Basic Information | |
---|---|
Family ID | F048810 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 41 residues |
Representative Sequence | MSTLLRTIEFLSLSLWLGSDVFLSFVVAPGAFRILGSRDQ |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 60.27 % |
% of genes near scaffold ends (potentially truncated) | 96.60 % |
% of genes from short scaffolds (< 2000 bps) | 84.35 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.830 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.809 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.531 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.503 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF07726 | AAA_3 | 36.05 |
PF01850 | PIN | 9.52 |
PF01882 | DUF58 | 3.40 |
PF03693 | ParD_antitoxin | 3.40 |
PF05168 | HEPN | 2.72 |
PF00072 | Response_reg | 1.36 |
PF05016 | ParE_toxin | 1.36 |
PF14255 | Cys_rich_CPXG | 1.36 |
PF12697 | Abhydrolase_6 | 1.36 |
PF10576 | EndIII_4Fe-2S | 1.36 |
PF00561 | Abhydrolase_1 | 0.68 |
PF04014 | MazE_antitoxin | 0.68 |
PF07730 | HisKA_3 | 0.68 |
PF07479 | NAD_Gly3P_dh_C | 0.68 |
PF11992 | TgpA_N | 0.68 |
PF12146 | Hydrolase_4 | 0.68 |
PF01694 | Rhomboid | 0.68 |
PF13559 | DUF4129 | 0.68 |
PF13545 | HTH_Crp_2 | 0.68 |
PF04055 | Radical_SAM | 0.68 |
PF00730 | HhH-GPD | 0.68 |
PF11304 | DUF3106 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 3.40 |
COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 3.40 |
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 2.72 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 2.72 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.68 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.68 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.68 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.68 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.68 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.68 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.68 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.68 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.68 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.83 % |
Unclassified | root | N/A | 25.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001084|JGI12648J13191_1010399 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300001159|JGI12650J13346_1004903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 629 | Open in IMG/M |
3300002909|JGI25388J43891_1000773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6411 | Open in IMG/M |
3300002917|JGI25616J43925_10163446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
3300002917|JGI25616J43925_10184092 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300004631|Ga0058899_12205185 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300005332|Ga0066388_102663919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300005553|Ga0066695_10043788 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
3300005554|Ga0066661_10245078 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300005602|Ga0070762_10813567 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300006034|Ga0066656_10443997 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300006041|Ga0075023_100548767 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006871|Ga0075434_100946978 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300007265|Ga0099794_10351689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300009038|Ga0099829_10143901 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
3300009088|Ga0099830_10491930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
