 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F048802 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MMRKKRSDRNHVLYRVECVDTGDSYIGLTVAQGQAFLRSVKVR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 52.05 % |
| % of genes near scaffold ends (potentially truncated) | 98.64 % |
| % of genes from short scaffolds (< 2000 bps) | 96.60 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.912 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.531 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.830 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.35% Coil/Unstructured: 74.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF14235 | DUF4337 | 4.76 |
| PF14236 | DUF4338 | 1.36 |
| PF03401 | TctC | 0.68 |
| PF14328 | DUF4385 | 0.68 |
| PF07460 | NUMOD3 | 0.68 |
| PF13392 | HNH_3 | 0.68 |
| PF10765 | Phage_P22_NinX | 0.68 |
| PF09414 | RNA_ligase | 0.68 |
| PF11351 | GTA_holin_3TM | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.91 % |
| All Organisms | root | All Organisms | 21.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.84% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.08% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.40% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.72% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 2.04% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.36% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.36% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.36% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.36% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.68% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.68% |
| Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003650 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020568 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100571773 | 3300000756 | Freshwater And Sediment | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYTRSVKVRWQKHVS |
| RCM31_102523173 | 3300001851 | Marine Plankton | MRKKRSDRNHVLYRVICQDTGDSYVGLTVAQGQAFVRSVKVR* |
| JGI25908J49247_100847191 | 3300003277 | Freshwater Lake | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRSVKIRWQKHVS |
| JGI25908J49247_101614922 | 3300003277 | Freshwater Lake | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRSVKIRWQKHVSR |
| JGI25911J50253_100568804 | 3300003411 | Freshwater Lake | MKRKLRSDRNHVLYRVECIDTGDSYIGVTVAQGAAFLRSV |
| SLW30_1082883 | 3300003650 | Subglacial Freshwater | MRKLRQDRNHVIYLITADTGDTYIGLTVALGQAFLKSVKVRVQKHF |
| Ga0066178_102455221 | 3300004124 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQTYIGLTVAIGQAYLRSVKVRVQK |
| Ga0066223_11348311 | 3300004461 | Marine | MRKKRSDRNHVIYAVTAEGQKYIGLTVANGQAYLRSVKVRVQKHISRALK |
| Ga0068876_106941833 | 3300005527 | Freshwater Lake | MRKKRNDRNYVLYRVTADGQEYIGLTVAIGRAFLRSVKVRLQKHQ |
