARGEPGVARMFSIPAFGQATVRHALFGKVLGALAN*
Ga0073909_1050363823300005526Surface SoilVDRYHPARGEPGIPHLLTNPRAFAQATWRHALFGAVFGQLA*
Ga0070679_10094251413300005530Corn RhizosphereLAPLVDRYHPARGERGVAAMWSKRAFAQETLRHVVFGAVLGRLTA*
Ga0070684_10110903723300005535Corn RhizosphereLCYFVDRFHPQRGSTGVPALLENRKAFVQATWRHAVFGLVLGRLA*
Ga0070665_10063699113300005548Switchgrass RhizosphereRGEPGIPPLLTNPRAFVQATWRHALFGAVLGRLAA*
Ga0066698_1097556623300005558SoilSTGSLVDRYHPARGEPGVEQLFSFRAFGQATLRHVVFGKVLGTLAR*
Ga0068855_10190022423300005563Corn RhizosphereLLDRTHPARGEPGVAQLFNRRGFAQATARHALFGMVLGRLASARD*
Ga0068854_10093314613300005578Corn RhizosphereEPGIPPLLTNPRAFAQATWRHLLFGTVLGRLASGR*
Ga0068854_10207833023300005578Corn RhizosphereDRRHPARGEAGVERVFGARAFAQATWRHLLFGAVLGRLARE*
Ga0068856_10089119113300005614Corn RhizosphereARGQAGVRNVFGARAFAQATWRHFLFGSVLGRLAGE*
Ga0068870_1083330413300005840Miscanthus RhizosphereSALVDRRHPARGSAGIPKLLTPRAFAQATVRHAVFGAVLGRLA*
Ga0081455_1027200743300005937Tabebuia Heterophylla RhizosphereVDRYHPARGKKGVPPLLTNARAFGQATVRHAVFGLLLGRLARP*
Ga0081455_1040866733300005937Tabebuia Heterophylla RhizosphereGSEGVPALLRNPRAFAQATWRHALFGAVLGGLAGPSEY*
Ga0066696_1112103723300006032SoilVDRYHPARGEPGVVRLFSQRAFVLATWRHTLFGWVLGRLA*
Ga0075017_10035581413300006059WatershedsARGEPGLEKLMSGRAFAQATWRHALFGWTLGRLA*
Ga0075421_10219052813300006845Populus RhizosphereYFVDRFHPQRGSTGVPALLENRKAFVQATWRHAVFGLVLGRLA*
Ga0079217_1140437323300006876Agricultural SoilSLYPLSYFVDRYHPARGEDGIPPLLTNPRAFAQATLRHAVFGALLGRLAR*
Ga0068865_10151516623300006881Miscanthus RhizosphereLYPLCYFIDRRHPARGEQGIPPLLKNPRAYAQATWRHALFGFALGRLA*
Ga0079218_1037422443300007004Agricultural SoilLSALVDRRHPARGTEGIPKLLTARAFGQATVRHAVFGAVLGRLA*
Ga0079218_1270049013300007004Agricultural SoilLSALVDRRHPARGTEGIPKLLTARAFGQATVRHAVFGAVLDRLA*
Ga0105098_1066972613300009081Freshwater SedimentPARGEEGVPPLLTNPRAFLQATWRHALFGVVLGRLAGRV*
Ga0099828_1076623623300009089Vadose Zone SoilYHPARGEPGIPPLLTNPRAFAQATWRHALFGAVLGWLA*
Ga0099828_1155005523300009089Vadose Zone SoilLCYFVDHYHRARGEPGVPPLLTNPRAFAQATWRHTLFAVVLDRLSRHQH*
Ga0066709_10368844323300009137Grasslands SoilFVDRYHPARGQPGIPRLLTNPRAFAQATWRHALFGAVLGHLA*
Ga0066709_10407774723300009137Grasslands SoilVDRCHPARGETGVPPLLRNPRAFAQGAARHALFGVVLGRLG*
Ga0105243_1012061213300009148Miscanthus RhizosphereRYHPARGEPGIPRLLTNPRAFAQATWRHTLFGAVLGQLA*