3300009088|Ga0099830_11557693 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300009521|Ga0116222_1065598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1571 | Open in IMG/M |
3300009552|Ga0116138_1033611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
3300009672|Ga0116215_1475180 | Not Available | 540 | Open in IMG/M |
3300010046|Ga0126384_10663471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
3300010048|Ga0126373_11241420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300010048|Ga0126373_13300128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300010301|Ga0134070_10404712 | Not Available | 538 | Open in IMG/M |
3300010333|Ga0134080_10626179 | Not Available | 526 | Open in IMG/M |
3300010337|Ga0134062_10096473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1264 | Open in IMG/M |
3300010366|Ga0126379_11616424 | Not Available | 753 | Open in IMG/M |
3300011270|Ga0137391_10647252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300012096|Ga0137389_10071295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2688 | Open in IMG/M |
3300012189|Ga0137388_10995314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300012189|Ga0137388_12038891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300012203|Ga0137399_10963079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300012205|Ga0137362_11515698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300012349|Ga0137387_10007417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6249 | Open in IMG/M |
3300012349|Ga0137387_10983378 | Not Available | 606 | Open in IMG/M |
3300012351|Ga0137386_10992095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300012361|Ga0137360_10680187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
3300012362|Ga0137361_11365966 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012362|Ga0137361_11509545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300012685|Ga0137397_10246174 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300012685|Ga0137397_11351741 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012923|Ga0137359_10965502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300012925|Ga0137419_10474259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300012925|Ga0137419_10659121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300012927|Ga0137416_10599069 | Not Available | 960 | Open in IMG/M |
3300012927|Ga0137416_11766353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300012930|Ga0137407_11005638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300012944|Ga0137410_10168881 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300012948|Ga0126375_11945441 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300012986|Ga0164304_10719728 | Not Available | 761 | Open in IMG/M |
3300014168|Ga0181534_10237167 | Not Available | 964 | Open in IMG/M |
3300015054|Ga0137420_1393188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
3300015241|Ga0137418_10195811 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
3300015241|Ga0137418_10640081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300015264|Ga0137403_10286093 | Not Available | 1547 | Open in IMG/M |
3300015356|Ga0134073_10353842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300015358|Ga0134089_10347462 | Not Available | 624 | Open in IMG/M |
3300016357|Ga0182032_10052778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2647 | Open in IMG/M |
3300016357|Ga0182032_10134739 | Not Available | 1804 | Open in IMG/M |
3300017940|Ga0187853_10188894 | Not Available | 970 | Open in IMG/M |
3300017955|Ga0187817_10452678 | Not Available | 819 | Open in IMG/M |
