| Basic Information | |
|---|---|
| Family ID | F048817 |
| Family Type | Metagenome |
| Number of Sequences | 147 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RRHPARGEPGIPPLLTNPRAFAQATWRHALFGYVLGRLA |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.32 % |
| % of genes from short scaffolds (< 2000 bps) | 95.24 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.796 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.891 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.980 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF03060 | NMO | 10.20 |
| PF12681 | Glyoxalase_2 | 4.08 |
| PF13539 | Peptidase_M15_4 | 3.40 |
| PF01636 | APH | 2.72 |
| PF00296 | Bac_luciferase | 2.72 |
| PF08241 | Methyltransf_11 | 2.72 |
| PF01243 | Putative_PNPOx | 2.04 |
| PF07883 | Cupin_2 | 2.04 |
| PF08494 | DEAD_assoc | 1.36 |
| PF13328 | HD_4 | 1.36 |
| PF12697 | Abhydrolase_6 | 1.36 |
| PF09362 | DUF1996 | 1.36 |
| PF00196 | GerE | 1.36 |
| PF08338 | DUF1731 | 0.68 |
| PF00561 | Abhydrolase_1 | 0.68 |
| PF04828 | GFA | 0.68 |
| PF00999 | Na_H_Exchanger | 0.68 |
| PF02230 | Abhydrolase_2 | 0.68 |
| PF01510 | Amidase_2 | 0.68 |
| PF00590 | TP_methylase | 0.68 |
| PF07690 | MFS_1 | 0.68 |
| PF13442 | Cytochrome_CBB3 | 0.68 |
| PF03851 | UvdE | 0.68 |
| PF10502 | Peptidase_S26 | 0.68 |
| PF01391 | Collagen | 0.68 |
| PF13378 | MR_MLE_C | 0.68 |
| PF00326 | Peptidase_S9 | 0.68 |
| PF07366 | SnoaL | 0.68 |
| PF13365 | Trypsin_2 | 0.68 |
| PF00211 | Guanylate_cyc | 0.68 |
| PF02627 | CMD | 0.68 |
| PF08281 | Sigma70_r4_2 | 0.68 |
| PF00903 | Glyoxalase | 0.68 |
| PF12705 | PDDEXK_1 | 0.68 |
| PF13624 | SurA_N_3 | 0.68 |
| PF13354 | Beta-lactamase2 | 0.68 |
| PF02826 | 2-Hacid_dh_C | 0.68 |
| PF01717 | Meth_synt_2 | 0.68 |
| PF03631 | Virul_fac_BrkB | 0.68 |
| PF01595 | CNNM | 0.68 |
| PF12706 | Lactamase_B_2 | 0.68 |
| PF05974 | DUF892 | 0.68 |
| PF13398 | Peptidase_M50B | 0.68 |
| PF07332 | Phage_holin_3_6 | 0.68 |
| PF06897 | DUF1269 | 0.68 |
| PF01894 | UPF0047 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 10.20 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 10.20 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.72 |
| COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 1.36 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.68 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.68 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.68 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.68 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.68 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.68 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.68 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.68 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.68 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.68 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.68 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.68 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.80 % |
| Unclassified | root | N/A | 10.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002407|C687J29651_10111655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300003911|JGI25405J52794_10148115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300003996|Ga0055467_10088033 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300004463|Ga0063356_104118121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300004463|Ga0063356_105255485 | Not Available | 556 | Open in IMG/M |