Ga0111538_1031892643300009156Populus RhizosphereARGEEGVPPLLTNPRAFAQATWRHAVFGAVLGRLA*
Ga0075423_1162661323300009162Populus RhizosphereYHPARGEPGVPPLLRSPRAFVQATWRHAVFGTILGRLAR*
Ga0075423_1273778223300009162Populus RhizosphereDRYHPARGEPGVPPLLASLRAFVQATWRHAVFGAVLGRLA*
Ga0126307_1082117313300009789Serpentine SoilGTDGVPRLVHPRAFAQATVRHALFGVLLGRLAKR*
Ga0105030_12922323300009987Switchgrass RhizosphereYHPARGEPGLPPLLKSPRAFSQATWRHALFGVLLGRLA*
Ga0126304_1060309113300010037Serpentine SoilDRRHPARGSAGIPKLLTPRVFAQATVRHAVFGAALGRLA*
Ga0126380_1169319223300010043Tropical Forest SoilMIGVTRERGESGVVDVFSKRAFAQATARHALFGYVLGRLA*
Ga0134111_1035451113300010329Grasslands SoilFVDRHHPARGESGVPPLLTNPRAFAQATWRHALFGGALGCLA*
Ga0134062_1062688113300010337Grasslands SoilVDRHHPARGEPGIPPLFTNPRAFAQATWRHAVFGFVLARMA*
Ga0126377_1243982113300010362Tropical Forest SoilDRYHPARGEPGLPPLARNGRAFAQATWRHALFGWLVGRLG*
Ga0134128_1110693513300010373Terrestrial SoilPARGEPGIPQLLTNPRAFAQATWRHALFGAVLGQLA*
Ga0126381_10290827413300010376Tropical Forest SoilDRRHPARGEPGVPRLAGNARAFALATWRPGLFGAVLARLA*
Ga0134122_1129590113300010400Terrestrial SoilALVDRFHPARGEPNLASLFSLPAFGQATFRHALFGKVLGRLSD*
Ga0134121_1082594623300010401Terrestrial SoilLWPFCALVDRYHPARGEPGVPPLLTNPRAFVQATARHALFGVALGVLAR*
Ga0137391_1090824113300011270Vadose Zone SoilLFPLCYFVDRYHPARGEPGIPPLLTNPRAFAQATWRHALFGAALAWLA*
Ga0137312_104281523300011400SoilARGEPGVPPLLTSPRAFAQATARHALFGLLLGRLAR*
Ga0120153_102371433300011991PermafrostFVDRYHPARGEPGVPPLLRSPRAFAQAGARHALFGYLLGRWA*
Ga0120153_103630313300011991PermafrostYHPARGEPGVPPLATSGRAFAQATARHVLFGVLLGRLA*
Ga0120159_102520033300012014PermafrostYPLAYFVDRYHPARGEPGVPPLLRSPRAFAQAGARHALFGYLLGRWA*
Ga0136631_1032396313300012043Polar Desert SandRYHPARGAPGIPPLLTNGRAFAQATWRHLVFGILLGRLATPR*
Ga0136631_1043182313300012043Polar Desert SandPYFVDRYHPARGELGFPPLLRSSPDFGQAAVRHAVFGVLLARWS*
Ga0136632_1008693323300012093Polar Desert SandYHPARGEPGVPSLLRSPRAFAQASWRHAVFGVVLGRLA*
Ga0136620_1006409643300012186Polar Desert SandRGEPGVPPLLTNSRAFAQATWRHALFGVVLGRLVAR*
Ga0136620_1048080513300012186Polar Desert SandARGTRGIPPLLTNPRAFAQATWRHALFGVVLGALASPRR*
Ga0137365_1102090613300012201Vadose Zone SoilDRHHRARGEPGIPPLLTNPRAYLQATWRHALFGVLLGRFA*
Ga0137367_1040555113300012353Vadose Zone SoilPARGEPGIPPLLTNPRAYLQATWRHALFGIVLGRLA*