3300017970|Ga0187783_10038200 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
3300018019|Ga0187874_10054439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1844 | Open in IMG/M |
3300018085|Ga0187772_10980309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 617 | Open in IMG/M |
3300018086|Ga0187769_11420227 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 525 | Open in IMG/M |
3300019268|Ga0181514_1165460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300020021|Ga0193726_1181443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
3300020140|Ga0179590_1058952 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300020579|Ga0210407_10215582 | Not Available | 1493 | Open in IMG/M |
3300020580|Ga0210403_10429680 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300020580|Ga0210403_10811097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300020582|Ga0210395_10069787 | All Organisms → cellular organisms → Bacteria | 2583 | Open in IMG/M |
3300020582|Ga0210395_10922900 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300020583|Ga0210401_10742093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
3300021088|Ga0210404_10365135 | Not Available | 803 | Open in IMG/M |
3300021168|Ga0210406_10447630 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300021170|Ga0210400_10022296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4934 | Open in IMG/M |
3300021170|Ga0210400_10089850 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
3300021180|Ga0210396_10992827 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300021180|Ga0210396_11069980 | Not Available | 680 | Open in IMG/M |
3300021180|Ga0210396_11085504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300021404|Ga0210389_10000819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26281 | Open in IMG/M |
3300021404|Ga0210389_10343602 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300021406|Ga0210386_11773661 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300021420|Ga0210394_10032022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4717 | Open in IMG/M |
3300021477|Ga0210398_10029506 | All Organisms → cellular organisms → Bacteria | 4599 | Open in IMG/M |
3300021478|Ga0210402_11857135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300021479|Ga0210410_10228794 | Not Available | 1666 | Open in IMG/M |
3300021479|Ga0210410_10599947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
3300021559|Ga0210409_10861831 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300021560|Ga0126371_10941521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
3300022510|Ga0242652_1031412 | Not Available | 613 | Open in IMG/M |
3300022533|Ga0242662_10210698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300022717|Ga0242661_1166374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300022724|Ga0242665_10370813 | Not Available | 517 | Open in IMG/M |
3300022873|Ga0224550_1039358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300024275|Ga0247674_1023612 | Not Available | 715 | Open in IMG/M |
3300024283|Ga0247670_1023229 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300024330|Ga0137417_1040669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2094 | Open in IMG/M |
3300025472|Ga0208692_1107416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300025916|Ga0207663_10018890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3872 | Open in IMG/M |
3300025918|Ga0207662_10399431 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300026078|Ga0207702_11740554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300026310|Ga0209239_1039175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2195 | Open in IMG/M |