| 3300004479|Ga0062595_101537874 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005186|Ga0066676_10613535 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005330|Ga0070690_101523249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300005343|Ga0070687_101197071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300005356|Ga0070674_100697174 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005445|Ga0070708_101066305 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005455|Ga0070663_101770321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300005518|Ga0070699_101558985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300005526|Ga0073909_10503638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 586 | Open in IMG/M |
| 3300005530|Ga0070679_100942514 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005535|Ga0070684_101109037 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005548|Ga0070665_100636991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300005558|Ga0066698_10975566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300005563|Ga0068855_101900224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 603 | Open in IMG/M |
| 3300005578|Ga0068854_100933146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300005578|Ga0068854_102078330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300005614|Ga0068856_100891191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300005840|Ga0068870_10833304 | Not Available | 647 | Open in IMG/M |
| 3300005937|Ga0081455_10272007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1228 | Open in IMG/M |
| 3300005937|Ga0081455_10408667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 940 | Open in IMG/M |
| 3300006032|Ga0066696_11121037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300006059|Ga0075017_100355814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1091 | Open in IMG/M |
| 3300006845|Ga0075421_102190528 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006876|Ga0079217_11404373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300006881|Ga0068865_101515166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300007004|Ga0079218_10374224 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300007004|Ga0079218_12700490 | Not Available | 592 | Open in IMG/M |
| 3300009081|Ga0105098_10669726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300009089|Ga0099828_10766236 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300009089|Ga0099828_11550055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300009137|Ga0066709_103688443 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009137|Ga0066709_104077747 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009148|Ga0105243_10120612 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300009156|Ga0111538_10318926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1967 | Open in IMG/M |
| 3300009162|Ga0075423_11626613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300009162|Ga0075423_12737782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300009789|Ga0126307_10821173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300009987|Ga0105030_129223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300010037|Ga0126304_10603091 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010043|Ga0126380_11693192 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010329|Ga0134111_10354511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300010337|Ga0134062_10626881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300010362|Ga0126377_12439821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300010373|Ga0134128_11106935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
| 3300010376|Ga0126381_102908274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300010400|Ga0134122_11295901 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300010401|Ga0134121_10825946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 893 | Open in IMG/M |
| 3300011270|Ga0137391_10908241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300011400|Ga0137312_1042815 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300011991|Ga0120153_1023714 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300011991|Ga0120153_1036303 | Not Available | 977 | Open in IMG/M |
