| Basic Information | |
|---|---|
| Family ID | F048617 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ALLQAKPTNNAKGDWLASSADGSSVTMRPFMNIDKESYSTYVLLKS |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 97.97 % |
| % of genes from short scaffolds (< 2000 bps) | 91.89 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.622 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.568 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.108 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.86% Coil/Unstructured: 85.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF14559 | TPR_19 | 20.95 |
| PF13428 | TPR_14 | 16.89 |
| PF13432 | TPR_16 | 12.16 |
| PF13414 | TPR_11 | 10.14 |
| PF09295 | ChAPs | 2.70 |
| PF00515 | TPR_1 | 2.70 |
| PF13181 | TPR_8 | 2.03 |
| PF05960 | DUF885 | 1.35 |
| PF01625 | PMSR | 1.35 |
| PF13669 | Glyoxalase_4 | 1.35 |
| PF00248 | Aldo_ket_red | 1.35 |
| PF13531 | SBP_bac_11 | 0.68 |
| PF07593 | UnbV_ASPIC | 0.68 |
| PF03928 | HbpS-like | 0.68 |
| PF10518 | TAT_signal | 0.68 |
| PF07719 | TPR_2 | 0.68 |
| PF13517 | FG-GAP_3 | 0.68 |
| PF01263 | Aldose_epim | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 1.35 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.35 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.68 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.62 % |
| Unclassified | root | N/A | 3.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12830375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 539 | Open in IMG/M |
| 3300001082|JGI12664J13189_1011467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300001356|JGI12269J14319_10137052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1083 | Open in IMG/M |
| 3300001979|JGI24740J21852_10141164 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300003368|JGI26340J50214_10171966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300004082|Ga0062384_100477389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300004082|Ga0062384_101466554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300004092|Ga0062389_100420271 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300004092|Ga0062389_101765173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300004633|Ga0066395_10179370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300004633|Ga0066395_10279756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 905 | Open in IMG/M |
| 3300005184|Ga0066671_10235900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300005186|Ga0066676_10234698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
| 3300005436|Ga0070713_101163249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300005529|Ga0070741_10723216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 876 | Open in IMG/M |
| 3300005530|Ga0070679_100934461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300005535|Ga0070684_102053978 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005542|Ga0070732_10424208 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005542|Ga0070732_10562529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300005598|Ga0066706_11117862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300005602|Ga0070762_10241957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1119 | Open in IMG/M |
| 3300005602|Ga0070762_10906290 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005614|Ga0068856_100198854 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300005712|Ga0070764_10207557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1101 | Open in IMG/M |
| 3300005764|Ga0066903_103778132 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005764|Ga0066903_104883695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300005876|Ga0075300_1049662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300005899|Ga0075271_10121024 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005921|Ga0070766_11131121 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006028|Ga0070717_10488408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300006028|Ga0070717_11444663 | Not Available | 624 | Open in IMG/M |
| 3300006052|Ga0075029_100006139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6628 | Open in IMG/M |
| 3300006052|Ga0075029_100914135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300006059|Ga0075017_100258171 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300006162|Ga0075030_100935958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300006163|Ga0070715_10114629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300006172|Ga0075018_10323041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300006176|Ga0070765_100704735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300006800|Ga0066660_10759895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300009012|Ga0066710_104412796 | Not Available | 526 | Open in IMG/M |
| 3300009029|Ga0066793_10857829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300009174|Ga0105241_10497362 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300009638|Ga0116113_1197047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300009792|Ga0126374_10201114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1260 | Open in IMG/M |
| 3300009792|Ga0126374_11120920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300010043|Ga0126380_10024437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2961 | Open in IMG/M |
| 3300010046|Ga0126384_10391829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300010359|Ga0126376_11418529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300010366|Ga0126379_10484619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300010376|Ga0126381_101222827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300010376|Ga0126381_103890421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300010398|Ga0126383_12315321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300011269|Ga0137392_10082132 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300012211|Ga0137377_10512147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1138 | Open in IMG/M |
| 3300012354|Ga0137366_10497999 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin122 | 880 | Open in IMG/M |
| 3300012930|Ga0137407_11130281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300013306|Ga0163162_12546478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300013307|Ga0157372_10410624 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300014150|Ga0134081_10389475 | Not Available | 520 | Open in IMG/M |
| 3300014165|Ga0181523_10822893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella cerasi | 505 | Open in IMG/M |
| 3300014654|Ga0181525_10150418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300015371|Ga0132258_10480251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3104 | Open in IMG/M |
| 3300015372|Ga0132256_100062389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3503 | Open in IMG/M |
| 3300015372|Ga0132256_100804672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300016270|Ga0182036_10529398 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300016341|Ga0182035_11678889 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin122 | 574 | Open in IMG/M |
| 3300017928|Ga0187806_1294674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300017970|Ga0187783_11379927 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018040|Ga0187862_10286106 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300018044|Ga0187890_10310522 | All Organisms → cellular organisms → Bacteria → Chrysiogenetes → Chrysiogenetes → Chrysiogenales → unclassified Chrysiogenales → Chrysiogenales bacterium | 885 | Open in IMG/M |
| 3300018085|Ga0187772_10913332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300018090|Ga0187770_10573726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300018482|Ga0066669_10871849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300020579|Ga0210407_10340549 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300020581|Ga0210399_10243993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300020581|Ga0210399_11518475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300020583|Ga0210401_10596620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300020583|Ga0210401_11432902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021088|Ga0210404_10201628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300021171|Ga0210405_10486078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300021178|Ga0210408_10711060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300021180|Ga0210396_10115416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2424 | Open in IMG/M |
| 3300021180|Ga0210396_11119337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300021180|Ga0210396_11700311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300021181|Ga0210388_11366229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300021404|Ga0210389_11551603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300021406|Ga0210386_10238677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300021407|Ga0210383_10806885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300021420|Ga0210394_10071181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3013 | Open in IMG/M |
| 3300021420|Ga0210394_11805679 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021433|Ga0210391_10004395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11748 | Open in IMG/M |
| 3300021478|Ga0210402_10828499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300021479|Ga0210410_10145094 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300021559|Ga0210409_10990995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300024331|Ga0247668_1068670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300025906|Ga0207699_11113036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300025911|Ga0207654_11023107 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025929|Ga0207664_11815465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300027535|Ga0209734_1104612 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027545|Ga0209008_1068726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300027609|Ga0209221_1131025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300027629|Ga0209422_1019449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300027667|Ga0209009_1056100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300027842|Ga0209580_10084441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300027842|Ga0209580_10284749 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300027879|Ga0209169_10266380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300027895|Ga0209624_10464732 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin122 | 843 | Open in IMG/M |
| 3300027911|Ga0209698_11396063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300027915|Ga0209069_10729238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300028047|Ga0209526_10185714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300028745|Ga0302267_10393234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300028748|Ga0302156_10117676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300028906|Ga0308309_11898728 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300029636|Ga0222749_10450513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300029882|Ga0311368_10933283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300030007|Ga0311338_11352160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300030057|Ga0302176_10422564 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300030509|Ga0302183_10219650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300030617|Ga0311356_11277391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300030618|Ga0311354_10256374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1833 | Open in IMG/M |
| 3300030760|Ga0265762_1018178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300030906|Ga0302314_11899967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300031094|Ga0308199_1092198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300031198|Ga0307500_10118418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300031231|Ga0170824_126983241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300031708|Ga0310686_107231145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1512 | Open in IMG/M |
| 3300031718|Ga0307474_10669272 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031820|Ga0307473_11256868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300031912|Ga0306921_11260838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300031954|Ga0306926_11144866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300031962|Ga0307479_11597499 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300032001|Ga0306922_11873345 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032059|Ga0318533_11176623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300032091|Ga0318577_10582620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300032180|Ga0307471_100302080 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300032205|Ga0307472_100479379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300032261|Ga0306920_103881837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300032782|Ga0335082_10420895 | Not Available | 1199 | Open in IMG/M |
| 3300032805|Ga0335078_11724104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300032892|Ga0335081_10129552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3664 | Open in IMG/M |
| 3300032896|Ga0335075_10648206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300032954|Ga0335083_10184024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1931 | Open in IMG/M |
| 3300033433|Ga0326726_11815985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300033545|Ga0316214_1028338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300033808|Ga0314867_049179 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300033824|Ga0334840_191480 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300034065|Ga0334827_081463 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.41% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.05% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.35% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.35% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.35% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_128303751 | 3300000789 | Soil | NGLLQAKATNNKAGDWTATAADGSSVTMRPFMNIDKESYSTYVLLKS* |
| JGI12664J13189_10114672 | 3300001082 | Forest Soil | LFAMADSQPSFDGNALLQAKPANNATGDWLAMSTDGSRVTMRPFMNIEKENYSTYVMLKS |
| JGI12269J14319_101370522 | 3300001356 | Peatlands Soil | AKPANNAKGDWLANSADGSSVTMRPFMNIDKESYSTYVLLKA* |
| JGI24740J21852_101411642 | 3300001979 | Corn Rhizosphere | PIKNDRGDWTATSTSGSEVTMRPFMSIDKESYSTYVQLKS* |
| JGI26340J50214_101719661 | 3300003368 | Bog Forest Soil | DRNALLQAKATNNATGDWLASSSDGSSVTMRPFMNIDKENYSTYVLLKS* |
| Ga0062384_1004773891 | 3300004082 | Bog Forest Soil | AKPVNNAEGDWLGKSADGGNVTMRSFMNIDQERYSTYVLLRS* |
| Ga0062384_1014665542 | 3300004082 | Bog Forest Soil | AKPTNNATADWLASSADGSTVTMRPFMNIDKESYSTYVLLRS* |
| Ga0062389_1004202711 | 3300004092 | Bog Forest Soil | SQPSFDRRSLLQAKPTNNATADWLASSADGSTVTMRPFMNIDKESYSAYVLLRS* |
| Ga0062389_1017651732 | 3300004092 | Bog Forest Soil | SQPSFDRRSLLQAKPTNNATGDWLAKSADGSSVTMRPFMNIDKESYSTYVLLKS* |
| Ga0066395_101793702 | 3300004633 | Tropical Forest Soil | PAFDRKGLLQAQATNHAQGDWMATSADGTRVAMRPFMNIDKEKYSTYVMLKS* |
| Ga0066395_102797562 | 3300004633 | Tropical Forest Soil | ADAQPSFDRSSLLAAKPTNNATGDWTATSIDGSNITMRPFMNIDKESYSTYVWLKS* |
| Ga0066671_102359001 | 3300005184 | Soil | VLMAVTESQPTFERSALLQAKPLNNEGGDWVANAADGSSITMRPFMTIDKEGYSTYVLLKS* |
| Ga0066676_102346982 | 3300005186 | Soil | LMAVTESQPTFERSALLQAKPLNNAGGDWVANAADGSSITMRPFMTIDKEGYSTYVLLKS |
| Ga0070713_1011632491 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QPSLEKGSLLKAKPAPSNGKGDWLVTSSDGKPITMRPFMTIDKESYSTYVLLKS* |
| Ga0070741_107232161 | 3300005529 | Surface Soil | NALLQAKPAKNASGDWVATSADGSEVTMRPFMKIDKESYSTYLRLKT* |
| Ga0070679_1009344611 | 3300005530 | Corn Rhizosphere | SQPPFERSALLQAKPLNNAGGDWVANAVDGSSITMRPFMTIDKEGYSTYVLLKS* |
| Ga0070684_1020539781 | 3300005535 | Corn Rhizosphere | PAFDSQALLRAKPIKNDRGDWTATSTSGSEVTMRPFMSIDKESYSTYVQLKS* |
| Ga0070732_104242081 | 3300005542 | Surface Soil | LLQAKPVSGSKGDLQATSADGSSITMRPFMNIDKESYSTYVALKS* |
| Ga0070732_105625292 | 3300005542 | Surface Soil | SSFGQNSLLQAKPTNNAKGDWLAKAADGSDVTMRPFMNIDKENYSTYVLLKS* |
| Ga0066706_111178622 | 3300005598 | Soil | NKAGDWIAQSADGSSISMRPFMNIDKESYSTYVLLQS* |
| Ga0070762_102419573 | 3300005602 | Soil | GDWSATSADGAQVTMRPFMLIDKESYSTYLRIKS* |
| Ga0070762_109062902 | 3300005602 | Soil | GDLIANSAEATPVSMRPFMSIDKESYSTYVQLKS* |
| Ga0068856_1001988543 | 3300005614 | Corn Rhizosphere | DNERGDWVASSVSGSDVTLRPFMKIDKESYSAYVQLKS* |
| Ga0070764_102075572 | 3300005712 | Soil | NNAAGDWQVTSANGSNITMRPFMNIDKESYSTYLLLKS* |
| Ga0066903_1037781321 | 3300005764 | Tropical Forest Soil | LQSKPTNNGKGDWVARSVDGSEITMRPFMNIDKENYSTYVLLKT* |
| Ga0066903_1048836952 | 3300005764 | Tropical Forest Soil | SQPSFERGSLLQAKPVANNDKGDWLVTSTEGKQVTMRPFMTIDKESYSAYVLLKS* |
| Ga0075300_10496621 | 3300005876 | Rice Paddy Soil | ALLQAKQVNNAGGDWVANAVDGSSITMRPFMTIDKEGYSTYVLLKS* |
| Ga0075271_101210241 | 3300005899 | Rice Paddy Soil | GDWVATSLDGRQITMRPFMKIDKESYSAYVRINS* |
| Ga0070766_111311211 | 3300005921 | Soil | SIDLITLLQAKPANNTAGDYMAGSVDGSRIAMRPFMNIDKETYSTYVALKS* |
| Ga0070717_104884082 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLMAVAESQPTFERTALLQAKPLNNAGGDWVANAVDGSSITMRPFMTIDKEGYSTYVLLKS* |
| Ga0070717_114446632 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LRARAANNERGDWTASSAAGGDVAMRPFIKIDKESYSTYVQIRS* |
| Ga0075029_1000061394 | 3300006052 | Watersheds | QPTFDRNALLQAKATNNATGDWLASSTDGSSVTMRPFMNIDKETYSSYVMLKS* |
| Ga0075029_1009141352 | 3300006052 | Watersheds | ALLQAKPANNNPGDWLATSADGSNVTMRPFMNIDKESYSTYVLLKA* |
| Ga0075017_1002581712 | 3300006059 | Watersheds | NALLQAKATNNATGDWLASSTDGSSVTMRPFMNIDKETYSSYVMLKS* |
| Ga0075030_1009359581 | 3300006162 | Watersheds | TGDWLASSADGRSIKMRPFMMIDKESYSTYVQLKS* |
| Ga0070715_101146292 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KGDWMATSADGSSIAMRPFMNIDKEKYSTYVILKS* |
| Ga0075018_103230411 | 3300006172 | Watersheds | LQAKSANNKTGDWVATAADGSSVTMRPFMTIDKESYSTYVLLKS* |
| Ga0070765_1007047351 | 3300006176 | Soil | LLQAKAANNAAGDWQVTSANGSNITMRPFMNIDKESYSTYLLLNQLRIR* |
| Ga0066660_107598952 | 3300006800 | Soil | ALLQAKPLNNAGGDWVANAADGSSITMRPFMTIDKEGYSTYVLLKS* |
| Ga0066710_1044127961 | 3300009012 | Grasslands Soil | AELLRARYTSNALGDSTAVSTDGKSITMRPFMNIDKESYNTYVVLKT |
| Ga0066793_108578292 | 3300009029 | Prmafrost Soil | VADSQPTFDANALLQAKPANNATGDWLASSIGGPSVTMRPFMNIDKESYSTYVLLKA* |
| Ga0105241_104973621 | 3300009174 | Corn Rhizosphere | DRGDWTASSVSGSEVIMRPFMTIDKESYSTYVQIKS* |
| Ga0116113_11970471 | 3300009638 | Peatland | LNNAAGDWSATSADGAQVTMRPFMSIDKESYSTYVRLKS* |
| Ga0126374_102011141 | 3300009792 | Tropical Forest Soil | AIADGQPTFDTNGLLQSKPTNNGKGDWVARSVDGSEITMRPFMNIDKENYSTYVLLKT* |
| Ga0126374_111209201 | 3300009792 | Tropical Forest Soil | ALLQAKAVNNATGDWTANSADGSRITLRPFMTIDQESYSTYVSLKS* |
| Ga0126380_100244373 | 3300010043 | Tropical Forest Soil | LQARPTNNAKGDWLANAADGSGVTMRPFMNIDKENYSTYLLLKS* |
| Ga0126384_103918291 | 3300010046 | Tropical Forest Soil | LVALLNGPVVLFAVADSQPTVERNALLQARPTNNAKGDWLANAADGSGVTMRPFMNIDKENYSTYLLLKS* |
| Ga0126376_114185291 | 3300010359 | Tropical Forest Soil | PAFDRNALLQARAANSSKGDWIAKSADGSDVTMRPFMNIDKESYSTYVLLKA* |
| Ga0126379_104846191 | 3300010366 | Tropical Forest Soil | TNGLLQAKPTSNAKGDWMARTVDGSEITMRPFMNIDKENYSTYVSLKT* |
| Ga0126381_1012228271 | 3300010376 | Tropical Forest Soil | KGDWLATSADGKQITMRPFMTIDKEGYSAYVLLKS* |
| Ga0126381_1038904212 | 3300010376 | Tropical Forest Soil | MNVAGDWIANATNGSQITMRPFMSIDKESYSTYVRLKS* |
| Ga0126383_123153211 | 3300010398 | Tropical Forest Soil | SKGLLQAKATNNAKGDWMATSADGNSIAMRPFMNIDKEKYSTYAMLKS* |
| Ga0137392_100821321 | 3300011269 | Vadose Zone Soil | ELLRSQLSNNAAGDFIANSAEATPVSMRPFMSIDKESYSTYVQLKS* |
| Ga0137377_105121471 | 3300012211 | Vadose Zone Soil | KASKNAAGDWIADSADGSSVTMRPFMNIDKESYSAYVLLKS* |
| Ga0137366_104979991 | 3300012354 | Vadose Zone Soil | AESQPAFESRSLLRAKPLNNPKGDWLASSIGGGQITMRPFMTIDKESYSTYVRITS* |
| Ga0137407_111302811 | 3300012930 | Vadose Zone Soil | PAFDQNALLQAKPTNNNYGDFVATSTNGSSITMRPFMNIDKESYSTYVLLKS* |
| Ga0163162_125464781 | 3300013306 | Switchgrass Rhizosphere | ALLQAKPVNNAGGDWVANAVDGSSITMRPFMTIDKEGYSSYVLLKS* |
| Ga0157372_104106241 | 3300013307 | Corn Rhizosphere | KNDRGDWTATSTSGSEVTMRPFMSIDKESYSTYVQLKS* |
| Ga0134081_103894752 | 3300014150 | Grasslands Soil | LRARHTSNAMGDSAAISTDGKSIIMRPFMSIDKESYNTYVLLKS* |
| Ga0181523_108228932 | 3300014165 | Bog | FVAQALLHAKPLNNAAGDWSATSADGSRLTMRPFMSIDKESYSTYVRIKS* |
| Ga0181525_101504181 | 3300014654 | Bog | NALLQAKPTNNPRGDWLVTSSDGSSVTMRPFMNIDRENYSTYVLLKS* |
| Ga0132258_104802513 | 3300015371 | Arabidopsis Rhizosphere | GDWTASAVDGSSVAMRPFMSIDKESYSTYVLLKS* |
| Ga0132256_1000623891 | 3300015372 | Arabidopsis Rhizosphere | SQPTFNRGGLLQAKAAKNATGDWLASSSDGSSITMRPFMTIDKETYSTYVQLKS* |
| Ga0132256_1008046721 | 3300015372 | Arabidopsis Rhizosphere | NNAAGDLIANSADSKPISMRPFMNIDKESYSTYVLLKT* |
| Ga0182036_105293982 | 3300016270 | Soil | GLLQAKPTNNAKGDWMARTVDGSEITMRPFMNIDKENYSTYVSLKT |
| Ga0182035_116788892 | 3300016341 | Soil | SGDWSATSADGSHITMRPFMTIDKESYSTYVRINS |
| Ga0187806_12946742 | 3300017928 | Freshwater Sediment | LQAKPANHSTGDWLATSADGSNVTMRPFMNIDKESYSTYVLLKS |
| Ga0187783_113799271 | 3300017970 | Tropical Peatland | AKGDFMATSADGSGVAMRPFTNIDQEDYSTCVLFK |
| Ga0187862_102861061 | 3300018040 | Peatland | AKGDWLANSVDGSSVTMRPFMNIDKESYSTYAVLKS |
| Ga0187890_103105221 | 3300018044 | Peatland | KPLNNAGGDRVANSIDRGLVTMRPFMTIDKESYSTYVRIRS |
| Ga0187772_109133322 | 3300018085 | Tropical Peatland | FAVADSQPSFERNALLQAKPANNAAGDWLATSAGGSTVTMRPFMNIDKENYSTYVLLKS |
| Ga0187770_105737262 | 3300018090 | Tropical Peatland | TGNAAGDSIANSIDGRPISMRPFAGINEENYSTYVKLVS |
| Ga0066669_108718491 | 3300018482 | Grasslands Soil | NNAGGDWVANAADGSRITMRPFMTIDKEGYSTYVLLKS |