3300026330|Ga0209473_1209187 | Not Available | 731 | Open in IMG/M |
3300026334|Ga0209377_1055932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1744 | Open in IMG/M |
3300026469|Ga0257169_1066238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300026555|Ga0179593_1186550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2699 | Open in IMG/M |
3300026862|Ga0207724_1018999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300026909|Ga0207858_1009951 | Not Available | 944 | Open in IMG/M |
3300027548|Ga0209523_1130340 | Not Available | 518 | Open in IMG/M |
3300027565|Ga0209219_1060735 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300027616|Ga0209106_1154734 | Not Available | 510 | Open in IMG/M |
3300027662|Ga0208565_1082346 | Not Available | 986 | Open in IMG/M |
3300027663|Ga0208990_1015909 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
3300027846|Ga0209180_10496279 | Not Available | 684 | Open in IMG/M |
3300027846|Ga0209180_10674999 | Not Available | 564 | Open in IMG/M |
3300027854|Ga0209517_10195413 | Not Available | 1253 | Open in IMG/M |
3300027855|Ga0209693_10106033 | Not Available | 1391 | Open in IMG/M |
3300027884|Ga0209275_10454623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300027884|Ga0209275_10543236 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300027903|Ga0209488_10433777 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300027908|Ga0209006_11260364 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300028906|Ga0308309_10001422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14302 | Open in IMG/M |
3300028906|Ga0308309_11849042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300031128|Ga0170823_11137547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300031231|Ga0170824_109057254 | Not Available | 1577 | Open in IMG/M |
3300031474|Ga0170818_101881725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300031545|Ga0318541_10183841 | Not Available | 1154 | Open in IMG/M |
3300031708|Ga0310686_106888167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2105 | Open in IMG/M |
3300031718|Ga0307474_11188560 | Not Available | 603 | Open in IMG/M |
3300031744|Ga0306918_11123053 | Not Available | 608 | Open in IMG/M |
3300031744|Ga0306918_11468923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300031754|Ga0307475_10501838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
3300031754|Ga0307475_10777258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
3300031754|Ga0307475_10999637 | Not Available | 657 | Open in IMG/M |
3300031833|Ga0310917_10066491 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
3300031879|Ga0306919_10537229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 902 | Open in IMG/M |
3300031897|Ga0318520_10747744 | Not Available | 612 | Open in IMG/M |
3300031910|Ga0306923_10846531 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300031942|Ga0310916_11286308 | Not Available | 602 | Open in IMG/M |
3300031954|Ga0306926_10000678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 32302 | Open in IMG/M |
3300032076|Ga0306924_10020981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6937 | Open in IMG/M |