| 3300012014|Ga0120159_1025200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2124 | Open in IMG/M |
| 3300012043|Ga0136631_10323963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 616 | Open in IMG/M |
| 3300012043|Ga0136631_10431823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300012093|Ga0136632_10086933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1446 | Open in IMG/M |
| 3300012186|Ga0136620_10064096 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300012186|Ga0136620_10480805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300012201|Ga0137365_11020906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300012353|Ga0137367_10405551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300012356|Ga0137371_10511977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300012358|Ga0137368_10031174 | All Organisms → cellular organisms → Bacteria | 4823 | Open in IMG/M |
| 3300012530|Ga0136635_10005193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4083 | Open in IMG/M |
| 3300012680|Ga0136612_10003804 | All Organisms → cellular organisms → Bacteria | 7092 | Open in IMG/M |
| 3300012897|Ga0157285_10294622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300012908|Ga0157286_10386235 | Not Available | 539 | Open in IMG/M |
| 3300012955|Ga0164298_10811839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
| 3300012957|Ga0164303_10891259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300012984|Ga0164309_10384058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300012985|Ga0164308_11787638 | Not Available | 572 | Open in IMG/M |
| 3300012987|Ga0164307_10716019 | Not Available | 786 | Open in IMG/M |
| 3300012987|Ga0164307_11584284 | Not Available | 554 | Open in IMG/M |
| 3300012989|Ga0164305_10705093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
| 3300013102|Ga0157371_11588761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 512 | Open in IMG/M |
| 3300013308|Ga0157375_12118775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 669 | Open in IMG/M |
| 3300013308|Ga0157375_13718992 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300013772|Ga0120158_10305582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300014031|Ga0120173_1004736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1939 | Open in IMG/M |
| 3300014166|Ga0134079_10067868 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300014965|Ga0120193_10054707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300015358|Ga0134089_10409870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300015371|Ga0132258_13766865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1033 | Open in IMG/M |
| 3300015372|Ga0132256_101901988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300016357|Ga0182032_11180109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300018051|Ga0184620_10108867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300018056|Ga0184623_10015024 | Not Available | 3385 | Open in IMG/M |
| 3300018061|Ga0184619_10051981 | Not Available | 1784 | Open in IMG/M |
| 3300018422|Ga0190265_12804103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300018481|Ga0190271_12483457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300019362|Ga0173479_10005503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3044 | Open in IMG/M |
| 3300019767|Ga0190267_10122837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
| 3300019878|Ga0193715_1074989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300021057|Ga0196981_1066260 | Not Available | 552 | Open in IMG/M |
| 3300021078|Ga0210381_10227030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha cephalotaxi | 658 | Open in IMG/M |