| Ga0210407_103405491 | 3300020579 | Soil | KGDWLATAADGSTVTMRPFMNIDQESYSTYVLLKG |
| Ga0210399_102439931 | 3300020581 | Soil | LVLFAVGDSQPTFDQGALLQAKPTPNTTGDWLASSADGSHVTMRPFMNIDKETYSTYVLLKS |
| Ga0210399_115184752 | 3300020581 | Soil | AIADSQPSFDQNTLLQAKATNNNTGDFLATSVNGTSVTMRPFMNIDKESYSTYVLLKS |
| Ga0210401_105966201 | 3300020583 | Soil | GGDWVATTVDGRPMTMRPFMSIDKESYSTYVRIKG |
| Ga0210401_114329021 | 3300020583 | Soil | QAKATNNATGDWIAQSADGSSVSMRPFMNIDKESYSTYVLLKA |
| Ga0210404_102016281 | 3300021088 | Soil | SALLQAKPTNNTTGDWIAESADGSRVSMRPFMNIDKESYSTYVLLKA |
| Ga0210405_104860782 | 3300021171 | Soil | ATNNATGDWIAQSADGSSVSMRPFMNIDKESYSTYVLLKA |
| Ga0210408_107110602 | 3300021178 | Soil | TNNAAGDSIANSVDSKEVSMRPFMSIDKESYSTYVLLKS |
| Ga0210396_101154161 | 3300021180 | Soil | VLFAVADTQPSFDQNALLQANATNNTTGDFVATSANGSSITMRPFMNIDKESYSTYVLLK |
| Ga0210396_111193372 | 3300021180 | Soil | NAAGDWQATSANGSNITMRPFMNVDKESYSTYVLLKS |
| Ga0210396_117003112 | 3300021180 | Soil | QAKPTNNAKGDWTATSADGSTVAMRPFMNIDKESYSTYVLLKS |
| Ga0210388_113662292 | 3300021181 | Soil | RAVQNAAGDWQANAADGSPVTMRPFMSIDKESYSTYVRLKS |
| Ga0210389_115516031 | 3300021404 | Soil | AGDWLANAADGSPITMRPFMSIDKESYSTYVRLNA |
| Ga0210386_102386772 | 3300021406 | Soil | PRNNAAGDWSATTSDGSQVTMRPFMSIDKETYSAYVRLKS |
| Ga0210383_108068851 | 3300021407 | Soil | SFDRNTLLQAKPTNNASGDWLADSADGSRVTMRPFMNIDKENYSTYVVLKS |
| Ga0210394_100711811 | 3300021420 | Soil | ATAVKNATGDWTANSADGRGITMRPFMTIDKESYSTYVQLKS |
| Ga0210394_118056791 | 3300021420 | Soil | NNAAGDLIANSAEATPVSMRPFMSIDKESYSTYVQLKS |
| Ga0210391_100043957 | 3300021433 | Soil | VLFAVADSQPTFDRNTLLQAKPANNAAGDQLASSIDGSHVAMRPFMNIDKENYSTYVSLK |
| Ga0210402_108284992 | 3300021478 | Soil | HPKLVGLVQGALVLFAIADSQPSFDQNTLLQAKATNNNTGDFLATSVNGTSVTMRPFMNIDKESYSTYVLLKS |
| Ga0210410_101450941 | 3300021479 | Soil | RLSNNAAGDLIANSAEATPVSMRPFMSIDKESYSTYVQLKS |
| Ga0210409_109909952 | 3300021559 | Soil | NNATGDWIAQSVEGSSVSMRPFMKIDKESYSTYVLLKA |
| Ga0247668_10686701 | 3300024331 | Soil | FAVADSQPSFTQNALLQAKPTNNATGDWLASSVNGSNVTMRPFMNIDKERYSTYVQLKS |
| Ga0207699_111130362 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSESQPTFDRNALLQAKASNNVTGDWLATSVDGKGIAMRPYMVIDKESYSTYVQLKS |
| Ga0207654_110231071 | 3300025911 | Corn Rhizosphere | VNTGRGDWTASSVSGGEVTMRPFMTIDKESYSTYVQITS |
| Ga0207664_118154651 | 3300025929 | Agricultural Soil | LRAASNATGDWLASSADQRSITMRPFMMIDKEPYSTYVQLKS |
| Ga0209734_11046122 | 3300027535 | Forest Soil | LSNNAAGDLIANSAEATPVSMRPFMSIDKESYSTYVQLKS |
| Ga0209008_10687262 | 3300027545 | Forest Soil | FAVADSQPSFERNALLQAKPTNNAKGDWLASSADGSGVTMRPFMNIDKEIYSTYVLLKS |
| Ga0209221_11310251 | 3300027609 | Forest Soil | PTRNATGDWLANSVDGSRVTMRPFMNIDKESYSTYVLLKS |
| Ga0209422_10194492 | 3300027629 | Forest Soil | FDQGALLQAKPTPNTTGDWLASSADGSHVTMRPFMNIDKETYSTYVLLKS |
| Ga0209009_10561001 | 3300027667 | Forest Soil | VGNSQPTFDQGALLQAKPTPNTTGDWLASSADGSHVTMRPFMNIDKETYSTYVLLKS |
| Ga0209580_100844412 | 3300027842 | Surface Soil | NTTGDWSANSVDGKSITMRPFMTIDKESYSTYVQLKA |
| Ga0209580_102847492 | 3300027842 | Surface Soil | LLQAKPVSGSKGDLQATSADGSSITMRPFMNIDKESYSTYVALKS |
| Ga0209169_102663802 | 3300027879 | Soil | ALLQAKPTNNAKGDWLASSADGSSVTMRPFMNIDKESYSTYVLLKS |
| Ga0209624_104647322 | 3300027895 | Forest Soil | AAGDWSATSADGAQVTMRPFMSIDKESYSTYLRIKS |
| Ga0209698_113960632 | 3300027911 | Watersheds | PLVLFAVADSQPTFDRNALLQAKATNNAVGDWNASSTDGSSVTMRPFMNIDKENYSTYVMLKS |
| Ga0209069_107292382 | 3300027915 | Watersheds | ETFAMASAADGSSISMRPFMNIDKESYSTYVMLKS |
| Ga0209526_101857142 | 3300028047 | Forest Soil | FAVGSSQPTFDQGALLQAKPTPNTTGDWLASSADGSHVTMRPFMNIDKETYSTYVLLKS |