3300032261|Ga0306920_100710936 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300032829|Ga0335070_11893204 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300033977|Ga0314861_0344998 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.40% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.04% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.04% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.04% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.04% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.36% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.68% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12648J13191_10103991 | 3300001084 | Forest Soil | MATFLRTVEFLALSLWLGSDVFLSFVVAPGAFRVLAG |
JGI12650J13346_10049032 | 3300001159 | Forest Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGSRDAAGMMVGFALARLH |
JGI25388J43891_10007736 | 3300002909 | Grasslands Soil | MATFLRAIEFLGLSLWLGSDVFLSFVVAPGAFRILSSRDQAG |
JGI25616J43925_101634463 | 3300002917 | Grasslands Soil | MSTMLRTVEFLGLSLWLGSDVFLSFVVAPGAFSLLGSRDQA |
JGI25616J43925_101840922 | 3300002917 | Grasslands Soil | LVTTLFRTIEFLSLSLWLGADAFLSFVVAPGAFTILGNRDAAGM |
Ga0058899_122051851 | 3300004631 | Forest Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMV |
Ga0066388_1026639191 | 3300005332 | Tropical Forest Soil | MQTLPRTLEFLCLSLWLGADTFLSFVVAPGAFAIFGNRDAAGMMVG |
Ga0066695_100437884 | 3300005553 | Soil | LYSAPMASLLRTIEFLGLGLWLGSDVFLSFVVAPGAFRILA |
Ga0066661_102450783 | 3300005554 | Soil | MMNFLRTLEFLGLSLWLGSDVFLSFVVARGAFRILASR |
Ga0070762_108135673 | 3300005602 | Soil | MQTILRTIEVLTLSLWLGADVFLSFVVAPGAFAILG |
Ga0066656_104439973 | 3300006034 | Soil | MMNLLRTLEFLGLSVWVGSDAFLSLVMAPGAFRILA |
Ga0075023_1005487673 | 3300006041 | Watersheds | MSTALRTIEFLCLGVWLGGICLLSFVIAPGAFTILPTRDIAGTFVG |
Ga0075434_1009469783 | 3300006871 | Populus Rhizosphere | MTILRTLEYLALSIWVGSDVFLSFIVAPGAFSVIASRDQA |
Ga0099794_103516891 | 3300007265 | Vadose Zone Soil | MSTLLRTIEFLGLSLWLGSDVFLSFVVAPGAFRILASRDQ |
Ga0099829_101439011 | 3300009038 | Vadose Zone Soil | MSTVLRSIEFLCLGLWLGSDVFLSFVVAPGAFRVL |
Ga0099830_104919301 | 3300009088 | Vadose Zone Soil | MSTVLRSIEFLCLGLWLGSDVFLSFVVAPGAFRVLG |
Ga0099830_115576931 | 3300009088 | Vadose Zone Soil | MSTLLRTIEFLCLGLWLGSDVFLSFVVAPGAFRVLGSR |
Ga0116222_10655983 | 3300009521 | Peatlands Soil | MQALLRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAG |
Ga0116138_10336111 | 3300009552 | Peatland | MSIFLRTVEFLGLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMVGFSLAR |
Ga0116215_14751803 | 3300009672 | Peatlands Soil | MSTALRTIEFLCLGVWLGGICLLSFVIAPGAFGILQSRDVAGEFVGYALGRLHLIG |
Ga0126384_106634714 | 3300010046 | Tropical Forest Soil | MISILRTFEFLALSVWLGSDVFLSFVVAPGAFHILPNRDQA |
Ga0126373_107488443 | 3300010048 | Tropical Forest Soil | MATLLRTIEFLGIALWLGSDIFVSLILAPGAFRLLASRDQAGAMVGFSL |
Ga0126373_112414201 | 3300010048 | Tropical Forest Soil | MNILRTLEFLALSIWLGSDAFLSFIVAPGAFLVMASRDQAGAMVGYSL |
Ga0126373_133001281 | 3300010048 | Tropical Forest Soil | MTTLFRTIEFLSLSLWLGGDAFLSFVVAPGAFAILGSRDAAGMMVGYALTRLHFA |
Ga0134070_104047123 | 3300010301 | Grasslands Soil | MSTLLRTIEFLGLSVWLGSDVFLSFVVAPGAFRILGS |
Ga0134080_106261791 | 3300010333 | Grasslands Soil | MSTLLRTIEFLSLSLWLGSDVFLSFVVAPGAFRILGSRDQ |
Ga0134062_100964731 | 3300010337 | Grasslands Soil | MSTFLRVIEFLGLSLWLGSDVFLSFVVAPGAFRILASRDQA |
Ga0126379_116164243 | 3300010366 | Tropical Forest Soil | MSTVLRALEFLGLSIWLGSDIFLSFIVAPGAFSVLASRDQAG |
Ga0137391_106472523 | 3300011270 | Vadose Zone Soil | MSTLLRTIEFLCLGLWLGSDVFLSFVVAPGAFRVLGGRD |
Ga0137389_100712951 | 3300012096 | Vadose Zone Soil | MSTFLRTIEFLCLGLWLGSDVFLSFVVAPGAFRVLG |
Ga0137388_109953141 | 3300012189 | Vadose Zone Soil | MSTLLRTVEFLGLSLWLGSDVFLSFVVAPGAFSILASRDQAG |
Ga0137388_120388911 | 3300012189 | Vadose Zone Soil | MSVFLRAIEFLGLSIWLGGDVFLSFVVAPGAFSVLASRDQAG |
Ga0137399_109630792 | 3300012203 | Vadose Zone Soil | MSIFLRAIEFLGLGIWLGSDIFLSFVVAPGAFSVLAS |