| 3300021362|Ga0213882_10404534 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300021445|Ga0182009_10425026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300021560|Ga0126371_11509234 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300022756|Ga0222622_10159376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
| 3300024290|Ga0247667_1071470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 639 | Open in IMG/M |
| 3300025908|Ga0207643_10118463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
| 3300025911|Ga0207654_10356274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1008 | Open in IMG/M |
| 3300025919|Ga0207657_10343178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1178 | Open in IMG/M |
| 3300025921|Ga0207652_10978657 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300025929|Ga0207664_11281863 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300025932|Ga0207690_11202690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 633 | Open in IMG/M |
| 3300025933|Ga0207706_10938625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 729 | Open in IMG/M |
| 3300025935|Ga0207709_10972862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 693 | Open in IMG/M |
| 3300025944|Ga0207661_10754130 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300025949|Ga0207667_11610019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 618 | Open in IMG/M |
| 3300026088|Ga0207641_12032207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300026089|Ga0207648_10962230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300027561|Ga0209887_1122130 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027638|Ga0208612_1111387 | Not Available | 700 | Open in IMG/M |
| 3300027821|Ga0209811_10261031 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300028589|Ga0247818_11174858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300028590|Ga0247823_11415993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 521 | Open in IMG/M |
| 3300028710|Ga0307322_10093632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| 3300028715|Ga0307313_10076372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
| 3300028717|Ga0307298_10042191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
| 3300028719|Ga0307301_10070393 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300028771|Ga0307320_10183100 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300028778|Ga0307288_10298273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300028791|Ga0307290_10367844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300028793|Ga0307299_10125862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300028793|Ga0307299_10200553 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300028807|Ga0307305_10418903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300028811|Ga0307292_10194336 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300028811|Ga0307292_10203407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
| 3300028814|Ga0307302_10139278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300028819|Ga0307296_10389212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300028828|Ga0307312_10980637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300028880|Ga0307300_10194510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300028884|Ga0307308_10184713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Limosilactobacillus | 999 | Open in IMG/M |
| 3300028884|Ga0307308_10323235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300028885|Ga0307304_10195390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
| 3300031366|Ga0307506_10487243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031450|Ga0272433_10490095 | Not Available | 507 | Open in IMG/M |
| 3300031901|Ga0307406_11999327 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031939|Ga0308174_11701461 | Not Available | 542 | Open in IMG/M |
| 3300031943|Ga0310885_10148715 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300031996|Ga0308176_11480594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 723 | Open in IMG/M |
| 3300032205|Ga0307472_101209076 | Not Available | 722 | Open in IMG/M |
| 3300034125|Ga0370484_0107402 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.13% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.04% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.04% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.36% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.68% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.68% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300021057 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J29651_101116551 | 3300002407 | Soil | YLIDRYHPARGEPGVPPLLTNPRAFAQATWRHALFGTMRGRLA* |
| JGI25405J52794_101481152 | 3300003911 | Tabebuia Heterophylla Rhizosphere | DRHHPARGEPGVASLFHPRAFGQATVRHAVFGLVLGRIGK* |
| Ga0055467_100880333 | 3300003996 | Natural And Restored Wetlands | PARGTRGVPPLLTNPRAFAQATWRHALFGALLGRLARSPGDRDG* |
| Ga0063356_1041181212 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PARGEEGIPPLLGNRRAFAQATWRHALFALLLGRLLSGATDTSRR* |
| Ga0063356_1052554852 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PASGEAGVPANLLSNERAFAQAAVRHALFGVVLGRLAAGR* |
| Ga0062595_1015378741 | 3300004479 | Soil | DRRHPARGEAGVAPMLSVRGFAQETVRHALFGVVLGRLAR* |
| Ga0066676_106135352 | 3300005186 | Soil | DRHHPARGEPGIPPLFTNPRAFAQATWRHAVFGFVLARMA* |
| Ga0070690_1015232492 | 3300005330 | Switchgrass Rhizosphere | CFFIDRFHPARGQEGVPPLLTNPRAFGQATWRHAIFGVILGRLA* |
| Ga0070687_1011970712 | 3300005343 | Switchgrass Rhizosphere | IDRYHPARGEPGIPPLLTNPRAFVQATWRHALFGAVLGRLAA* |
| Ga0070674_1006971742 | 3300005356 | Miscanthus Rhizosphere | DRYHPARGEPGVQHVFSLRAFGQATLRHALFGLVLGRLAE* |
| Ga0070708_1010663051 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRFHPRRGEPGVPPLLGNPRAFGQATARHALFGWLLGRLAA* |
| Ga0070663_1017703211 | 3300005455 | Corn Rhizosphere | LCFFIDRFHPARGQEGVPPLLTNTRAFGQATWRHAIFGVILGRLA* |
| Ga0070699_1015589851 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FADRYHPARGEPGVARMFSIPAFGQATVRHALFGKVLGALAN* |
| Ga0073909_105036382 | 3300005526 | Surface Soil | VDRYHPARGEPGIPHLLTNPRAFAQATWRHALFGAVFGQLA* |
| Ga0070679_1009425141 | 3300005530 | Corn Rhizosphere | LAPLVDRYHPARGERGVAAMWSKRAFAQETLRHVVFGAVLGRLTA* |
| Ga0070684_1011090372 | 3300005535 | Corn Rhizosphere | LCYFVDRFHPQRGSTGVPALLENRKAFVQATWRHAVFGLVLGRLA* |
| Ga0070665_1006369911 | 3300005548 | Switchgrass Rhizosphere | RGEPGIPPLLTNPRAFVQATWRHALFGAVLGRLAA* |
| Ga0066698_109755662 | 3300005558 | Soil | STGSLVDRYHPARGEPGVEQLFSFRAFGQATLRHVVFGKVLGTLAR* |
| Ga0068855_1019002242 | 3300005563 | Corn Rhizosphere | LLDRTHPARGEPGVAQLFNRRGFAQATARHALFGMVLGRLASARD* |
| Ga0068854_1009331461 | 3300005578 | Corn Rhizosphere | EPGIPPLLTNPRAFAQATWRHLLFGTVLGRLASGR* |
| Ga0068854_1020783302 | 3300005578 | Corn Rhizosphere | DRRHPARGEAGVERVFGARAFAQATWRHLLFGAVLGRLARE* |
| Ga0068856_1008911911 | 3300005614 | Corn Rhizosphere | ARGQAGVRNVFGARAFAQATWRHFLFGSVLGRLAGE* |
| Ga0068870_108333041 | 3300005840 | Miscanthus Rhizosphere | SALVDRRHPARGSAGIPKLLTPRAFAQATVRHAVFGAVLGRLA* |
| Ga0081455_102720074 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VDRYHPARGKKGVPPLLTNARAFGQATVRHAVFGLLLGRLARP* |
| Ga0081455_104086673 | 3300005937 | Tabebuia Heterophylla Rhizosphere | GSEGVPALLRNPRAFAQATWRHALFGAVLGGLAGPSEY* |
| Ga0066696_111210372 | 3300006032 | Soil | VDRYHPARGEPGVVRLFSQRAFVLATWRHTLFGWVLGRLA* |
| Ga0075017_1003558141 | 3300006059 | Watersheds | ARGEPGLEKLMSGRAFAQATWRHALFGWTLGRLA* |
| Ga0075421_1021905281 | 3300006845 | Populus Rhizosphere | YFVDRFHPQRGSTGVPALLENRKAFVQATWRHAVFGLVLGRLA* |
| Ga0079217_114043732 | 3300006876 | Agricultural Soil | SLYPLSYFVDRYHPARGEDGIPPLLTNPRAFAQATLRHAVFGALLGRLAR* |
| Ga0068865_1015151662 | 3300006881 | Miscanthus Rhizosphere | LYPLCYFIDRRHPARGEQGIPPLLKNPRAYAQATWRHALFGFALGRLA* |
| Ga0079218_103742244 | 3300007004 | Agricultural Soil | LSALVDRRHPARGTEGIPKLLTARAFGQATVRHAVFGAVLGRLA* |
| Ga0079218_127004901 | 3300007004 | Agricultural Soil | LSALVDRRHPARGTEGIPKLLTARAFGQATVRHAVFGAVLDRLA* |
| Ga0105098_106697261 | 3300009081 | Freshwater Sediment | PARGEEGVPPLLTNPRAFLQATWRHALFGVVLGRLAGRV* |
| Ga0099828_107662362 | 3300009089 | Vadose Zone Soil | YHPARGEPGIPPLLTNPRAFAQATWRHALFGAVLGWLA* |
| Ga0099828_115500552 | 3300009089 | Vadose Zone Soil | LCYFVDHYHRARGEPGVPPLLTNPRAFAQATWRHTLFAVVLDRLSRHQH* |
| Ga0066709_1036884432 | 3300009137 | Grasslands Soil | FVDRYHPARGQPGIPRLLTNPRAFAQATWRHALFGAVLGHLA* |
| Ga0066709_1040777472 | 3300009137 | Grasslands Soil | VDRCHPARGETGVPPLLRNPRAFAQGAARHALFGVVLGRLG* |
| Ga0105243_101206121 | 3300009148 | Miscanthus Rhizosphere | RYHPARGEPGIPRLLTNPRAFAQATWRHTLFGAVLGQLA* |
| Ga0111538_103189264 | 3300009156 | Populus Rhizosphere | ARGEEGVPPLLTNPRAFAQATWRHAVFGAVLGRLA* |
| Ga0075423_116266132 | 3300009162 | Populus Rhizosphere | YHPARGEPGVPPLLRSPRAFVQATWRHAVFGTILGRLAR* |
| Ga0075423_127377822 | 3300009162 | Populus Rhizosphere | DRYHPARGEPGVPPLLASLRAFVQATWRHAVFGAVLGRLA* |
| Ga0126307_108211731 | 3300009789 | Serpentine Soil | GTDGVPRLVHPRAFAQATVRHALFGVLLGRLAKR* |
| Ga0105030_1292232 | 3300009987 | Switchgrass Rhizosphere | YHPARGEPGLPPLLKSPRAFSQATWRHALFGVLLGRLA* |
| Ga0126304_106030911 | 3300010037 | Serpentine Soil | DRRHPARGSAGIPKLLTPRVFAQATVRHAVFGAALGRLA* |
| Ga0126380_116931922 | 3300010043 | Tropical Forest Soil | MIGVTRERGESGVVDVFSKRAFAQATARHALFGYVLGRLA* |
| Ga0134111_103545111 | 3300010329 | Grasslands Soil | FVDRHHPARGESGVPPLLTNPRAFAQATWRHALFGGALGCLA* |
| Ga0134062_106268811 | 3300010337 | Grasslands Soil | VDRHHPARGEPGIPPLFTNPRAFAQATWRHAVFGFVLARMA* |
| Ga0126377_124398211 | 3300010362 | Tropical Forest Soil | DRYHPARGEPGLPPLARNGRAFAQATWRHALFGWLVGRLG* |
| Ga0134128_111069351 | 3300010373 | Terrestrial Soil | PARGEPGIPQLLTNPRAFAQATWRHALFGAVLGQLA* |
| Ga0126381_1029082741 | 3300010376 | Tropical Forest Soil | DRRHPARGEPGVPRLAGNARAFALATWRPGLFGAVLARLA* |
| Ga0134122_112959011 | 3300010400 | Terrestrial Soil | ALVDRFHPARGEPNLASLFSLPAFGQATFRHALFGKVLGRLSD* |
| Ga0134121_108259462 | 3300010401 | Terrestrial Soil | LWPFCALVDRYHPARGEPGVPPLLTNPRAFVQATARHALFGVALGVLAR* |
| Ga0137391_109082411 | 3300011270 | Vadose Zone Soil | LFPLCYFVDRYHPARGEPGIPPLLTNPRAFAQATWRHALFGAALAWLA* |
| Ga0137312_10428152 | 3300011400 | Soil | ARGEPGVPPLLTSPRAFAQATARHALFGLLLGRLAR* |
| Ga0120153_10237143 | 3300011991 | Permafrost | FVDRYHPARGEPGVPPLLRSPRAFAQAGARHALFGYLLGRWA* |
| Ga0120153_10363031 | 3300011991 | Permafrost | YHPARGEPGVPPLATSGRAFAQATARHVLFGVLLGRLA* |
| Ga0120159_10252003 | 3300012014 | Permafrost | YPLAYFVDRYHPARGEPGVPPLLRSPRAFAQAGARHALFGYLLGRWA* |
| Ga0136631_103239631 | 3300012043 | Polar Desert Sand | RYHPARGAPGIPPLLTNGRAFAQATWRHLVFGILLGRLATPR* |
| Ga0136631_104318231 | 3300012043 | Polar Desert Sand | PYFVDRYHPARGELGFPPLLRSSPDFGQAAVRHAVFGVLLARWS* |
| Ga0136632_100869332 | 3300012093 | Polar Desert Sand | YHPARGEPGVPSLLRSPRAFAQASWRHAVFGVVLGRLA* |
| Ga0136620_100640964 | 3300012186 | Polar Desert Sand | RGEPGVPPLLTNSRAFAQATWRHALFGVVLGRLVAR* |
| Ga0136620_104808051 | 3300012186 | Polar Desert Sand | ARGTRGIPPLLTNPRAFAQATWRHALFGVVLGALASPRR* |
| Ga0137365_110209061 | 3300012201 | Vadose Zone Soil | DRHHRARGEPGIPPLLTNPRAYLQATWRHALFGVLLGRFA* |
| Ga0137367_104055511 | 3300012353 | Vadose Zone Soil | PARGEPGIPPLLTNPRAYLQATWRHALFGIVLGRLA* |
| Ga0137371_105119771 | 3300012356 | Vadose Zone Soil | RHHPARGEPGIPPLFTNPRAFAQATWRHALFGWTLGRLT* |
| Ga0137368_100311741 | 3300012358 | Vadose Zone Soil | YFVDRYHPARGKPGVPRLLDNPRAFGQATARHALFGLILGRLG* |
| Ga0136635_100051933 | 3300012530 | Polar Desert Sand | STGRFVDRYHPARGEPGIPPLLSPRVFGQATVRHTVFGLVLGRLAR* |
| Ga0136612_100038046 | 3300012680 | Polar Desert Sand | ARGTKGIPPLLTNPRAFTQAAWRHAVFGVVLGRLA* |
| Ga0157285_102946222 | 3300012897 | Soil | AHGEPGVARMFSVPAFGQATIRHALFGKVLGALAN* |
| Ga0157286_103862351 | 3300012908 | Soil | ARGSAGIPKLLTPRAFAQATVRHALFGAVLGRLA* |
| Ga0164298_108118392 | 3300012955 | Soil | PARGRAGVRSVFGARAFVQATWRHFLFGSVLGRLADE* |
| Ga0164303_108912591 | 3300012957 | Soil | LVDRTHPARGEPGVGQLFNRRGFAQATARHALFGTVLGRIAAARG* |
| Ga0164309_103840581 | 3300012984 | Soil | PGIPPLLTNPRAFAQATWRHLLFGTVLGRLASGR* |
| Ga0164308_117876381 | 3300012985 | Soil | HPARGEPGVPPIFTKRAFAQATWRHALFGWLLGRLA* |
| Ga0164307_107160192 | 3300012987 | Soil | HPARGEPGLAPLLTVRGFVQSTARHALFGVVLGRLAR* |
| Ga0164307_115842841 | 3300012987 | Soil | NAVVDRHHPASGEPGIPRNMLSSPRAFALATWRHAVFGVLLGRLAGD* |
| Ga0164305_107050932 | 3300012989 | Soil | LVDRHHPARGEPGVPPIFMKRAFAQATWRHALFGWLLGRLA* |
| Ga0157371_115887612 | 3300013102 | Corn Rhizosphere | ALYPLCYLVDRFHPRRGAPGVPPLLRNRKAFVQATWRHAVFGVVLGRLA* |
| Ga0157375_121187751 | 3300013308 | Miscanthus Rhizosphere | HPRRGAPGVPPLLRNRKAFVQATWRHAVFGVVLGRLA* |
| Ga0157375_137189921 | 3300013308 | Miscanthus Rhizosphere | ALVDRYHPARGEAGLASLFSLRAFGQATARHALFGKVLGRLGT* |
| Ga0120158_103055823 | 3300013772 | Permafrost | DTHHPARGEPGVARLFSLRAFGQATVRHALFGVVLGRAYSPPT* |
| Ga0120173_10047363 | 3300014031 | Permafrost | VARSPPARGEGGTPPLLTNGRAFAQATVRHACFGALVGRLADQPIP* |
| Ga0134079_100678681 | 3300014166 | Grasslands Soil | DRYHPARGEKGLPPLLTNPRAFAQATARHLVFGIALGRLAG* |
| Ga0120193_100547074 | 3300014965 | Terrestrial | LFPLGVLVDRYHPARGTPGVPCLVHPKAFGQATVRHALFGAVLGRLAR* |
| Ga0134089_104098702 | 3300015358 | Grasslands Soil | GKLVDRYHPARGEPGVEQLFSLRAFAQATLRHALFGKVLGTLAR* |
| Ga0132258_137668652 | 3300015371 | Arabidopsis Rhizosphere | HHPARGEPGVPPLLTSGRAFAQATLRHAVFGVVLGRLA* |
| Ga0132256_1019019883 | 3300015372 | Arabidopsis Rhizosphere | SILSDRYHPAMGQPGVVPIARDPRAFAQETWRHLLFGWALARLLPREVSRA* |
| Ga0182032_111801091 | 3300016357 | Soil | LGAVVDRYHPARGEPGLPPIFTKRAFAQATWRHAVFGWTLGKLA |
| Ga0184620_101088672 | 3300018051 | Groundwater Sediment | CYFIDRYHPARGEPGIPPLLSNPRAFLQATWRHALFGAVLGRLA |
| Ga0184623_100150242 | 3300018056 | Groundwater Sediment | ALFPTGHFVDRYHPAHGEPGVPRLVSARAFGQATVRHTVFGFVLGRLA |
| Ga0184619_100519811 | 3300018061 | Groundwater Sediment | RYHPARGEPGIPRLLTNPRAFAQATWRHALFGAVLGQLA |
| Ga0190265_128041032 | 3300018422 | Soil | RYHPARGEEGIPPLLTNPRAFVQATWRHAVFGVVLGRLAPR |
| Ga0190271_124834571 | 3300018481 | Soil | TSFVDRPARGESGVPPLLTNPRAFGQATWRHAFFGAVLGRLA |
| Ga0173479_100055031 | 3300019362 | Soil | SYFVDRFHPRRGTRGIPPLLENPRAFAQATWRHTIFGLVLGRLA |
| Ga0190267_101228372 | 3300019767 | Soil | YHPARGERGIPRLAGNRRAFAQATFRHALFGLVLARLTRAGGGSTRA |
| Ga0193715_10749891 | 3300019878 | Soil | LALYPLCYFIDRHHPAHGEPGVPPLFANRRAFAQATWRHAVFGLILGRLAAGRS |
| Ga0196981_10662603 | 3300021057 | Soil | YHPARGTRDVPRIFTWRAFGQATLRHLLFGWLLGRLARERPR |
| Ga0210381_102270302 | 3300021078 | Groundwater Sediment | YHPARGEEGVPPLLTNRRAFAQATVRHVVFGFALGLLAG |
| Ga0213882_104045342 | 3300021362 | Exposed Rock | HPARGEAGLAPLFSARGFVQATARHAVFGAVLGALAGEELE |
| Ga0182009_104250263 | 3300021445 | Soil | ALYPLSFFVDRFHPARREQGVPPLLTNGRAFGQATMRHLVFGLILGRLA |
| Ga0126371_115092342 | 3300021560 | Tropical Forest Soil | VDRHHPARGESGVPRLAGNPRAFALATWRHALFGAVLGRLA |
| Ga0222622_101593763 | 3300022756 | Groundwater Sediment | DRYHPARGEPGVPPLLTSRRAFAQATLRHALFGVVLGSLA |
| Ga0247667_10714701 | 3300024290 | Soil | RRHPARGEAGVERVFGARAFVQATWRHALFGAVLGRLAGE |
| Ga0207643_101184634 | 3300025908 | Miscanthus Rhizosphere | LYPLCYFVDRFHPQRGATGVPPLLKNHKAFMQATWRHALFGLVLARLA |
| Ga0207654_103562742 | 3300025911 | Corn Rhizosphere | HPARGQPGLRRVFGARAFAQATWRHFLFGAVLGRLADE |
| Ga0207657_103431783 | 3300025919 | Corn Rhizosphere | GALVDRRHPARGQPGVRRVFGARAFAQATWRHLLFGAVLGRLAGE |