| Ga0049081_100967893 | 3300005581 | Freshwater Lentic | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVR |
| Ga0049081_102413721 | 3300005581 | Freshwater Lentic | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVRVQ |
| Ga0049081_103252851 | 3300005581 | Freshwater Lentic | LRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRSVKIRWQKHVS |
| Ga0049080_102885611 | 3300005582 | Freshwater Lentic | MDYMIKRKPRSDRNHVLYRVECIDTGDSYIGVTVAQGHAFLRSVKL |
| Ga0049084_103286291 | 3300005585 | Freshwater Lentic | MRKKRSDRNYVLYQLTAGTDTYVGLTVAQGQAFLRSV |
| Ga0075472_107152732 | 3300006917 | Aqueous | MIKKKRNDRNYVIYLVTCQDTNDTYIGVTVATGRA |
| Ga0103959_11994193 | 3300007214 | Freshwater Lake | MLIRKRRSDRNHVVYRVTCVDTGDTYIGITVAQGHAFVRS |
| Ga0099848_12898452 | 3300007541 | Aqueous | MRKKRNDRNYILYELRVDNQTYIGLTVAVGRAFLRSVK |
| Ga0102917_11086241 | 3300007590 | Estuarine | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRS |
| Ga0105745_11642471 | 3300007972 | Estuary Water | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVRVQKHCS |
| Ga0105747_12924851 | 3300007974 | Estuary Water | LRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVRVQKHC |
| Ga0114343_11570631 | 3300008110 | Freshwater, Plankton | MAYNPSMMRKKRSDRNYVLYQLTADNETYIGLTVAQGQAFLRSVKV |
| Ga0114343_12084352 | 3300008110 | Freshwater, Plankton | MAYNPSMIRKKRSDRNYVLYQLTADNETYIGLTVAQGQAFLRSVKV |
| Ga0114346_10664091 | 3300008113 | Freshwater, Plankton | LRKKRNDRNYVLYAITAETGDSYVGLTVAQGQAFLRSVKVR |
| Ga0114350_11296073 | 3300008116 | Freshwater, Plankton | MMRKKRSDRNYVLYQLTADNETYIGLTVAQGQAFLRSVKVRVQKHLSRAKR |
| Ga0102831_10351533 | 3300008996 | Estuarine | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYTRSVKIRWQ |
| Ga0114962_101336361 | 3300009151 | Freshwater Lake | MHMILRKRRNDRNHVLYRVTCPETGDSYIGLTVAIGQAFLRSVKVR |
| Ga0114962_106870121 | 3300009151 | Freshwater Lake | MNCNRKKRTDRNHVIYQLTCVETGETYIGLTVMRGQAIKKSVNTRFQQHC |
| Ga0114966_102262144 | 3300009161 | Freshwater Lake | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSV |
| Ga0114966_104712191 | 3300009161 | Freshwater Lake | MNRKKRNDRNHVLYRVRCTDTGDTYIGLTVAIKSAY |
| Ga0114970_103754621 | 3300009163 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQKYIGLTVANGQAYLRSVKVRVQKHISRA |
| Ga0114975_104000703 | 3300009164 | Freshwater Lake | MMNRKKRSDRNHVLYRVICQDTGDSYIGLTVAQGQAFVRSVK |
| Ga0114969_101901981 | 3300009181 | Freshwater Lake | MTIRKKRADRNHVIYKVTCVDTNDTYIGLTVANGQAYVR |
| Ga0114959_104050351 | 3300009182 | Freshwater Lake | MPIRGIMRKKRSDRNHVIYAVTAEGQKYIGLTVANG |
| Ga0114974_104429851 | 3300009183 | Freshwater Lake | MRKKRSDRNHVLYQLTIGEQTYIGLTVAIGQAYLRSVKVRVQKHL |
| Ga0114971_106099312 | 3300009185 | Freshwater Lake | MVYMIKRKPRSDRNHVLYRVKCIDTGDSYIGVTVAQGHAFLRSVKVRWQ |
| Ga0114972_106165012 | 3300009187 | Freshwater Lake | MRKKRSDRNYVLYQLTADNQTYIGLTVSQGQAFLRSVKVRVQKHLS |