| Ga0302267_103932341 | 3300028745 | Bog | LNNASGDWVANSIGGGQITMRPFMTIDKESYSTYVQILS |
| Ga0302156_101176761 | 3300028748 | Bog | LLRAKPLNNASGDWVANSIGGGQITMRPFMTIDKESYSTYVQILS |
| Ga0308309_118987282 | 3300028906 | Soil | PTFDRNTLLQAKPANNAAGDQLAGSIDGSHVAMRPFMNIDKENYSTYVSLKS |
| Ga0222749_104505131 | 3300029636 | Soil | NTTGDFVATSANGSSITMRPFMNIDKESYSTYVLLKS |
| Ga0311368_109332832 | 3300029882 | Palsa | ATNNATGDWVATSIDGGRVTMRPFMNIEKENYSTYVMLKS |
| Ga0311338_113521601 | 3300030007 | Palsa | SLLQAKPANNTGDWLASSADGGKVTMRPFMNIDKESYSTYVLLKS |
| Ga0302176_104225641 | 3300030057 | Palsa | VGNAQPSFDRNALLRAKPTNSAGGDWLASSSDGTSVTMRPFMNIDKESYSAYVLLKA |
| Ga0302183_102196501 | 3300030509 | Palsa | QPSFDRNALLRAKPTNSAGGDWLASSSDGTSVTMRPFMNIDKESYSAYVLLKA |
| Ga0311356_112773911 | 3300030617 | Palsa | LFAVADSQPSFDRNALLQAKPTNNPRGDWLVTSSDGSSVTMRPFMNIDKESYSAYVLLKS |
| Ga0311354_102563741 | 3300030618 | Palsa | AVSDSQPSFERNGLLQAKATNNATGDWVTTSIDGGRVTMRPFMNIEKENYSTYVMLKS |
| Ga0265762_10181781 | 3300030760 | Soil | AKPTNNAKGDWLASSADGSSVTMRPFMNIDKESYSTYVLLKS |
| Ga0302314_118999672 | 3300030906 | Palsa | SNSTGDWLATSAGGSNVTMRPFMNIDKESYSSYVWLKS |
| Ga0308199_10921982 | 3300031094 | Soil | LRAQMTNNAAGDSIAKSVDGQSVSMRPFMSIDKESYSTYVLLKS |
| Ga0307500_101184181 | 3300031198 | Soil | MAVGESQPTFNRSGLLQAKAANNPAGDWLASSADGSNITMRPFMTIDKETYSTYVQLKS |
| Ga0170824_1269832412 | 3300031231 | Forest Soil | QAKPTNNKAGDWTASAADGSNVTMRPFMSIGKESYSTYVLLKS |
| Ga0310686_1072311452 | 3300031708 | Soil | RNALLQAKPANNAKGDWLVSSADGSGVTMRPFMNIDNENYSTYVLLKS |
| Ga0307474_106692722 | 3300031718 | Hardwood Forest Soil | NGLLQAKPAQNAKGDWLATAADGSNVTMRPFMNIDKESYSTYVLLKG |
| Ga0318568_105358152 | 3300031819 | Soil | GNATGDLLASSADGKHISMRPFMTIDKESYSAYVRIKS |
| Ga0307473_112568682 | 3300031820 | Hardwood Forest Soil | SFDENALLQAKASNNAAGDWMANSADGSSVTMRPFMNIDKESYSTYVLLKS |
| Ga0306921_112608381 | 3300031912 | Soil | AGNASKGDWIAKSADGSEIIMRPFMNIDQESYSTYVLLKA |
| Ga0306926_111448662 | 3300031954 | Soil | AKASNNASGDWSATSADGSHITMRPFMTIDKESYSTYMLLKS |
| Ga0307479_115974991 | 3300031962 | Hardwood Forest Soil | SQLSNNAAGDLIANSAEATPVSMRPFMSIDKESYSTYVQLKS |
| Ga0306922_118733451 | 3300032001 | Soil | DRGSLLQAKPAAIRDKGDWLATSTDGKQITMRPFMTIDKESYSAYLLLKS |
| Ga0318533_111766232 | 3300032059 | Soil | TQSLLRAKPTNNATGDWLATAGDGRQISMRPFMTIDKETYSAYVRINS |
| Ga0318577_105826201 | 3300032091 | Soil | AVADSQPSFDRNALLQARPTNNANGDWLAKSADGSDVTMRPFMNIDKENYSTYVVLKS |
| Ga0307471_1003020801 | 3300032180 | Hardwood Forest Soil | NATNNDQGDSTAVAADGSSVIMRPFSTINQESYSTYVLLKS |
| Ga0307472_1004793791 | 3300032205 | Hardwood Forest Soil | GLLQAKAANNKAGDWTATAADGSSVTMRPFMNIDKESYSTYVLLKS |
| Ga0306920_1038818372 | 3300032261 | Soil | QAKASNNASGDWSATSADGSHITMRPFMTIDKESYSTYMLLKS |
| Ga0335082_104208951 | 3300032782 | Soil | VLFAVADAQPTFDTTGLLQAKPTNNGKGDWMARSADGSEITMRPFMNIDKENYSTYVLLK |
| Ga0335078_117241042 | 3300032805 | Soil | IADSQLSFDRNGLLQAKATNNATGDWTATSADGSSVTMRPFMNIDKEKYSTYVVLKS |
| Ga0335081_101295523 | 3300032892 | Soil | LLAIANSQPSFDRNSLLQAKPAKNATGDWTATSADGSSVTLRPFMNIDKENYSTYVLLKS |
| Ga0335075_106482061 | 3300032896 | Soil | AQPTNNAAGDWLATSSDGSSVTMRPFMNIDKESYSTYVLLKA |
| Ga0335083_101840241 | 3300032954 | Soil | PLVLMAVAESQPSFEKRSLLNAKSAANSDKGDWLATSSDGKQIIMRPFMRIDKESYSAYVLLKS |
| Ga0326726_118159851 | 3300033433 | Peat Soil | NALFQAKSVNNAVGDWTANSVDGSQITMRPFMTIDKENYSTYVLLKS |
| Ga0316214_10283381 | 3300033545 | Roots | AKGDWTATSADGSTVAMRPFMNIDKESYSTYVLLKS |
| Ga0314867_049179_12_146 | 3300033808 | Peatland | LQAKAANSSKGDWLATAADGSSVSMRPFMNIDKESYSTYLLLKA |
| Ga0334840_191480_413_520 | 3300033824 | Soil | SGDWVANSIGGGQITMRPFMTIDKESYSTYVQILS |
| Ga0334827_081463_994_1104 | 3300034065 | Soil | ASGDWVANSIGGGQITMRPFMTIDKESYSTYVQILS |
| ⦗Top⦘ |