| Ga0207652_109786572 | 3300025921 | Corn Rhizosphere | LAPLVDRYHPARGERGVAAMWSKRAFAQETLRHVVFGAVLGRLTA |
| Ga0207664_112818631 | 3300025929 | Agricultural Soil | ALWPFCALVDRYHPARGEPGVPPLLTNPRAFVQATVRHALFGVALGVLAAA |
| Ga0207690_112026901 | 3300025932 | Corn Rhizosphere | PARGEPGVAQLFNRRGFAQATARHALFGMVLGRLASARD |
| Ga0207706_109386251 | 3300025933 | Corn Rhizosphere | VALYPLSYFVDRFHPRRGTRGVPPLLSNPRAFAQATWRHTIFGAVLGRLA |
| Ga0207709_109728622 | 3300025935 | Miscanthus Rhizosphere | RYHPARGEPGIPRLLTNPRAFAQATWRHTLFGAVLGQLA |
| Ga0207661_107541303 | 3300025944 | Corn Rhizosphere | HPARGEPDMPAIAGSPRAFLQATWRHWLFGTLLGRWS |
| Ga0207667_116100191 | 3300025949 | Corn Rhizosphere | LLDRTHPARGEPGVAQLFNRRGFAQATARHALFGMVLGRLASARD |
| Ga0207641_120322072 | 3300026088 | Switchgrass Rhizosphere | YVADRAHPARGEPGLAPLFTFRAFGQATLRHAVFGAVLGRLNR |
| Ga0207648_109622301 | 3300026089 | Miscanthus Rhizosphere | ARGEPGVPSLLTSPRAFAQATWRHLVFGTVLGRLAA |
| Ga0209887_11221302 | 3300027561 | Groundwater Sand | RGEPGLAPLLSVRAFGQTTVRHAVFGIVLGRLADR |
| Ga0208612_11113871 | 3300027638 | Polar Desert | PARGEPGVPPLLLNPRAFGQATVRHAVFGALLGRLA |
| Ga0209811_102610312 | 3300027821 | Surface Soil | RGEPGIPPLLTNPRAFLQATWRHALFGAVLGRLAEEPAER |
| Ga0247818_111748581 | 3300028589 | Soil | RYHPARGEPGLPPIARSPRAYAQATWRHLLFGWVLARLLPGEVSRP |
| Ga0247823_114159932 | 3300028590 | Soil | FGEAPGVPPLLRNRKAFVQATWRHAVFGVVLGRLA |
| Ga0307322_100936322 | 3300028710 | Soil | ARGEPGVPPLLTNGRAFGQATARHLLFGIVLGRLAA |
| Ga0307313_100763721 | 3300028715 | Soil | RRHPARGEPGIPPLLTNPRAFAQATWRHALFGYVLGRLA |
| Ga0307298_100421911 | 3300028717 | Soil | DRYHPARGEEGVPPLLTNRRAFAQATVRHVVFGFALGLLAG |
| Ga0307301_100703932 | 3300028719 | Soil | LHPARGEAGVAKLFSVPAFGQATFRHALFGMVLGRLAAERV |
| Ga0307320_101831003 | 3300028771 | Soil | PARGEPGVERLFSLRACGQATLRHARFGKVLGILAR |
| Ga0307288_102982731 | 3300028778 | Soil | DRFHPARGEPGLASLFSIPAFGQATFRHALFGKVLGRLSD |
| Ga0307290_103678441 | 3300028791 | Soil | RGAGGIPPLLRNPRAFGQATVRHALFGLVLGRLSR |
| Ga0307299_101258622 | 3300028793 | Soil | PARGEPGIPPLLTNPRAFAQATWRHALFGYVLGRLA |
| Ga0307299_102005531 | 3300028793 | Soil | YHPARGEPGVQHVFSLRAFGQATLRHAIFGKVLGTLAD |
| Ga0307305_104189031 | 3300028807 | Soil | DRYHPARGEPGVPRLISARAFVQATVRHAFFGVVLGRLAGPATS |
| Ga0307292_101943361 | 3300028811 | Soil | PARGEPGLARLFSLPAFGQATLRHALFGKLLGELAN |
| Ga0307292_102034073 | 3300028811 | Soil | HPARGEPGVPPLLRSRRAFAQATWRHALFGWVLGRLGA |
| Ga0307302_101392781 | 3300028814 | Soil | YFVDRYHPARGEPGVPRLLTNPRAFGQATVRHALFGAVLGRLAR |
| Ga0307296_103892121 | 3300028819 | Soil | EPGVPPLFTNRRAFAQATWRHAVFGLILGRLAPGRS |
| Ga0307312_109806372 | 3300028828 | Soil | YHPARGEPGVARMFSVPAFGQATIRHALFGKVLGALAN |
| Ga0307300_101945101 | 3300028880 | Soil | AVVDRRHPARGGLGLAKLFSIQAFGQATFRHTLFGVVLGTLGD |
| Ga0307308_101847132 | 3300028884 | Soil | YHPARGEPGVPPILHSPRAFAQATARHALFGFLVGRWA |
| Ga0307308_103232352 | 3300028884 | Soil | VDRYHPARGEPGIPPLLRNPRAFAQATWRHALFGAVLGWLA |
| Ga0307304_101953901 | 3300028885 | Soil | GRHPARGEEGVPPLLTNRRAFAQATLRHVVFGFALGLLAG |
| Ga0307506_104872432 | 3300031366 | Soil | DRYHPARGEPGLPRLHGNRAAFAQACWRHALFGWLLGRFTRM |
| Ga0272433_104900952 | 3300031450 | Rock | LYPLGYFVDRYHPARGEEGIPPLLTNPRAFGQATVRHVLFGVLLGRLA |
| Ga0307406_119993271 | 3300031901 | Rhizosphere | RGEEGVPPLLTNGRAFVQATWRHAVFGVVLGALATGRGRSR |
| Ga0308174_117014612 | 3300031939 | Soil | ALPISRGEHGVPPLLTSPRAFAQATWRHLVFGTVLGRLAA |
| Ga0310885_101487153 | 3300031943 | Soil | TAFVDRFHPARGTPGIRPSLTSGRAFAQATWRHGLFGAALGLLAGRTAR |
| Ga0308176_114805941 | 3300031996 | Soil | ARGQAGVRRVFGARAFAQATWRHLLFGAVLGRLADE |
| Ga0307472_1012090761 | 3300032205 | Hardwood Forest Soil | PARGEAGLAPLFTFRAFAQATVRHAVFGAVLARLSP |
| Ga0370484_0107402_612_731 | 3300034125 | Untreated Peat Soil | RYHPARGEPGVERVFGGRAFAQATFRHALFGLVLGRLAA |
| ⦗Top⦘ |