| Ga0114958_106490431 | 3300009684 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQKYIGLTVANGQAYLRSVKVR |
| Ga0114960_105156141 | 3300010158 | Freshwater Lake | MRKKRSDRNHVIYQVTCVDTGDNYIGLTVAQGQAFLRS |
| Ga0136644_103456753 | 3300010334 | Freshwater Lake | MGYMIKRKPRSDRNHVLYRVECVDTGDSYIGLTVAQGHAFLRSVKVRW |
| Ga0139557_10778661 | 3300011010 | Freshwater | MIRKKRSDRNYVLYQLTADNETYIGLTVAQGQAFLRSVKVRVQKHLSRAKRE |
| Ga0139556_10181684 | 3300011011 | Freshwater | MRRKRSDRNHVLYQLTIGEDTYIGLTAAIGQAYLRSVKVRVQKHMSRA |
| Ga0153805_10429823 | 3300012013 | Surface Ice | MQRKKRNDRNYVLYRVTADGQDYIGLTVAIGRAFLRSVKVR |
| Ga0138284_12285161 | 3300012779 | Freshwater Lake | MIRKKRSDRNHVLYRVECLDTGDSYIGVTVAQGQAFLRSVKVRWQK |
| Ga0164293_106379532 | 3300013004 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYVGLTVAQGQAFLRSVKV |
| Ga0164293_107141601 | 3300013004 | Freshwater | MIKKKRNDRNYVIYLVTCQDTNDTYIGVTVATGRAFLKSVKIRWQKHMS |
| Ga0164294_106955251 | 3300013006 | Freshwater | MMNRKKRSDRNHVLYRVECTDTGDSYIGVTVAQGQ |
| (restricted) Ga0172373_100518259 | 3300013131 | Freshwater | MRKKRNDRNYVLYRVTADGQEYIGLTVAIGRAFLRSVKVRLQKHQS |
| (restricted) Ga0172373_101155271 | 3300013131 | Freshwater | MRKKRNDRNYVLYRVTADGQEYIGLTVAIGRAFLRSVKVRLQKHQSRAKCENK |
| (restricted) Ga0172373_109369261 | 3300013131 | Freshwater | MRKKRNDRNYVLYRVTADGQEYIGLTVAIGRAFLRSVKVR |
| (restricted) Ga0172372_106304363 | 3300013132 | Freshwater | MIRKKRNDRNYILYHLTVDDQTYIGLTVALGRAFMR |
| Ga0177922_105161893 | 3300013372 | Freshwater | MRKKRNDRNYVLYRVTADGQDYIGLTVAIGRAFLRSVKVRLQKHQS |
| Ga0134314_1149672 | 3300014711 | Surface Water | MMRKKRNDRNYVLYRVSGDGESYVGLTVAVGRAFAKSVKVRVQK |
| Ga0134316_10289902 | 3300014960 | Surface Water | MKKKRCDRNHVIYRITAATGDSYIGLTVAQGAAYLRSVKVRVQKHLSRARREDKQ |
| Ga0134315_10442611 | 3300014962 | Surface Water | MSRKKRNDRNYVLYQIVCPDTGDNYIGVTVATGRAFLRSVKV |
| Ga0181364_10173891 | 3300017701 | Freshwater Lake | MRKKRSDRNHVLYRVICADTGDSYIGLTVAQGQAFVRSVKVRW |
| Ga0181364_10348861 | 3300017701 | Freshwater Lake | MLRKKRSDRNHVLYRVICADTGDSYIGLTVAQGQAFVRSVKVRW |
| Ga0181347_11018881 | 3300017722 | Freshwater Lake | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVRV |
| Ga0181347_11050831 | 3300017722 | Freshwater Lake | MLRKKRSDRNHVLYRVICADTGDSYIGLTVAQGQAFVRSV |
| Ga0181362_10177455 | 3300017723 | Freshwater Lake | MLKRKPRSDRNHVLYRVKCLDTGDTYIGLTVAKGQAFLRSV |
| Ga0181362_10436341 | 3300017723 | Freshwater Lake | MMKRKLRSDRNHVLYRVECMDTGDSYIGVTVAQGAAFLRSVKVRWQK |
| Ga0181344_10603444 | 3300017754 | Freshwater Lake | MRRKRSDRNHVLYQLTIGEDTYIGLTAAIGQAYLRSVKVRVQKHMSRAR |
| Ga0181356_11286941 | 3300017761 | Freshwater Lake | MMKRKLRSDRHHVLYRVKCIDTGDSYNGVTVAQGQAFLRPVKLRWQRHVS |
| Ga0181343_11516741 | 3300017766 | Freshwater Lake | MRKKRSDRNYVLYQVTCEDTGDSYIGVTVSQGRAF |
| Ga0181343_11596141 | 3300017766 | Freshwater Lake | MRKARSDRNHVIYQVTCVDTGDTYIGLTVAKGQAFLRSVKVR |