Ga0137371_1051197713300012356Vadose Zone SoilRHHPARGEPGIPPLFTNPRAFAQATWRHALFGWTLGRLT*
Ga0137368_1003117413300012358Vadose Zone SoilYFVDRYHPARGKPGVPRLLDNPRAFGQATARHALFGLILGRLG*
Ga0136635_1000519333300012530Polar Desert SandSTGRFVDRYHPARGEPGIPPLLSPRVFGQATVRHTVFGLVLGRLAR*
Ga0136612_1000380463300012680Polar Desert SandARGTKGIPPLLTNPRAFTQAAWRHAVFGVVLGRLA*
Ga0157285_1029462223300012897SoilAHGEPGVARMFSVPAFGQATIRHALFGKVLGALAN*
Ga0157286_1038623513300012908SoilARGSAGIPKLLTPRAFAQATVRHALFGAVLGRLA*
Ga0164298_1081183923300012955SoilPARGRAGVRSVFGARAFVQATWRHFLFGSVLGRLADE*
Ga0164303_1089125913300012957SoilLVDRTHPARGEPGVGQLFNRRGFAQATARHALFGTVLGRIAAARG*
Ga0164309_1038405813300012984SoilPGIPPLLTNPRAFAQATWRHLLFGTVLGRLASGR*
Ga0164308_1178763813300012985SoilHPARGEPGVPPIFTKRAFAQATWRHALFGWLLGRLA*
Ga0164307_1071601923300012987SoilHPARGEPGLAPLLTVRGFVQSTARHALFGVVLGRLAR*
Ga0164307_1158428413300012987SoilNAVVDRHHPASGEPGIPRNMLSSPRAFALATWRHAVFGVLLGRLAGD*
Ga0164305_1070509323300012989SoilLVDRHHPARGEPGVPPIFMKRAFAQATWRHALFGWLLGRLA*
Ga0157371_1158876123300013102Corn RhizosphereALYPLCYLVDRFHPRRGAPGVPPLLRNRKAFVQATWRHAVFGVVLGRLA*
Ga0157375_1211877513300013308Miscanthus RhizosphereHPRRGAPGVPPLLRNRKAFVQATWRHAVFGVVLGRLA*
Ga0157375_1371899213300013308Miscanthus RhizosphereALVDRYHPARGEAGLASLFSLRAFGQATARHALFGKVLGRLGT*
Ga0120158_1030558233300013772PermafrostDTHHPARGEPGVARLFSLRAFGQATVRHALFGVVLGRAYSPPT*
Ga0120173_100473633300014031PermafrostVARSPPARGEGGTPPLLTNGRAFAQATVRHACFGALVGRLADQPIP*
Ga0134079_1006786813300014166Grasslands SoilDRYHPARGEKGLPPLLTNPRAFAQATARHLVFGIALGRLAG*
Ga0120193_1005470743300014965TerrestrialLFPLGVLVDRYHPARGTPGVPCLVHPKAFGQATVRHALFGAVLGRLAR*
Ga0134089_1040987023300015358Grasslands SoilGKLVDRYHPARGEPGVEQLFSLRAFAQATLRHALFGKVLGTLAR*
Ga0132258_1376686523300015371Arabidopsis RhizosphereHHPARGEPGVPPLLTSGRAFAQATLRHAVFGVVLGRLA*
Ga0132256_10190198833300015372Arabidopsis RhizosphereSILSDRYHPAMGQPGVVPIARDPRAFAQETWRHLLFGWALARLLPREVSRA*
Ga0182032_1118010913300016357SoilLGAVVDRYHPARGEPGLPPIFTKRAFAQATWRHAVFGWTLGKLA
Ga0184620_1010886723300018051Groundwater SedimentCYFIDRYHPARGEPGIPPLLSNPRAFLQATWRHALFGAVLGRLA
Ga0184623_1001502423300018056Groundwater SedimentALFPTGHFVDRYHPAHGEPGVPRLVSARAFGQATVRHTVFGFVLGRLA
Ga0184619_1005198113300018061Groundwater SedimentRYHPARGEPGIPRLLTNPRAFAQATWRHALFGAVLGQLA
