NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048814

Metagenome / Metatranscriptome Family F048814

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048814
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 44 residues
Representative Sequence MGKIVFAGAMSHVLDPDYYERACGAVGRQKVEAAMAEIARMGER
Number of Associated Samples 130
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.60 %
% of genes near scaffold ends (potentially truncated) 97.96 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.197 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.884 % of family members)
Environment Ontology (ENVO) Unclassified
(25.170 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.939 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF07883Cupin_2 9.52
PF11249DUF3047 5.44
PF00296Bac_luciferase 4.76
PF02653BPD_transp_2 4.76
PF00480ROK 3.40
PF00441Acyl-CoA_dh_1 3.40
PF13561adh_short_C2 2.72
PF00107ADH_zinc_N 2.72
PF06537DHOR 2.72
PF00005ABC_tran 2.72
PF02738MoCoBD_1 2.72
PF031712OG-FeII_Oxy 1.36
PF01315Ald_Xan_dh_C 1.36
PF09754PAC2 1.36
PF02900LigB 1.36
PF00581Rhodanese 1.36
PF14226DIOX_N 1.36
PF02604PhdYeFM_antitox 1.36
PF02771Acyl-CoA_dh_N 1.36
PF00702Hydrolase 0.68
PF05494MlaC 0.68
PF13669Glyoxalase_4 0.68
PF13147Obsolete Pfam Family 0.68
PF04909Amidohydro_2 0.68
PF11794HpaB_N 0.68
PF01212Beta_elim_lyase 0.68
PF03241HpaB 0.68
PF07969Amidohydro_3 0.68
PF00528BPD_transp_1 0.68
PF00211Guanylate_cyc 0.68
PF00890FAD_binding_2 0.68
PF04264YceI 0.68
PF13087AAA_12 0.68
PF16868NMT1_3 0.68
PF02633Creatininase 0.68
PF07681DoxX 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 6.80
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 4.76
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 4.76
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 2.72
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.36
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.36
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 1.36
COG2368Aromatic ring hydroxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.68
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.68
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.68
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.68
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.68
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.68
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.68
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.68
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.68
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.68
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.68
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.68
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 0.68
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.68
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.68
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.68
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.68
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.68
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.68
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.68
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.68
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.20 %
UnclassifiedrootN/A6.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|F0B48LX02I484LAll Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
2228664022|INPgaii200_c1124802All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300001139|JGI10220J13317_12064590All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria574Open in IMG/M
3300004268|Ga0066398_10064517All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300004479|Ga0062595_101994064All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300004633|Ga0066395_10247986All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300005166|Ga0066674_10064471All Organisms → cellular organisms → Bacteria → Proteobacteria1671Open in IMG/M
3300005174|Ga0066680_10132335All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300005180|Ga0066685_11094294All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005328|Ga0070676_10260906All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300005332|Ga0066388_100789570All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300005332|Ga0066388_100906544All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300005353|Ga0070669_100801846All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005353|Ga0070669_102024961All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria503Open in IMG/M
3300005441|Ga0070700_100351304All Organisms → cellular organisms → Bacteria → Proteobacteria1093Open in IMG/M
3300005445|Ga0070708_100851642All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300005468|Ga0070707_101986795All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005536|Ga0070697_101211393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium673Open in IMG/M
3300005555|Ga0066692_10656894All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300005558|Ga0066698_10076144All Organisms → cellular organisms → Bacteria → Proteobacteria2174Open in IMG/M
3300005598|Ga0066706_10605164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300005713|Ga0066905_100654718All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300005713|Ga0066905_101114115All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005764|Ga0066903_105689900All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005841|Ga0068863_100693775Not Available1012Open in IMG/M
3300005844|Ga0068862_101512508All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium677Open in IMG/M
3300005844|Ga0068862_102651663All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005879|Ga0075295_1021549All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005937|Ga0081455_10974235All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300005983|Ga0081540_1003560All Organisms → cellular organisms → Bacteria12254Open in IMG/M
3300006034|Ga0066656_10766277All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. KM1618Open in IMG/M
3300006852|Ga0075433_10539445All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300006854|Ga0075425_100899710All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300006876|Ga0079217_11566997All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium524Open in IMG/M
3300006894|Ga0079215_11480120All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006894|Ga0079215_11550321All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium525Open in IMG/M
3300006903|Ga0075426_10644019Not Available793Open in IMG/M
3300006903|Ga0075426_11562369All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009012|Ga0066710_102187227Not Available808Open in IMG/M
3300009012|Ga0066710_103804157All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300009038|Ga0099829_11129292All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium649Open in IMG/M
3300009078|Ga0105106_10485071All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300009089|Ga0099828_10934939All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300009089|Ga0099828_11947579All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium515Open in IMG/M
3300009090|Ga0099827_10103630All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2266Open in IMG/M
3300009147|Ga0114129_10775710All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1225Open in IMG/M
3300009157|Ga0105092_10866869All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009162|Ga0075423_11376671All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300009545|Ga0105237_12237511All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300009553|Ga0105249_11222903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria822Open in IMG/M
3300009792|Ga0126374_10003005All Organisms → cellular organisms → Bacteria5448Open in IMG/M
3300009804|Ga0105063_1021291All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300009810|Ga0105088_1036554All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300010047|Ga0126382_11280291Not Available662Open in IMG/M
3300010322|Ga0134084_10006087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2887Open in IMG/M
3300010326|Ga0134065_10024506All Organisms → cellular organisms → Bacteria → Proteobacteria1726Open in IMG/M
3300010336|Ga0134071_10212609All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300010359|Ga0126376_10832620All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300010361|Ga0126378_10970477Not Available954Open in IMG/M
3300010361|Ga0126378_12144121All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300010362|Ga0126377_11305727All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium797Open in IMG/M
3300010366|Ga0126379_11182421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium871Open in IMG/M
3300010376|Ga0126381_100854779All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1308Open in IMG/M
3300010376|Ga0126381_103768269All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300010398|Ga0126383_13001154All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium551Open in IMG/M
3300010398|Ga0126383_13484361All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010399|Ga0134127_13555624All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300010400|Ga0134122_12508088All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300011269|Ga0137392_11047019All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300011436|Ga0137458_1261209All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012035|Ga0137445_1086670All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria633Open in IMG/M
3300012096|Ga0137389_10960070All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium733Open in IMG/M
3300012201|Ga0137365_10985254All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria612Open in IMG/M
3300012205|Ga0137362_10829883All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300012354|Ga0137366_11001165All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012363|Ga0137390_11284298All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300012685|Ga0137397_10097013All Organisms → cellular organisms → Bacteria2157Open in IMG/M
3300012925|Ga0137419_10162425All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300012929|Ga0137404_11202638All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012944|Ga0137410_10218586Not Available1482Open in IMG/M
3300012957|Ga0164303_10686791All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300014150|Ga0134081_10370807All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium530Open in IMG/M
3300014154|Ga0134075_10379368All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300014157|Ga0134078_10092323All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1120Open in IMG/M
3300014157|Ga0134078_10615240All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300014324|Ga0075352_1038025All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300015245|Ga0137409_11146271All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300015264|Ga0137403_10786227Not Available808Open in IMG/M
3300015357|Ga0134072_10248850All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300015359|Ga0134085_10225052All Organisms → cellular organisms → Bacteria → Proteobacteria812Open in IMG/M
3300015359|Ga0134085_10315512All Organisms → cellular organisms → Bacteria → Proteobacteria689Open in IMG/M
3300017974|Ga0187777_10237525All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1234Open in IMG/M
3300018031|Ga0184634_10362861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium664Open in IMG/M
3300018064|Ga0187773_11126406All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300018075|Ga0184632_10094965All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300018076|Ga0184609_10127097All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1162Open in IMG/M
3300018077|Ga0184633_10129437All Organisms → cellular organisms → Bacteria → Proteobacteria1307Open in IMG/M
3300018431|Ga0066655_10410606All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300018431|Ga0066655_10996891All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300019279|Ga0184642_1057886All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria739Open in IMG/M
3300020006|Ga0193735_1157770All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria582Open in IMG/M
3300020018|Ga0193721_1136993All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria602Open in IMG/M
3300020109|Ga0194112_10044990All Organisms → cellular organisms → Bacteria4491Open in IMG/M
3300022563|Ga0212128_10082004All Organisms → cellular organisms → Bacteria2080Open in IMG/M
3300022563|Ga0212128_10097296All Organisms → cellular organisms → Bacteria1900Open in IMG/M
3300025157|Ga0209399_10144398All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300025905|Ga0207685_10387278All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300025922|Ga0207646_11149609All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300025923|Ga0207681_11657444All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria535Open in IMG/M
3300025932|Ga0207690_10735228All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300026018|Ga0208418_1017221All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300026075|Ga0207708_10823667All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium800Open in IMG/M
3300026075|Ga0207708_11483165All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium596Open in IMG/M
3300026301|Ga0209238_1225099All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300026306|Ga0209468_1196325All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300026330|Ga0209473_1105332All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300026469|Ga0257169_1077714All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M
3300026480|Ga0257177_1038016All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300026507|Ga0257165_1065083All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300026514|Ga0257168_1011208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1713Open in IMG/M
3300026535|Ga0256867_10103550All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300027273|Ga0209886_1069323All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300027277|Ga0209846_1026495All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria936Open in IMG/M
3300027324|Ga0209845_1040003All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300027646|Ga0209466_1119472Not Available535Open in IMG/M
3300027669|Ga0208981_1114276All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300027748|Ga0209689_1406599All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300027775|Ga0209177_10012669All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300027874|Ga0209465_10067499All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1730Open in IMG/M
3300027880|Ga0209481_10503445All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
3300027950|Ga0209885_1006836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1141Open in IMG/M
3300028792|Ga0307504_10340309All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300028814|Ga0307302_10313454All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria772Open in IMG/M
3300028878|Ga0307278_10274652All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300028889|Ga0247827_10233649All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300030006|Ga0299907_10032320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4068Open in IMG/M
3300031455|Ga0307505_10147405All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300031713|Ga0318496_10158756Not Available1236Open in IMG/M
3300031740|Ga0307468_100982968All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300031740|Ga0307468_102015438All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300031780|Ga0318508_1037007Not Available1257Open in IMG/M
3300031798|Ga0318523_10016939All Organisms → cellular organisms → Bacteria3097Open in IMG/M
3300031820|Ga0307473_10069292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1761Open in IMG/M
3300032180|Ga0307471_102840859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium615Open in IMG/M
3300032770|Ga0335085_10817007All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300033433|Ga0326726_10267699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1595Open in IMG/M
3300033500|Ga0326730_1100309All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.76%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.40%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.72%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs2.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.36%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.36%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.36%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.36%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.36%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.68%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026018Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027273Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027950Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_041033802170459002Grass SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIARMGERF
INPgaii200_112480212228664022SoilMGEIVFGGAMSHVLDPDYYQVACGDLGRQKVTEAMAAIARM
JGI10220J13317_1206459023300001139SoilMGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLS
Ga0066398_1006451723300004268Tropical Forest SoilMGKIVFAGAMSHVLDPEYYDHACGAVGRQKVEAAMTEIARMGERFSATR
Ga0062595_10199406423300004479SoilMGKLVFAGAMSHVLDPEYYDRACGALGRKTVTECMAQIAQMGERFSATG
Ga0066395_1024798613300004633Tropical Forest SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIAR
Ga0066674_1006447133300005166SoilMGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAMAAIAA
Ga0066680_1013233513300005174SoilMGKIVFAGAMSHVLDPDYYERACGAVGRQKVEAAMAEIARMGER
Ga0066685_1109429413300005180SoilMGKIVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQMGARL
Ga0070676_1026090623300005328Miscanthus RhizosphereMGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECMAQIAQMGERFSATGAD
Ga0066388_10078957023300005332Tropical Forest SoilMGKIVFAGAMSHVLDPEYYDHACGAVGRQKVEAAMTEIGRMGERFSA
Ga0066388_10090654423300005332Tropical Forest SoilMGEIVFAGAMSHVLDPQYYQEACGPSGRRKVEACMAEIRTMGATFLARRPDA
Ga0070669_10080184623300005353Switchgrass RhizosphereMGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECMTEIARMGE
Ga0070669_10202496113300005353Switchgrass RhizosphereMGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMTEIAR
Ga0070700_10035130433300005441Corn, Switchgrass And Miscanthus RhizosphereMGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLSA
Ga0070708_10085164223300005445Corn, Switchgrass And Miscanthus RhizosphereMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIAR
Ga0070707_10198679523300005468Corn, Switchgrass And Miscanthus RhizosphereMGKIVFAGAMSHVLDPEYYRAACGPVGRQKVEALMAEIRQMGGRLAGA
Ga0070697_10121139333300005536Corn, Switchgrass And Miscanthus RhizosphereMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIASMGDRFV
Ga0066692_1065689413300005555SoilMGKIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEIEKLGET
Ga0066698_1007614433300005558SoilMGKIVFAGAMSHVLDPDYYERACGAVGRQKVEAAMAEIA
Ga0066706_1060516433300005598SoilMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIANMGDRFVEKKADAL
Ga0066905_10065471823300005713Tropical Forest SoilMGRIVFAGAMSHVLDPDYYERACGADGRQKVLAAMAEIAKMGERCSAAKPD
Ga0066905_10111411523300005713Tropical Forest SoilMGRIVFAGAMSHVLDPDYYERVCGAVGRRKTEETMAAIAAMGER
Ga0066903_10568990013300005764Tropical Forest SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIA
Ga0068863_10069377513300005841Switchgrass RhizosphereMGEIVFGGAMSHVLDPDYYQAACGDLGRQKVVEAMDAI
Ga0068862_10151250813300005844Switchgrass RhizosphereMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIA
Ga0068862_10265166313300005844Switchgrass RhizosphereMGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECMAQ
Ga0075295_102154913300005879Rice Paddy SoilMGRIVFAGAMSHVLDPDYYERACGAVGRRTVETAMAEIAAMGARLSA
Ga0081455_1097423513300005937Tabebuia Heterophylla RhizosphereMGKIVFAGAMSHVLDPDYYQRACGDEGRQKTVACMAEIARMGERLSAARPDAL
Ga0081540_100356013300005983Tabebuia Heterophylla RhizosphereMGTIVFGGAMSHVLDPEYYQAACGDLGRRKVTEEMEA
Ga0066656_1076627723300006034SoilMGKIVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQMGARLAARS
Ga0075433_1053944523300006852Populus RhizosphereMGKLVFAGAMSHVLDPDYYDKACGALGRKTVTECMAQIAQMGERFSATGADA
Ga0075425_10089971023300006854Populus RhizosphereMGKLVFAGAMSHVLDPDYYDKACGALGRKTVTECMAQI
Ga0079217_1156699713300006876Agricultural SoilMGKIVFAGAMSHVLDPEYYQAACGDVGRQKVTAAMEAIAHMGDRFVEQKADALI
Ga0079215_1148012023300006894Agricultural SoilVFAAAMSHVLDPDYYEAACGAGGRRMVEACMTEIRAMGDRLSGWFPLL
Ga0079215_1155032113300006894Agricultural SoilMGRIVFAGAMSHVLDPEYYDHACGQIGRRMVEEVMA*
Ga0075426_1064401913300006903Populus RhizosphereMGKIVFAGAMSHVLDPEYYDRACGARGRRTVTECMAQIAQMGER
Ga0075426_1156236913300006903Populus RhizosphereMGKLVFAGAMSHVLDPDYYDKACGALGRKTVTECMAQIAQMGER
Ga0066710_10218722723300009012Grasslands SoilMGKIVFAGAMSHVLDPEYYQRVCGDVGRQKTEEAMAAIAK
Ga0066710_10380415723300009012Grasslands SoilMGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAM
Ga0099829_1112929233300009038Vadose Zone SoilMGEIVFGGAMSHVLDPDYYQAACGDVGRQKVTEAMEAIARMG
Ga0105106_1048507113300009078Freshwater SedimentMGRIVFAGAMSHVLDPDYYERACGALGRRMITDTMTAIAQMGARFSATKADA
Ga0099828_1093493923300009089Vadose Zone SoilMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIANMG
Ga0099828_1194757923300009089Vadose Zone SoilMGKIVFAGAMSHVLDPDYYERACGAVGRQTVEAVMAEIAKMG
Ga0099827_1010363033300009090Vadose Zone SoilMGKIVFAGAMSHVLDPDYYERACGAVGRRTVEAVMAEIAKMGERFSA
Ga0114129_1077571043300009147Populus RhizosphereMGRIVFAGAMSHVLDPDYYDRACGAQGRRMITETMA
Ga0105092_1086686913300009157Freshwater SedimentVGRIVFAGAMSHVLDPDYYQAAGGMSGRRMVEACMVEIRKLGDT
Ga0075423_1137667113300009162Populus RhizosphereMGRIVFAAAMSHVLDPDYYDRVCGAAGRRKTEEAMAAIA
Ga0105237_1223751113300009545Corn RhizosphereMGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLSARQPDARIV
Ga0105249_1122290323300009553Switchgrass RhizosphereMGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMTEIARMGERLTAARPDAL
Ga0126374_1000300563300009792Tropical Forest SoilMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRLVERKPDALIVV
Ga0105063_102129123300009804Groundwater SandMGQIVFAAAMSHVLDPDYYQAACGVAGRRMVEACMAEVRKLGD
Ga0105088_103655413300009810Groundwater SandVGQIVFAAAMSHVLDPDYYQAACGPAGRRTVEACMAEVRKLGDTFLRRRPDALI
Ga0126382_1128029113300010047Tropical Forest SoilMGTIVFGGAMSHVLDPEYYQAACGDLGRQMVTEAMEAIARMGDRFVARKPDAL
Ga0134084_1000608713300010322Grasslands SoilMGKIVFAAAMSHVLDPDYYQAACGLSGRRKVEACMAEIGKLGDTLLAHRP
Ga0134065_1002450613300010326Grasslands SoilMGKIVFAAAMSHVLDPDYYQAACGLSGRRKVEACMAEIEKL
Ga0134071_1021260913300010336Grasslands SoilMGRIVFAGAMSHVLDPDYYERACGSVGRQKVEAAMAEIARM
Ga0126376_1083262013300010359Tropical Forest SoilMGKIVFAGAMSHVLDPDYYDRACGALGRRTVSECMAQIAHMGERFS
Ga0126378_1097047733300010361Tropical Forest SoilMGTIVFGGAMSHVLDPEYYQAACGDLGRQMVTEAMEAIARMGDRFVERKPDALIVVA
Ga0126378_1214412113300010361Tropical Forest SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIARMGDRFV
Ga0126377_1130572733300010362Tropical Forest SoilMGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRFVERKPDALIVV
Ga0126379_1118242113300010366Tropical Forest SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIARMGDRFVERK
Ga0126381_10085477933300010376Tropical Forest SoilMGKIVFAGAMSHVLDPDYYQRACGALGRRTVEECMREIAAMG
Ga0126381_10376826923300010376Tropical Forest SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRQKVTACMTEIARMGERFTAT
Ga0126383_1300115413300010398Tropical Forest SoilMGRIVFASAMSHVLDPDYYDHACGAVGRRMVEEVMREIRAMGERC
Ga0126383_1348436123300010398Tropical Forest SoilMGQIVFGGAMSHVLDPEYYQAASGDLGRRKVTEAMEAIARMGDRFVERKP
Ga0134127_1355562413300010399Terrestrial SoilMGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECMAQIAQMGERF
Ga0134122_1250808813300010400Terrestrial SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRQKVTACM
Ga0137392_1104701913300011269Vadose Zone SoilMGKIVFAGAMSHVLDPDYYERACGAVGRQTVEAVMAEIAKMGERFS
Ga0137458_126120913300011436SoilMGRIVFAGAMSHVLDPEYYQRVCGDEGRKKTEEAMAAIAAMGERFSAT
Ga0137445_108667013300012035SoilMGQIVFAGAMSHVLNPDYYDRACGAAGRQKVTECM
Ga0137389_1096007013300012096Vadose Zone SoilMGKIVFAGAMSHVLDPDYYERACGAVGRQTVEAVMAEIAKMGE
Ga0137365_1098525423300012201Vadose Zone SoilMGKIVFAGAMSHVLDPDYYERACGAVGRRTVEAVMAEIAKMGERFSAKK
Ga0137362_1082988323300012205Vadose Zone SoilMGKIVFAGAMSHVLDPDYYERACGAFGRQTVEAVMAEI
Ga0137366_1100116523300012354Vadose Zone SoilMGRIVFGGAMSHVLDPDYYERACGSVGRQKVEAAMAE
Ga0137390_1128429813300012363Vadose Zone SoilMGRIVFAGAMSHVLDPEYYDRACGAVGRQTVEAVMA
Ga0137397_1009701313300012685Vadose Zone SoilMGKIIFAGAMSHVLDPDYYQRACGDEGRRKTVECMTEIARMGER
Ga0137419_1016242513300012925Vadose Zone SoilMAVKRSKETAMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIAN
Ga0137404_1120263823300012929Vadose Zone SoilMGKMVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQMGARLAARSPD
Ga0137410_1021858613300012944Vadose Zone SoilMGKIVFGGAMSHVLDPEYYQAACGDVGRQKVIEAMDAIAGMGDRLV
Ga0164303_1068679113300012957SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCITEIARMGE
Ga0134081_1037080723300014150Grasslands SoilMGKIVFAGAMSHVLDPEYYQRVCGDVGRQKTEEAMAAIAAMGERFSATKA
Ga0134075_1037936813300014154Grasslands SoilMGRIVFAGAMSHVLDPDYYERACGSVGRQKVEAAMAEIARMGERCSA
Ga0134078_1009232313300014157Grasslands SoilMGKIVFAAAMSHVLDPDYYQAACGLSGRRKVEACMAEIEKLGDSFLARRP
Ga0134078_1061524013300014157Grasslands SoilMGKIVFAGAMSHVLDPEYYDRACGAVGRQTVEAVMAEIARMGE
Ga0075352_103802543300014324Natural And Restored WetlandsMGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECMTEI
Ga0137409_1114627123300015245Vadose Zone SoilMGKIVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIA
Ga0137403_1078622723300015264Vadose Zone SoilMGKIVFAGAMSHVLDPEYYDRACGAVGRQTVEAVMAEIA
Ga0134072_1024885023300015357Grasslands SoilMGKIVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQ
Ga0134085_1022505223300015359Grasslands SoilMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIASMGDRFV*
Ga0134085_1031551213300015359Grasslands SoilMGRIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEI
Ga0187777_1023752523300017974Tropical PeatlandMGEIVFAGAMSHVLDPDYYERACGALGRRTVQECMAEIGRMGDRLTARRVDA
Ga0184634_1036286123300018031Groundwater SedimentMGKIVFGGAMSHVLDPEYYQAACGDVGRQKVMAAMDAIAKMGDRFV
Ga0187773_1112640623300018064Tropical PeatlandMGQIVFAGAMSHVLDPEYYERACGAAGRRAVEQCMA
Ga0184632_1009496533300018075Groundwater SedimentMGKIVFAGAMSHVLDPDYYQRACGDDGRKKVTACMAEIARMGERF
Ga0184609_1012709713300018076Groundwater SedimentMGKIVFAGAMSHVLDPDYYQRACGDDGRKKVTACMAEIA
Ga0184633_1012943713300018077Groundwater SedimentMGRLVFAGAMSHVLDPDYYDRACGALGRQKVVAAMAEIARM
Ga0066655_1041060613300018431Grasslands SoilMGKIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEIEKLGETFLAR
Ga0066655_1099689113300018431Grasslands SoilMGKIVFAGAMSHVLDPEYYQAACGDVGRQKVVAAMDAIASMGDRFVETKAEGLIVVA
Ga0184642_105788613300019279Groundwater SedimentMGRLVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIARMGER
Ga0193735_115777023300020006SoilMGQIVFAGAMSHVLDPDYYERACGAAGRQKVTECMA
Ga0193721_113699323300020018SoilMGRLVFAGAMSHVLDPDYYDRACGAVGRQKVVAAMAEIARM
Ga0194112_1004499063300020109Freshwater LakeMGTIVFAGAMSHVLDPDYYDRACGAIGRRMITETMAEIAQMGERLSSAK
Ga0212128_1008200413300022563Thermal SpringsMGRIVFAAAMSHVLDPDYYEAACGLSGRRKVEACMAEIRR
Ga0212128_1009729613300022563Thermal SpringsVGRLVFAGAMSHVLDPDYYDRACGAVGRQKVTDAMAAIA
Ga0209399_1014439833300025157Thermal SpringsVGRLVFAGAMSHVLDPDYYDRACGAVGRQKVTDAMAQ
Ga0207685_1038727813300025905Corn, Switchgrass And Miscanthus RhizosphereMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIARMGERFSATR
Ga0207646_1114960913300025922Corn, Switchgrass And Miscanthus RhizosphereMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIARMGERFS
Ga0207681_1165744413300025923Switchgrass RhizosphereMGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMTEIARMGERLTAARPDA
Ga0207690_1073522813300025932Corn RhizosphereMGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECM
Ga0208418_101722123300026018Natural And Restored WetlandsMGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECMT
Ga0207708_1082366723300026075Corn, Switchgrass And Miscanthus RhizosphereMGRIVFAGAMSHVLDPDYYDHACGPVGRRMVEEVMREIRAMGDR
Ga0207708_1148316513300026075Corn, Switchgrass And Miscanthus RhizosphereMGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLSARQPD
Ga0209238_122509913300026301Grasslands SoilMGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAMAAIAAMGERFSAIGAD
Ga0209468_119632523300026306SoilMGKIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEIEKLGETF
Ga0209473_110533213300026330SoilMGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAMVA
Ga0257169_107771423300026469SoilMGEIVFGGAMSHVLDPDYYQAACGDVGRQKVTEAMEAIAGMGDRFVERRPD
Ga0257177_103801623300026480SoilMGKIVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIARMGERFT
Ga0257165_106508323300026507SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRLMVTDCMTEIAR
Ga0257168_101120833300026514SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRLMVTDCMTEIARMGE
Ga0256867_1010355033300026535SoilMGKIVFAGAMSHVLDPDYYQRACGDDGRRKVTACMTEIARM
Ga0209886_106932323300027273Groundwater SandMGQIVFAAAMSHVLDPDYYQAACGLVGRRTVEACMAEVRKLGDTLLSRRPDALI
Ga0209846_102649523300027277Groundwater SandVGQIVFAAAMSHVLDPDYYQAACGLAGRRTVEACMAEVRK
Ga0209845_104000323300027324Groundwater SandMGKLVFAGAMSHVLDPDYYQRACGAEGRHKVTLCMSEIARMGERLQ
Ga0209466_111947213300027646Tropical Forest SoilMGKIVFAGAMSHVLDPEYYDHACGAVGRQKVEAAMVEIARMGERFSATKA
Ga0208981_111427613300027669Forest SoilMGKIVFAGAMSHVLDPEYYQAACGDVGRQKVVAAMDA
Ga0209689_140659923300027748SoilMGKIVFAAAMSHVLDPDHYQAACGLSGRRKVEACMAEIEKLG
Ga0209177_1001266933300027775Agricultural SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTECMTEIARMGE
Ga0209465_1006749913300027874Tropical Forest SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIARMGDRFVERKPD
Ga0209481_1050344523300027880Populus RhizosphereMGRIVFGGAMSHVLDPDYYDRACGALGRQSVLAAMAEIG
Ga0209885_100683613300027950Groundwater SandMGKLVFAGAMSHVLDPDYYDHACGAVGRRMVEEVMAEIRA
Ga0307504_1034030913300028792SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMAEIAR
Ga0307302_1031345423300028814SoilMGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMAEIARMGERLTAARPDAL
Ga0307278_1027465223300028878SoilMGKIVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIARMGERF
Ga0247827_1023364913300028889SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECM
Ga0299907_1003232063300030006SoilMGRIVFAGAMSHVLDADYYDQACGDLGRRSVLAAMAEIARMGE
Ga0307505_1014740533300031455SoilMGKIVFAGAMSHVLDPDYYQRACGDDGRRKTVECMTEIAR
Ga0318496_1015875613300031713SoilMGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAM
Ga0307468_10098296833300031740Hardwood Forest SoilMGEIVFGGAMSHVLDPDYYQAACGDLGRQKVVEAMDAIGKMGDRFVERKP
Ga0307468_10201543813300031740Hardwood Forest SoilMGRIVFAGAMSHVLDPDYYDRACGAVGRQTVVAVMAEIARMGE
Ga0318508_103700713300031780SoilMGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRLVERKPD
Ga0318523_1001693953300031798SoilMGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRLVERKPDALIV
Ga0307473_1006929213300031820Hardwood Forest SoilMGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCM
Ga0307471_10284085923300032180Hardwood Forest SoilMGRIVFAGAMSHVLDPDYYDHACGAVGRRMVEEVMAEIRVMGD
Ga0335085_1081700713300032770SoilMGRIVFAGAMSHVLDPDYYERACGAVGRQAVVACMTEIGRMGERLS
Ga0326726_1026769923300033433Peat SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRQKVIEAMDAIAGMGDRL
Ga0326730_110030913300033500Peat SoilMGKIVFGGAMSHVLDPEYYQAACGDLGRQKVIEAMDAIAGMGDRLVERKPDALIVV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.