| Ga0181343_11840051 | 3300017766 | Freshwater Lake | MMNRKKRSDRNHVLYRVECTDTGDSYIGVTVAQGQAFLRSVKVRWQKHVSR |
| Ga0181358_11475521 | 3300017774 | Freshwater Lake | MIRKKRSDRNHVLYRVECMDTGDSYIGVTVAQGAAF |
| Ga0181358_12622053 | 3300017774 | Freshwater Lake | MMKRKLRSDRNHVLYRVECIDTGDSYIGVTVAIGQ |
| Ga0181349_12719812 | 3300017778 | Freshwater Lake | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRS |
| Ga0181349_12822731 | 3300017778 | Freshwater Lake | MLKRKLRSDRNHVLYRVECIDTGDSYIGVTVAQGQAFL |
| Ga0181349_13131511 | 3300017778 | Freshwater Lake | MWYNEYMTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYTRSVKVRWQKHVS |
| Ga0181346_11616672 | 3300017780 | Freshwater Lake | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGHAYVRSVKIR |
| Ga0181346_11901263 | 3300017780 | Freshwater Lake | MMNRKKRSDRNHVLYRVICHDTGDSYIGLTVAQGQAFVRSVK |
| Ga0181348_10315747 | 3300017784 | Freshwater Lake | MITLTRKPRSDRNHVLYKVTCVDTGDSYIGLTVAKGHAYVRAVKV |
| Ga0181355_11761721 | 3300017785 | Freshwater Lake | LRKKRNDRNYVLYAITAETGDSYVGLTVAQGQAFLRS |
| Ga0181562_104621691 | 3300019459 | Salt Marsh | MKKRCDRNHVIYCLTAETGDQYIGLTVAQGQAFLRSVKVRVQKHLSRAK |
| Ga0194113_101796894 | 3300020074 | Freshwater Lake | MRKKRNDRNYILYQLTVDDQTYIGLTVAVGRAFLRSVKVR |
| Ga0194110_103578801 | 3300020084 | Freshwater Lake | MKKRSDRNYVLYQVTCMDTGDSYIGLTVACGRAFVRSVK |
| Ga0211734_111907083 | 3300020159 | Freshwater | MDYMIKRKPRSDRNHVLYRVECIDTGDSYIGVTVAQGHAFLRSVKVRWQK |
| Ga0211734_112094013 | 3300020159 | Freshwater | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGHAYVRSVKIRWQKHVS |
| Ga0211735_110848791 | 3300020162 | Freshwater | MLKRKPRSDRNHVLYRVKCLDTGDTYIGLTVAKGQAFLRSVKVR |
| Ga0211729_108832931 | 3300020172 | Freshwater | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGHAYVRSVKIRWQKHVSR |
| Ga0194115_104675221 | 3300020183 | Freshwater Lake | MRKKRNDRNYILYQLTVDDQTYIGLTVAVGRAFLRSVKV |
| Ga0194116_100565945 | 3300020204 | Freshwater Lake | MRKKRNDRNYILYQLTVDDQTYIGLTVAVGRAFLRSVKVRVQ |
| Ga0194127_104057831 | 3300020221 | Freshwater Lake | MRKKRNDRNYVLYSLTTSAGDSYVGLTVARGQAFLRS |
| Ga0208090_10494121 | 3300020513 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYVGLTVAQGQAFL |
| Ga0208855_10343921 | 3300020553 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYVGLTVAQGQAFLRSVKVRVQKHLS |
| Ga0208598_10396171 | 3300020568 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYVGLTVAQGQAFLRSV |
| Ga0194123_102095924 | 3300021093 | Freshwater Lake | MRKKRNDRNYVLYSLTTSAGDSYVGLTVARGQAFLRSVKVRVQKHLS |
| Ga0194117_103557943 | 3300021424 | Freshwater Lake | MRKKRNDRNYILYQLTVDDQTYIGLTVAVGRAFLRSVKVRVQKHLSR |
| Ga0181354_12424513 | 3300022190 | Freshwater Lake | MLRKKRSDRNHVLYRVICADTGDSYIGLTVAQGQAFVRSVL |
| Ga0196905_11154754 | 3300022198 | Aqueous | MIRKKRNDRNYILYQLTVDNQTYIGLTVAVGRAFLRSVKV |
| Ga0181351_11422813 | 3300022407 | Freshwater Lake | MDYMIKRKARSDRNHVLYRVKCIDTGDSYIGVTVAQGHAFLRSVN |