Ga0190265_1280410323300018422SoilRYHPARGEEGIPPLLTNPRAFVQATWRHAVFGVVLGRLAPR
Ga0190271_1248345713300018481SoilTSFVDRPARGESGVPPLLTNPRAFGQATWRHAFFGAVLGRLA
Ga0173479_1000550313300019362SoilSYFVDRFHPRRGTRGIPPLLENPRAFAQATWRHTIFGLVLGRLA
Ga0190267_1012283723300019767SoilYHPARGERGIPRLAGNRRAFAQATFRHALFGLVLARLTRAGGGSTRA
Ga0193715_107498913300019878SoilLALYPLCYFIDRHHPAHGEPGVPPLFANRRAFAQATWRHAVFGLILGRLAAGRS
Ga0196981_106626033300021057SoilYHPARGTRDVPRIFTWRAFGQATLRHLLFGWLLGRLARERPR
Ga0210381_1022703023300021078Groundwater SedimentYHPARGEEGVPPLLTNRRAFAQATVRHVVFGFALGLLAG
Ga0213882_1040453423300021362Exposed RockHPARGEAGLAPLFSARGFVQATARHAVFGAVLGALAGEELE
Ga0182009_1042502633300021445SoilALYPLSFFVDRFHPARREQGVPPLLTNGRAFGQATMRHLVFGLILGRLA
Ga0126371_1150923423300021560Tropical Forest SoilVDRHHPARGESGVPRLAGNPRAFALATWRHALFGAVLGRLA
Ga0222622_1015937633300022756Groundwater SedimentDRYHPARGEPGVPPLLTSRRAFAQATLRHALFGVVLGSLA
Ga0247667_107147013300024290SoilRRHPARGEAGVERVFGARAFVQATWRHALFGAVLGRLAGE
Ga0207643_1011846343300025908Miscanthus RhizosphereLYPLCYFVDRFHPQRGATGVPPLLKNHKAFMQATWRHALFGLVLARLA
Ga0207654_1035627423300025911Corn RhizosphereHPARGQPGLRRVFGARAFAQATWRHFLFGAVLGRLADE
Ga0207657_1034317833300025919Corn RhizosphereGALVDRRHPARGQPGVRRVFGARAFAQATWRHLLFGAVLGRLAGE
Ga0207652_1097865723300025921Corn RhizosphereLAPLVDRYHPARGERGVAAMWSKRAFAQETLRHVVFGAVLGRLTA
Ga0207664_1128186313300025929Agricultural SoilALWPFCALVDRYHPARGEPGVPPLLTNPRAFVQATVRHALFGVALGVLAAA
Ga0207690_1120269013300025932Corn RhizospherePARGEPGVAQLFNRRGFAQATARHALFGMVLGRLASARD
Ga0207706_1093862513300025933Corn RhizosphereVALYPLSYFVDRFHPRRGTRGVPPLLSNPRAFAQATWRHTIFGAVLGRLA
Ga0207709_1097286223300025935Miscanthus RhizosphereRYHPARGEPGIPRLLTNPRAFAQATWRHTLFGAVLGQLA
Ga0207661_1075413033300025944Corn RhizosphereHPARGEPDMPAIAGSPRAFLQATWRHWLFGTLLGRWS
Ga0207667_1161001913300025949Corn RhizosphereLLDRTHPARGEPGVAQLFNRRGFAQATARHALFGMVLGRLASARD
Ga0207641_1203220723300026088Switchgrass RhizosphereYVADRAHPARGEPGLAPLFTFRAFGQATLRHAVFGAVLGRLNR
Ga0207648_1096223013300026089Miscanthus RhizosphereARGEPGVPSLLTSPRAFAQATWRHLVFGTVLGRLAA
Ga0209887_112213023300027561Groundwater SandRGEPGLAPLLSVRAFGQTTVRHAVFGIVLGRLADR
Ga0208612_111138713300027638Polar DesertPARGEPGVPPLLLNPRAFGQATVRHAVFGALLGRLA
Ga0209811_1026103123300027821Surface SoilRGEPGIPPLLTNPRAFLQATWRHALFGAVLGRLAEEPAER
Ga0247818_1117485813300028589SoilRYHPARGEPGLPPIARSPRAYAQATWRHLLFGWVLARLLPGEVSRP
Ga0247823_1141599323300028590SoilFGEAPGVPPLLRNRKAFVQATWRHAVFGVVLGRLA
Ga0307322_1009363223300028710SoilARGEPGVPPLLTNGRAFGQATARHLLFGIVLGRLAA
Ga0307313_1007637213300028715SoilRRHPARGEPGIPPLLTNPRAFAQATWRHALFGYVLGRLA
Ga0307298_1004219113300028717SoilDRYHPARGEEGVPPLLTNRRAFAQATVRHVVFGFALGLLAG
Ga0307301_1007039323300028719SoilLHPARGEAGVAKLFSVPAFGQATFRHALFGMVLGRLAAERV
Ga0307320_1018310033300028771SoilPARGEPGVERLFSLRACGQATLRHARFGKVLGILAR
Ga0307288_1029827313300028778SoilDRFHPARGEPGLASLFSIPAFGQATFRHALFGKVLGRLSD
Ga0307290_1036784413300028791SoilRGAGGIPPLLRNPRAFGQATVRHALFGLVLGRLSR
Ga0307299_1012586223300028793SoilPARGEPGIPPLLTNPRAFAQATWRHALFGYVLGRLA
Ga0307299_1020055313300028793SoilYHPARGEPGVQHVFSLRAFGQATLRHAIFGKVLGTLAD
Ga0307305_1041890313300028807SoilDRYHPARGEPGVPRLISARAFVQATVRHAFFGVVLGRLAGPATS
Ga0307292_1019433613300028811SoilPARGEPGLARLFSLPAFGQATLRHALFGKLLGELAN
Ga0307292_1020340733300028811SoilHPARGEPGVPPLLRSRRAFAQATWRHALFGWVLGRLGA
Ga0307302_1013927813300028814SoilYFVDRYHPARGEPGVPRLLTNPRAFGQATVRHALFGAVLGRLAR
Ga0307296_1038921213300028819SoilEPGVPPLFTNRRAFAQATWRHAVFGLILGRLAPGRS
Ga0307312_1098063723300028828SoilYHPARGEPGVARMFSVPAFGQATIRHALFGKVLGALAN
Ga0307300_1019451013300028880SoilAVVDRRHPARGGLGLAKLFSIQAFGQATFRHTLFGVVLGTLGD
Ga0307308_1018471323300028884SoilYHPARGEPGVPPILHSPRAFAQATARHALFGFLVGRWA
Ga0307308_1032323523300028884SoilVDRYHPARGEPGIPPLLRNPRAFAQATWRHALFGAVLGWLA
Ga0307304_1019539013300028885SoilGRHPARGEEGVPPLLTNRRAFAQATLRHVVFGFALGLLAG
Ga0307506_1048724323300031366SoilDRYHPARGEPGLPRLHGNRAAFAQACWRHALFGWLLGRFTRM
Ga0272433_1049009523300031450RockLYPLGYFVDRYHPARGEEGIPPLLTNPRAFGQATVRHVLFGVLLGRLA
Ga0307406_1199932713300031901RhizosphereRGEEGVPPLLTNGRAFVQATWRHAVFGVVLGALATGRGRSR
Ga0308174_1170146123300031939SoilALPISRGEHGVPPLLTSPRAFAQATWRHLVFGTVLGRLAA
Ga0310885_1014871533300031943SoilTAFVDRFHPARGTPGIRPSLTSGRAFAQATWRHGLFGAALGLLAGRTAR
Ga0308176_1148059413300031996SoilARGQAGVRRVFGARAFAQATWRHLLFGAVLGRLADE
Ga0307472_10120907613300032205Hardwood Forest SoilPARGEAGLAPLFTFRAFAQATVRHAVFGAVLARLSP
Ga0370484_0107402_612_7313300034125Untreated Peat SoilRYHPARGEPGVERVFGGRAFAQATFRHALFGLVLGRLAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.