Ga0137362_115156982 | 3300012205 | Vadose Zone Soil | MAFMSGTIEFLCLGLWLGSDVFLSFVVAPWAFRVLGSR |
Ga0137387_100074171 | 3300012349 | Vadose Zone Soil | MLTVLRAFEFLGLSIWLGSDIFLSFVVAPGAFSVLASRDQ |
Ga0137387_109833783 | 3300012349 | Vadose Zone Soil | MSNIFRALEFLGLSVWLGSDIFLSFVVAPGAFRILASRDQAG |
Ga0137386_109920951 | 3300012351 | Vadose Zone Soil | MMSFLRTLEFLGLSLWLGSDVFLSFVVAPGAFWILTSRDQ |
Ga0137360_106801871 | 3300012361 | Vadose Zone Soil | MSTLLRTVEFLTLSLWLGSDVFLSFVVAPGAFRVL |
Ga0137361_113659661 | 3300012362 | Vadose Zone Soil | MSILLRTIEFLGLGYWLGSDGFLSFVVAPGAFSVL |
Ga0137361_115095453 | 3300012362 | Vadose Zone Soil | MSIVLRTLEFLSLSLWLGSDVFLSFVVAPGAFSVLASRDQ |
Ga0137397_102461744 | 3300012685 | Vadose Zone Soil | LVTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFTILGNRDAAGMMVGYSLARLH |
Ga0137397_113517412 | 3300012685 | Vadose Zone Soil | MSILLRTIEYLGLGYWLGSDGFLSFVVAPGAFSVLASR |
Ga0137359_109655022 | 3300012923 | Vadose Zone Soil | MSTFLRSIEFLCLGLWLGSDVFLSFVVAPGAFRVLGSRD |
Ga0137419_104742591 | 3300012925 | Vadose Zone Soil | MSTVLRTIEFLCLGLWVGSDVFLSFVVAPGAFRIL |
Ga0137419_106591211 | 3300012925 | Vadose Zone Soil | MSTLLRTVEFLCLGLWLGSDVFLSFVVAPGAFRILGS |
Ga0137416_105990691 | 3300012927 | Vadose Zone Soil | MSTVLRTIEFLCLGLWVGSDVFLSFVVAPGAFRILGSRGMLLELW |
Ga0137416_117663532 | 3300012927 | Vadose Zone Soil | MASLLRTIEFLGLSLWLGSDVFLSFVLAPGAFRILAS |
Ga0137407_110056383 | 3300012930 | Vadose Zone Soil | MTILLQTIEFLGLSLWLGSDVFLSFVVAPGAFRILASRDQAG |
Ga0137410_101688811 | 3300012944 | Vadose Zone Soil | MTILLQSIEFLGLSLWLGSDVFLSFVVAPGAFRIL |
Ga0126375_119454413 | 3300012948 | Tropical Forest Soil | MNNIFRALEFLGLSVWLGSDIFLSFVVAPGAFRVLAPNR |
Ga0164304_107197281 | 3300012986 | Soil | MSTLLRTIEFLGLSLWLGSDVFLSFVVAPGAFRIL |
Ga0181534_102371673 | 3300014168 | Bog | MQAFLRTIEFLSLGLWLGADAFLSFVVAPGAFTILNNRDSAG |
Ga0137420_13931881 | 3300015054 | Vadose Zone Soil | MSTLLRTIEFLGLSLWLGSDVFLSFVVAPGAFRILASR |
Ga0137418_101958113 | 3300015241 | Vadose Zone Soil | MQSLLRTIEFLGLSLWLGSDVFLSFVVAPGAFRILANRDQ |
Ga0137418_106400811 | 3300015241 | Vadose Zone Soil | MSTLLRTVEFLCLGLWLGSDVFLSFVVAPGAFRVLG |
Ga0137403_102860934 | 3300015264 | Vadose Zone Soil | MTHLFRSIEFLSLGLWLGADAFLSFVVAPGAFAILGNRDAAGMM |
Ga0134073_103538423 | 3300015356 | Grasslands Soil | MASLLRTIEFLGLSLWLGSDVFLSFVVAPGAFRILA |
Ga0134089_103474621 | 3300015358 | Grasslands Soil | MSTFLRTIEFLGLSVWLGSDVFLSFVVAPGAFRIL |
Ga0182032_100527784 | 3300016357 | Soil | MILRTFEFLCLSLWLGADVFLSFVVAPGAFGILGSRD |
Ga0182032_101347393 | 3300016357 | Soil | MSTLLRTIEFLSLGLWLAGIAFLSFVVTPGAFAILGAAMRQG |
Ga0187853_101888943 | 3300017940 | Peatland | MQTILRSIEFLCLSLWLGADAFLSFVVAPGAFAIL |
Ga0187817_104526781 | 3300017955 | Freshwater Sediment | MQTILRSVEFLCVSLWLGADALLSFVVAPGAFAILGSREAAG |
Ga0187783_100382001 | 3300017970 | Tropical Peatland | MSTVLRAIEFLTVGLWLGADVFLSFVVAPGAFSILGN |
Ga0187874_100544391 | 3300018019 | Peatland | MQTILRSIEFLCLSLWLGADAFLSFVVAQGAFAILGSRDTAG |
Ga0187772_109803092 | 3300018085 | Tropical Peatland | LFAGASEMSSVFRFVEFLSLSLWLGADAFLSFVVAPGAFAILGSR |
Ga0187769_114202271 | 3300018086 | Tropical Peatland | VTTILRTVEFLGLSLWLGSDVFLSFVVAPGAFSVLASRD |
Ga0181514_11654601 | 3300019268 | Peatland | MIFIARTFEFLCLSLWLGSDVFLSFVVAPGAFRILGN |
Ga0193726_11814432 | 3300020021 | Soil | MSNFLRTVEFLCVGLWLGSDAFLSFVVAPGAFSVLARRD |
Ga0179590_10589521 | 3300020140 | Vadose Zone Soil | VTTLFRTIEFLSLSLWLGADAFLSFVVAPGAFTILGNRD |
Ga0210407_102155821 | 3300020579 | Soil | MLRTVEFLCLGLWLGADVFLSFVVAPGAFRILGSR |
Ga0210403_104296801 | 3300020580 | Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNR |
Ga0210403_108110973 | 3300020580 | Soil | MVSILRTIEFLGLSLWLGSDVFLSFVVAPGAFRILAS |
Ga0210395_100697871 | 3300020582 | Soil | MAGGESFVTTFFRTIEFLSLGLWLGADAFLSFVVAPGA |
Ga0210395_109229001 | 3300020582 | Soil | MQTLLRAIEFLSLSLWLGGDAFLSFVVAPGAFSILGNRDAAGMMVGYALGRL |
Ga0210401_107420931 | 3300020583 | Soil | VTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFTILGNRDAAGMMVG |
Ga0210404_103651353 | 3300021088 | Soil | MSTLLRTIEFLGLSLWLGSDVFLSFVMAPGAFRILA |
Ga0210406_104476303 | 3300021168 | Soil | VTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGN |
Ga0210400_100222961 | 3300021170 | Soil | MSSFLRTIEFLGLSLWLGSDVFLSFVVAPGAFRILASR |
Ga0210400_100898506 | 3300021170 | Soil | MTILLQAIEFLGLSLWLGSDVFLSFVMAPGAFRILASRDQAGT |
Ga0210396_109928271 | 3300021180 | Soil | VTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFTILG |
Ga0210396_110699801 | 3300021180 | Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGDRDAAGMM |
Ga0210396_110855041 | 3300021180 | Soil | VTTLFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGSRDAAGMMVGFALGRLH |
Ga0210389_1000081923 | 3300021404 | Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMVGFALGRLHF |
Ga0210389_103436024 | 3300021404 | Soil | VTTFFRTIEFLSLGLWLGADAFLSFVVAPGAFAILGNRDAAAMMVGFA |
Ga0210386_117736612 | 3300021406 | Soil | VTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILG |
Ga0210394_100320221 | 3300021420 | Soil | MAGGESFVTTFFRTIEFLSLGLWLGADAFLSFVVAPGAFAMLGNRD |
Ga0210398_100295061 | 3300021477 | Soil | MQTFLRGIEFLSLGLWLGGDVFLSFVVAPGAFSILGNR |
Ga0210402_118571351 | 3300021478 | Soil | MSTVLRSIEFLGLGLWLGSDIFLSFVVAPGAFRILASRD |
Ga0210410_102287941 | 3300021479 | Soil | VTTFFRKIEFLSLSLWLGADAFLSFVVAPGAFTILGNRDAAGMMVGFALARLHFA |
Ga0210410_105999473 | 3300021479 | Soil | MSSLLRTIEFLGLSLWLGSDAFMSLILAPGAFRILASRDQA |
Ga0210409_108618313 | 3300021559 | Soil | VTTFFRTIEFLSLGLWLGADAFLSFVVAPGAFAILGNRDAAAMMVGFALG |
Ga0126371_109415211 | 3300021560 | Tropical Forest Soil | MTSILRTIEFLALGVWLGSDVFLSFVVAPGAFGLLQSRDAAGAMV |
Ga0242652_10314121 | 3300022510 | Soil | MTTFFRTIEFLSLSLWLGSVAFLSFVVAPGAFAILGNRDAAGMM |
Ga0242662_102106981 | 3300022533 | Soil | MTSILRTIEFLALSLWLGSDVFLSFVVAPGAFRVLAPNRDQ |
Ga0242661_11663741 | 3300022717 | Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMVSFALARLHF |
Ga0242665_103708133 | 3300022724 | Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDA |
Ga0224550_10393581 | 3300022873 | Soil | MSIFLRTVEFLALSLWLGSDVFLSFVVAPGAFRVLAGRDQA |
Ga0247674_10236123 | 3300024275 | Soil | MSNIFRALEFLGLSVWLGSDIFLSFVVAPGAFRVLAPNR |
Ga0247670_10232293 | 3300024283 | Soil | MVTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMVGYSLA |
Ga0137417_10406691 | 3300024330 | Vadose Zone Soil | MTTFLRTIEFLSLSLWLGADAFLSFVVAPGAFTILGNRDAAGMMV |
Ga0208692_11074162 | 3300025472 | Peatland | MSIFLRTVEFLGLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMVGFS |
Ga0207663_100188901 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTLLRAIEFLSLSLWLGGDVFLSFVVAPGAFSILGNRDAAG |
Ga0207662_103994314 | 3300025918 | Switchgrass Rhizosphere | MSTFLRTVEFLALSLWLGSDVFLSFVVAPGAFRILA |
Ga0207702_117405542 | 3300026078 | Corn Rhizosphere | MSTFLRTVEFLALSLWLGSDVFLSFVVAPGAFRILASR |
Ga0209239_10391751 | 3300026310 | Grasslands Soil | MATFLRAIEFLGLSLWLGSDVFLSFVVAPGAFRILSSR |
Ga0209473_12091873 | 3300026330 | Soil | MATFLRAIEFLGLSLWLGSDVFLSFVVAPGAFRIL |
Ga0209377_10559323 | 3300026334 | Soil | MLTVLRAFEFLGLSIWLGSDIFLSFVVAPGAFSVLASRD |
Ga0257169_10662382 | 3300026469 | Soil | MSIFLRAIEFLGLGIWLGSDIFLSFVVAPGAFSVLASRD |
Ga0179593_11865505 | 3300026555 | Vadose Zone Soil | MSNIFRALEFLGLSVWLGSDIFLSFVVAPGAFRVLAPNRDQPEQWWGLR |
Ga0207724_10189992 | 3300026862 | Tropical Forest Soil | MSTILRTVEFLCLSLWLGADVFLSFVVAPGAFGILGSRDAAGM |
Ga0207858_10099513 | 3300026909 | Tropical Forest Soil | MSTMLRTVEFLCLSLWLGADVFLSFVVAPGAFGILGSRDAAGMMVGYVLTR |
Ga0209523_11303401 | 3300027548 | Forest Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGSRDVAGM |
Ga0209219_10607351 | 3300027565 | Forest Soil | MTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGSRDAAGMMVGFA |
Ga0209106_11547341 | 3300027616 | Forest Soil | MSTFLRTIEFLCLGLWLGSDVFLSFVVAPGAFRVLGSRD |
Ga0208565_10823461 | 3300027662 | Peatlands Soil | MQAFLRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAA |
Ga0208990_10159091 | 3300027663 | Forest Soil | VTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFTILGNRDAAGMMVGYSLARLH |
Ga0209180_104962793 | 3300027846 | Vadose Zone Soil | MSNFLRTVEFLCLGLWLGADVFLSFVVAPGAFAVLGNRD |
Ga0209180_106749993 | 3300027846 | Vadose Zone Soil | LSTILRTIEFLCLSLWVGGIVFLSFVVAPGAFSILPGRDIA |
Ga0209517_101954133 | 3300027854 | Peatlands Soil | MQAFLRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAG |
Ga0209693_101060334 | 3300027855 | Soil | MALPAAPFTMTSILRTVEFLALSVWLGSDVFLSFVVAPGAFRVLAPNRDQ |
Ga0209275_104546231 | 3300027884 | Soil | MANVLRTVEFLALSLWLGSDVFLSFVLAPGAFRILASRDQA |
Ga0209275_105432361 | 3300027884 | Soil | MQTILRTIEVLTLSLWLGADVFLSFVVAPGAFAILGNRDAAGMMVGF |
Ga0209488_104337771 | 3300027903 | Vadose Zone Soil | MSTVLRTIEFLCLGLWVGSDVFLSFVVAPGAFRILG |
Ga0209006_112603641 | 3300027908 | Forest Soil | MQDLLRTIEFLGLSLWLGSDVFLSFVVAPGAFRILGS |
Ga0308309_100014221 | 3300028906 | Soil | MTIFSRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAGMMVGF |
Ga0308309_118490421 | 3300028906 | Soil | MANFLRTVEFLCLSLWLGSDVFLSFVVAPGAFRVLA |
Ga0170823_111375473 | 3300031128 | Forest Soil | MTNFLRTLEFLTLGLWLGSDVFLSFVVAPGAFHVLATRD |
Ga0170824_1090572541 | 3300031231 | Forest Soil | VTTFFRTIEFLSLSLWLGADAFLSFVVAPGAFAILGNRDAAGMV |
Ga0170818_1018817253 | 3300031474 | Forest Soil | MIVVLRTLEFLGLSIWLGSDVFLSFVVAPGAFSVLA |
Ga0318541_101838413 | 3300031545 | Soil | MSTLLRTIEFLSLGLWLAGIAFLSFVVTPGAFAILGAAMRRG |
Ga0310686_1068881671 | 3300031708 | Soil | MSTALRTIEFLCLGVWLGGICLLSFVIAPGAFGILQSR |
Ga0307474_111885603 | 3300031718 | Hardwood Forest Soil | MSTVFRAIEFLGLSIWLGSDVFLSFVVAPGAFSVLASRDQ |
Ga0306918_111230533 | 3300031744 | Soil | MSTILRTIEFLCLSLWLGADVFLSLVVAPGAFGILGSRDAAGMMVGYVLA |
Ga0306918_114689233 | 3300031744 | Soil | MSTILRAVEFLCLSLWLGADVFLSFVVAPGAFGILGSRDAAGMMVGYALARLHF |
Ga0307475_105018383 | 3300031754 | Hardwood Forest Soil | MSTLLRTVEFLCLSLWLGSDVFLSFVVAPGAFSILA |
Ga0307475_107772582 | 3300031754 | Hardwood Forest Soil | MSTILRTIEFLALGLWLGSDVFLSFVVAPGAFRILASR |
Ga0307475_109996371 | 3300031754 | Hardwood Forest Soil | MSTVLRTIEFLGLSLWLGSDVFLSFVVAPGAFSLLGS |
Ga0310917_100664911 | 3300031833 | Soil | IEFLSLGLWLAGIAFLSFVVAPGAFAILGAAMRRG |
Ga0306919_105372291 | 3300031879 | Soil | MQTLLRTVEFLALGLWLGGDAFLSLVVAPGAFTLLGNRDAAGMMVG |
Ga0318520_107477441 | 3300031897 | Soil | MSTLLRTIEFLSLGLWLAGIALLSFVVTPGAFAIQGAARR |
Ga0306923_108465313 | 3300031910 | Soil | MSTILRTIEFLCLSLWLGADVFLSLVVAPGAFGILGSRDAAGMMVGYVLARLHF |
Ga0310916_112863081 | 3300031942 | Soil | MHTFLRGVEFLSVSLWLGADAFLSFVVAPGAFLLLGNRDAAGMLVG |
Ga0306926_100006784 | 3300031954 | Soil | MSTLLRTIEFLSLGLWLAGIAFLSFVVAPGAFAILGAAMRRG |
Ga0306924_100209811 | 3300032076 | Soil | MSTILRAVEFLCLSLWLGADVFLSFVVAPGAFGILGSRDAAGMMV |
Ga0306920_1007109362 | 3300032261 | Soil | MSTFLRATEFLCLSLWLGSDAFLSFVVAPGAFRILSNRN |
Ga0335070_118932041 | 3300032829 | Soil | MQTTLRFIEFLSLSLWLGADAFLSFVVAPGAFAILG |
Ga0314861_0344998_540_662 | 3300033977 | Peatland | MNLTLRFIEFLSLSLWLGADAFLSFVVAPGAFSILGSRDAA |
⦗Top⦘ |