| Ga0181351_12452871 | 3300022407 | Freshwater Lake | MRKKRSDRNYVLYRVTADGQDYIGLTASLGRAYLRSVKV |
| Ga0228656_10996211 | 3300024322 | Seawater | MANRKRRSDRNYVLYRVTGGDELYIGLTVARGRAF |
| Ga0244775_109739583 | 3300024346 | Estuarine | MWYNGYMTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYT |
| Ga0255142_10617362 | 3300024352 | Freshwater | MRNGYTMRKKRSDRNYVLYQLTAENETYIGLTVAQGQAFLRSVKVRVQKH |
| Ga0208613_10365801 | 3300025616 | Freshwater | MRKKRSDRNHVIYAVTAEGQTYIGLTVAIGQAYLRSVKVRVQKHISR |
| Ga0208161_10989801 | 3300025646 | Aqueous | MIRKKRNDRNYILYQLTVDNQTYIGLTVAVGRAFLRSVKVRVQKHISRAL |
| Ga0208019_10561274 | 3300025687 | Aqueous | MMRKKRSDRNYVLYRISSDHNTYIGLTVAQGQAFLRS |
| Ga0255134_10773683 | 3300027292 | Freshwater | MRKKRSDRNYVLYQLTADNETYIGLTVSQGQAFLRSVKV |
| Ga0209247_10380621 | 3300027468 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQTYIGLTVAIGQAYLR |
| Ga0208966_10236997 | 3300027586 | Freshwater Lentic | MRKKRSDRNHVLYRVICMDTGDSYIGLTVAQGQAFLRSV |
| Ga0208974_10223157 | 3300027608 | Freshwater Lentic | MRRKRSDRNHVLYQLTIGEDTYIGLTAAIGQAYLRSVKVRVQ |
| Ga0208974_11611321 | 3300027608 | Freshwater Lentic | MIRKKRSDRNHVLYRVECIDTGDSYIGVTVAQGAAFLRSVKVRWQKHV |
| Ga0208951_11226811 | 3300027621 | Freshwater Lentic | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGHAYVRSVKI |
| Ga0208951_11918492 | 3300027621 | Freshwater Lentic | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVR |
| Ga0209443_12885191 | 3300027707 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQTYIGLTVAIGQAYLRSVKVRVQKHI |
| Ga0209442_11381514 | 3300027732 | Freshwater Lake | MRKKRSDRNHVIYQVTCVDTGDNYIGLTVAQGQAFLRSVKVR |
| Ga0209442_12842831 | 3300027732 | Freshwater Lake | MKRKLRSDRNHVLYRVECIDTGDSYIGVTVAQGHAFLRSVKLRWQKH |
| Ga0209442_12868451 | 3300027732 | Freshwater Lake | MMRKKRSDRNHVLYRVECVDTGDSYIGLTVAQGQAFLRSVKVR |
| Ga0209355_13880531 | 3300027744 | Freshwater Lake | MMKRKLRSDRNHVLYRVECIDTGDSYIGVTVAQGQAFLRSV |
| Ga0209597_11378921 | 3300027746 | Freshwater Lake | MILRKKRSDRNHVLYRVTCVDTGDSYIGLTVAQGQA |
| Ga0209597_12019723 | 3300027746 | Freshwater Lake | MIRKKRSDRNHVLYRVECTDTGDSYIGVTVAQGQAFL |
| Ga0209296_12566871 | 3300027759 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQKYIGLTVANGQAYLRS |
| Ga0209296_12692371 | 3300027759 | Freshwater Lake | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRSVKV |
| Ga0209086_102880561 | 3300027770 | Freshwater Lake | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVRVQKHC |
| Ga0209107_105573521 | 3300027797 | Freshwater And Sediment | MTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGHAYVR |
| Ga0209353_100440677 | 3300027798 | Freshwater Lake | MLKRKPRQDRNHVLYRVECIDTGDSYIGLTVAQGQAY |
| Ga0209353_102955831 | 3300027798 | Freshwater Lake | VWYNEYMTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGHAY |
| Ga0209353_103521851 | 3300027798 | Freshwater Lake | MITLNRKPRSDRNHVLYKVTCVDTGDSYIGLTVAKGHAYVRAVKVRW |
| Ga0209354_101674881 | 3300027808 | Freshwater Lake | MWYNEYMTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRSVKIRWQK |
| Ga0209550_104491501 | 3300027892 | Freshwater Lake | MIFMRRKRSDRNHVLYQLTIGKQTYIGLTAAIGQAYLRSVKVRV |
| Ga0228645_11501901 | 3300028128 | Seawater | MANRKRRSDRNYVLYRVTGGDELYIGLTVARGRAFK |
| Ga0255174_10521061 | 3300028275 | Freshwater | MRNGYTMRKKRSDRNYVLYQLTAENETYIGLTVAQGQAFLRSVKVRVQ |
| Ga0304729_10844481 | 3300028392 | Freshwater Lake | MRKKRSDRNHVIYAVTAEGQKYIGLTVANGQAYLRSVKVRV |
| Ga0315907_109779262 | 3300031758 | Freshwater | MRKKRSDRNYVLYQLTAGTDTYVGLTVAQGQAFLRSVKVRVQKHLSRAKRENH |
| Ga0315907_112527303 | 3300031758 | Freshwater | MRKKRNDRNYIIYQILSENTGDSYIGVTVATGRAFLRSVKVRVQKHF |
| Ga0315899_105586415 | 3300031784 | Freshwater | MMRKKRSDRNHVLYRVECVDTGDSYIGLTVAQGQAFLR |
| Ga0315900_108680711 | 3300031787 | Freshwater | MRRKRSDRNHVLYQLTIGEDTYIGLTAAIGQAYLRSVKVRVQKHMSRARK |
| Ga0315904_111862893 | 3300031951 | Freshwater | MRRKRSDRNHVLYQLTIGKQTYIGLTAAIGQAYLRSVK |
| Ga0315901_102322411 | 3300031963 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYIGLTVAQGQAFLRSVKVRVQKHLSRARKENK |
| Ga0315901_106941011 | 3300031963 | Freshwater | LRKKRNDRNYVLYAITAETGDSYVGLTVAQGQAFLRSVKVRVQKHLSRARKE |
| Ga0315906_109615672 | 3300032050 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYIGLTVAQGQAFLRSVKVRVQ |
| Ga0315906_111214422 | 3300032050 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYIGLTVAQGQAFLRSVKVRVQK |
| Ga0315905_106499772 | 3300032092 | Freshwater | MRKKRSDRNYVLYQLTAGTDTYVGLTVAQGQAFLRSVKVR |
| Ga0315902_105346674 | 3300032093 | Freshwater | MRKKRSDRNYVLYQLTADNETYIGLTVSQGQAFLRSVKVRVQ |
| Ga0315902_108474081 | 3300032093 | Freshwater | MMRKKRSDRNYVLYAITAETGDSYIGLTVAQGQAFLR |
| Ga0315902_110238941 | 3300032093 | Freshwater | MRRKRSDRNHVLYQLTIGKQTYIGLTAAIGQAYLRSVKVRVQ |
| Ga0334979_0617215_2_109 | 3300033996 | Freshwater | MRRKRSDRNHVLYQLTIGKQTYIGLTVAIGQAYLRS |
| Ga0334995_0683364_470_580 | 3300034062 | Freshwater | MKRKLRSDRNHVLYRVECIDTGDSYIGLTVAQGHAFL |
| Ga0335019_0277477_1_105 | 3300034066 | Freshwater | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLR |
| Ga0335035_0206828_2_154 | 3300034105 | Freshwater | MIFMRRKRSDRNHVLYQLTIGEDTYIGLTVAQGQAFLRSVKVRVQKHMSRA |
| Ga0335036_0574846_550_687 | 3300034106 | Freshwater | MRKKRSDRNYVLYQLTAGTSTYVGLTVAQGQAFLRSVKVRVQKHLS |
| Ga0335036_0726362_442_582 | 3300034106 | Freshwater | MRKKRNDRNYVLYRVTADGQDYIGLTVAIGRAFLRSVKVRLQKHQSR |
| Ga0335050_0521525_352_504 | 3300034108 | Freshwater | MWYNEYMTLRKKRSDRNHVLYKVTCVDTGDSYVGLTVAQGQAYVRSVKIRW |
| Ga0335060_0526274_476_604 | 3300034122 | Freshwater | MMRKKRSDRNHVVYRVELTDTGDSYIGVTVAQGAAYLRSVKVR |
| Ga0335061_0314101_1_108 | 3300034168 | Freshwater | MRKKRNDRNYVLYQLTAGTSTYVGLTVAQGQAFLRS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |