| Basic Information | |
|---|---|
| Family ID | F048594 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LKLGRRKFLGLGSAALVGLSLKSEKKIAGSFVNDSFQMGHLLR |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.84 % |
| % of genes near scaffold ends (potentially truncated) | 98.65 % |
| % of genes from short scaffolds (< 2000 bps) | 91.22 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.459 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.865 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.405 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.21% β-sheet: 0.00% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF01564 | Spermine_synth | 91.89 |
| PF03994 | DUF350 | 3.38 |
| PF13785 | DUF4178 | 1.35 |
| PF01402 | RHH_1 | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.46 % |
| Unclassified | root | N/A | 15.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1025478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 518 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100992894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 724 | Open in IMG/M |
| 3300004080|Ga0062385_11124182 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300004082|Ga0062384_100281968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1023 | Open in IMG/M |
| 3300004091|Ga0062387_100512273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 840 | Open in IMG/M |
| 3300005167|Ga0066672_10783984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 601 | Open in IMG/M |
| 3300005176|Ga0066679_11028830 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005178|Ga0066688_10958169 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005331|Ga0070670_102024933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 530 | Open in IMG/M |
| 3300005332|Ga0066388_103293528 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005339|Ga0070660_100681807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 861 | Open in IMG/M |
| 3300005434|Ga0070709_10888908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 704 | Open in IMG/M |
| 3300005542|Ga0070732_10509847 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005556|Ga0066707_10812274 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005558|Ga0066698_10060594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2415 | Open in IMG/M |
| 3300005559|Ga0066700_10954381 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005598|Ga0066706_10916696 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005602|Ga0070762_10850118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 620 | Open in IMG/M |
| 3300005712|Ga0070764_10761730 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005764|Ga0066903_106583151 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005952|Ga0080026_10185453 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006052|Ga0075029_100643144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 711 | Open in IMG/M |
| 3300006052|Ga0075029_100835614 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006059|Ga0075017_101319297 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006086|Ga0075019_10469557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300006102|Ga0075015_100047324 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300006162|Ga0075030_100282440 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300006163|Ga0070715_10804104 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006175|Ga0070712_100863474 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006176|Ga0070765_100185950 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300006176|Ga0070765_100682020 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 970 | Open in IMG/M |
| 3300006176|Ga0070765_101595617 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006755|Ga0079222_10170937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1266 | Open in IMG/M |
| 3300006755|Ga0079222_10383239 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006797|Ga0066659_10341543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300006797|Ga0066659_10753722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 800 | Open in IMG/M |
| 3300006800|Ga0066660_10885821 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006806|Ga0079220_10032915 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300010358|Ga0126370_11356858 | Not Available | 669 | Open in IMG/M |
| 3300010359|Ga0126376_12265793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 589 | Open in IMG/M |
| 3300010376|Ga0126381_101825049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300010396|Ga0134126_11576887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 723 | Open in IMG/M |
| 3300011119|Ga0105246_10842119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 817 | Open in IMG/M |
| 3300012096|Ga0137389_10320103 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300012199|Ga0137383_10114911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1960 | Open in IMG/M |
| 3300012202|Ga0137363_10168273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1736 | Open in IMG/M |
| 3300012205|Ga0137362_10197108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1732 | Open in IMG/M |
| 3300012211|Ga0137377_10605395 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300012357|Ga0137384_11357459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012582|Ga0137358_10137615 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300012582|Ga0137358_10442045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300012683|Ga0137398_10121530 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300012918|Ga0137396_10349691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
| 3300012923|Ga0137359_10225480 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300012986|Ga0164304_11549402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 550 | Open in IMG/M |
| 3300014166|Ga0134079_10535871 | Not Available | 571 | Open in IMG/M |
| 3300014169|Ga0181531_10987522 | Not Available | 529 | Open in IMG/M |
| 3300015242|Ga0137412_10685591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 764 | Open in IMG/M |
| 3300015371|Ga0132258_12188348 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300016371|Ga0182034_10939471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 745 | Open in IMG/M |
| 3300017955|Ga0187817_10170441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1386 | Open in IMG/M |
| 3300017994|Ga0187822_10218967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300018012|Ga0187810_10210556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300018033|Ga0187867_10427469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 732 | Open in IMG/M |
| 3300018038|Ga0187855_10193853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1201 | Open in IMG/M |
| 3300018047|Ga0187859_10669653 | Not Available | 588 | Open in IMG/M |
| 3300018058|Ga0187766_10566375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300018088|Ga0187771_10367193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1211 | Open in IMG/M |
| 3300018090|Ga0187770_10859908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 727 | Open in IMG/M |
| 3300018468|Ga0066662_11369923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 730 | Open in IMG/M |
| 3300018468|Ga0066662_12937813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300019789|Ga0137408_1079285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 1069 | Open in IMG/M |
| 3300019888|Ga0193751_1120908 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300020199|Ga0179592_10240935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300020580|Ga0210403_11072709 | Not Available | 627 | Open in IMG/M |
| 3300020583|Ga0210401_11254652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300021088|Ga0210404_10170242 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300021088|Ga0210404_10423746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 746 | Open in IMG/M |
| 3300021168|Ga0210406_10088152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2647 | Open in IMG/M |
| 3300021180|Ga0210396_11336667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 595 | Open in IMG/M |
| 3300021401|Ga0210393_10471023 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300021401|Ga0210393_10683210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 837 | Open in IMG/M |
| 3300021402|Ga0210385_10239535 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300021402|Ga0210385_11065586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 621 | Open in IMG/M |
| 3300021405|Ga0210387_11629638 | Not Available | 548 | Open in IMG/M |
| 3300021406|Ga0210386_11733831 | Not Available | 515 | Open in IMG/M |
| 3300021407|Ga0210383_11785018 | Not Available | 502 | Open in IMG/M |
| 3300021479|Ga0210410_11453958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300021560|Ga0126371_10858268 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300021560|Ga0126371_13771082 | Not Available | 511 | Open in IMG/M |
| 3300023250|Ga0224544_1051009 | Not Available | 594 | Open in IMG/M |
| 3300024224|Ga0247673_1037447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 675 | Open in IMG/M |
| 3300024246|Ga0247680_1045532 | Not Available | 636 | Open in IMG/M |
| 3300024288|Ga0179589_10205334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300024330|Ga0137417_1403753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5161 | Open in IMG/M |
| 3300025319|Ga0209520_10084620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2021 | Open in IMG/M |
| 3300025916|Ga0207663_11287840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 589 | Open in IMG/M |
| 3300025924|Ga0207694_10275091 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300026142|Ga0207698_11417384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 710 | Open in IMG/M |
| 3300026296|Ga0209235_1003994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8218 | Open in IMG/M |
| 3300026304|Ga0209240_1077076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300026333|Ga0209158_1239230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 623 | Open in IMG/M |
| 3300026334|Ga0209377_1225461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300026508|Ga0257161_1018658 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300026515|Ga0257158_1050365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300026551|Ga0209648_10488818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 725 | Open in IMG/M |
| 3300027172|Ga0208098_1018759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 679 | Open in IMG/M |
| 3300027432|Ga0209421_1112220 | Not Available | 560 | Open in IMG/M |
| 3300027521|Ga0209524_1055167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 836 | Open in IMG/M |
| 3300027610|Ga0209528_1135161 | Not Available | 541 | Open in IMG/M |
| 3300027635|Ga0209625_1025322 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300027671|Ga0209588_1065816 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300027671|Ga0209588_1222989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300027725|Ga0209178_1361490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 545 | Open in IMG/M |
| 3300027855|Ga0209693_10168603 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300027875|Ga0209283_10323493 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300027879|Ga0209169_10064093 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
| 3300027905|Ga0209415_11082368 | Not Available | 524 | Open in IMG/M |
| 3300027910|Ga0209583_10478921 | Not Available | 610 | Open in IMG/M |
| 3300028047|Ga0209526_10022548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4401 | Open in IMG/M |
| 3300028072|Ga0247675_1040177 | Not Available | 689 | Open in IMG/M |
| 3300028906|Ga0308309_11400378 | Not Available | 599 | Open in IMG/M |
| 3300029882|Ga0311368_10009161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10185 | Open in IMG/M |
| 3300029945|Ga0311330_10168124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2051 | Open in IMG/M |
| 3300029955|Ga0311342_10107031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2946 | Open in IMG/M |
| 3300030007|Ga0311338_11169533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 732 | Open in IMG/M |
| 3300030764|Ga0265720_1025180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 512 | Open in IMG/M |
| 3300030813|Ga0265750_1016863 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031057|Ga0170834_100028549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300031057|Ga0170834_101922281 | Not Available | 512 | Open in IMG/M |
| 3300031090|Ga0265760_10070917 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300031231|Ga0170824_101338755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300031474|Ga0170818_112499116 | Not Available | 599 | Open in IMG/M |
| 3300031682|Ga0318560_10140883 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300031708|Ga0310686_100757537 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300031715|Ga0307476_11281355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031720|Ga0307469_10867410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 833 | Open in IMG/M |
| 3300031736|Ga0318501_10243041 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031754|Ga0307475_11499142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031962|Ga0307479_10004291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13032 | Open in IMG/M |
| 3300032044|Ga0318558_10435428 | Not Available | 653 | Open in IMG/M |
| 3300032180|Ga0307471_100301988 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300032421|Ga0310812_10576723 | Not Available | 504 | Open in IMG/M |
| 3300032828|Ga0335080_11794957 | Not Available | 599 | Open in IMG/M |
| 3300032829|Ga0335070_11049096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 751 | Open in IMG/M |
| 3300032896|Ga0335075_10600671 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300032897|Ga0335071_10914580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.41% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.35% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.35% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10254781 | 3300001089 | Forest Soil | LKLGRRKFLGLGSAALVGLSLKSERKIEGSFVNDSFQMGHLLRDRAL |
| JGIcombinedJ26739_1009928941 | 3300002245 | Forest Soil | LKVGRRKFLRSGSAALVGLSLKTDRPIAGSFVNDSFQM |
| Ga0062385_111241822 | 3300004080 | Bog Forest Soil | LNFTRRDFLAAGSAALIGLSLKSEKQIDGSFVNESAAAGHLVRDKASFPP |
| Ga0062384_1002819682 | 3300004082 | Bog Forest Soil | MNRRQFLTLSSAAVIGLSQKTDRPITGSFVNESFQAGHLLRDHASFPAPK |
| Ga0062387_1005122732 | 3300004091 | Bog Forest Soil | LKFKSAKFTRRKFLQSGSAALIGLSLKSEKHIDGSFVNESAAAGHLLRDRA |
| Ga0066672_107839841 | 3300005167 | Soil | LRISRRKFLQSGSAALIGLSVKGDRPITGGFVNDSFAMGHKLRVRAAFPIAKKFEKRTVV |
| Ga0066679_110288301 | 3300005176 | Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIAGSFVNDSFQMGHLLRDR |
| Ga0066688_109581691 | 3300005178 | Soil | MLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLLRDRA |
| Ga0070670_1020249331 | 3300005331 | Switchgrass Rhizosphere | LSLSRRKFLQSSSAALVGLSLKSDRPIAGSFVNDSFAQGHLL |
| Ga0066388_1032935281 | 3300005332 | Tropical Forest Soil | LKIGRRKFLGKGSAALIGLSLKNEKKIAGSFVNEAAATGHLLRD |
| Ga0070660_1006818072 | 3300005339 | Corn Rhizosphere | LSPSRRKFLQSTGAALVGLSLKTDQPMRGSFVNDSFQQGHLLRDRA |
| Ga0070709_108889082 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LNFSRRKFLQSSSAALVGLSLKSDRTIAGSFVNDSFQQGHLLRD |
| Ga0070732_105098471 | 3300005542 | Surface Soil | LRLGRRNFLRNASAALIGLSLKSERTIEGSFVNEAAATGH |
| Ga0066707_108122741 | 3300005556 | Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIAGSFVNDSF |
| Ga0066698_100605945 | 3300005558 | Soil | LKLGRRKFLGFGSAALVGLSLKSERKIEGSFVNDSFQMGHLLR |
| Ga0066700_109543811 | 3300005559 | Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIAGSFVNDSFQMGHLLR |
| Ga0066706_109166962 | 3300005598 | Soil | LKLGRRKFLGLGSAALVGLTLKSEKKIAGSFVNDSFQMG |
| Ga0070762_108501182 | 3300005602 | Soil | MRRRDFLTTTSAALIGLSLKSDRPIPGSFVNESAQLGHQLRDHA |
| Ga0070764_107617301 | 3300005712 | Soil | LKVGRRKFLRASSAALVGLSFKSDRPIAGSFVNDSFQMGHL |
| Ga0066903_1065831511 | 3300005764 | Tropical Forest Soil | LKIGRRKFLGKGSAALIGLSLKNEKKIAGSFVNEAAATGHLLRDHQPFPAASQAV |
| Ga0080026_101854532 | 3300005952 | Permafrost Soil | LKVDRRKFLGLGSAALVGLSLKGERAIAGSFVNESFQAGH |
| Ga0075029_1006431442 | 3300006052 | Watersheds | LKASRRQFLQSGSAALIGLSIKGDRAMAGSFVNDS |
| Ga0075029_1008356142 | 3300006052 | Watersheds | LTASRRTFLQSASAALVGLSIKGDRPIAGSFVNESFDLGHR |
| Ga0075017_1013192971 | 3300006059 | Watersheds | LKISRRKFLQNGSAALVGLSVKGDRPIAGSFVYDAFQSGHKLRDRS |
| Ga0075019_104695571 | 3300006086 | Watersheds | LSGTRRQFLQSASAALIGLSIKGDRTIAGSFVNDSLQLGHQIRDRAKFPEHRQVVKK |
| Ga0075015_1000473241 | 3300006102 | Watersheds | LKLGRRNFLGLGSAALVGLSLKSEKKIEGSFVNDSFQ |
| Ga0075030_1002824401 | 3300006162 | Watersheds | LKISRRKFLQNGSAALVGLSIKGERPIAGSFVNDSFQLGHRLR |
| Ga0070715_108041042 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLLRDR |
| Ga0070712_1008634741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LKIGRRKFLGTGSAALIGLSLKSERKIEGSFVNEAAAAGH |
| Ga0070765_1001859501 | 3300006176 | Soil | MDRRKFLGLSSAALIGLSVKSDRPIAGSFVNESVRAGHLLRDRASFPA |
| Ga0070765_1006820202 | 3300006176 | Soil | LKVARRKFLRTGSAALVGLSLKADRPIAGSFVNDSFQMGHLLR |
| Ga0070765_1015956171 | 3300006176 | Soil | LKVGRRKFLRASSAALVGLSFKSDRPIAGSFVNDSFQMGHLLRDS |
| Ga0079222_101709371 | 3300006755 | Agricultural Soil | LKIGRRKFLGTGSAALVGLSLKTDRPIAGSFVNDSFQM |
| Ga0079222_103832392 | 3300006755 | Agricultural Soil | LKLGRRKFLGLGSAALVGLSFKSEKRIEGSFVNDSLQMGHLLRDRTTF |
| Ga0066659_103415431 | 3300006797 | Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDS |
| Ga0066659_107537221 | 3300006797 | Soil | LKTTRREFCALGAAALVGLSLKSERPIAGSFVNDSFQLG |
| Ga0066660_108858212 | 3300006800 | Soil | LKTTRREFCAFSAAALVGLSVKADRPISGSFVNDSFQMGHLLRDRALFPAVR |
| Ga0079220_100329155 | 3300006806 | Agricultural Soil | LKLGRRKFLETSSAALIGLSLKSEKKIQGSFVNDSFQMGHLL |
| Ga0126370_113568582 | 3300010358 | Tropical Forest Soil | LKPQPPKINRRKFLSTTSAALIGLSLKSEEKITGEFVNE |
| Ga0126376_122657932 | 3300010359 | Tropical Forest Soil | LKIDRRKFLAVGSAGLLGLSLKSGEKIDGSFVNESFSAGHQ |
| Ga0126381_1018250492 | 3300010376 | Tropical Forest Soil | LTLSRRQFLHSASAALIGLSVKSDRPIAGSFVNDSFQLGHQLR |
| Ga0134126_115768872 | 3300010396 | Terrestrial Soil | LSLSRRKFLQSSSAALVGLSLKSDRPIAGSFVNDSFKQGHLLRDRVN |
| Ga0105246_108421192 | 3300011119 | Miscanthus Rhizosphere | LSLSRRKFLQSSSAALVGLSLKSDRPIAGSFVNDSFKQG |
| Ga0137389_103201031 | 3300012096 | Vadose Zone Soil | LKLGRRTFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHL |
| Ga0137383_101149114 | 3300012199 | Vadose Zone Soil | LKLGRRRFLGLGSAALVGLSLKSERKIEGSFVNDSFEIGPLLG |
| Ga0137363_101682733 | 3300012202 | Vadose Zone Soil | LKLGRRKFLGFGSAALVGLSIKSERKIEGSFVNDSFQMG |
| Ga0137362_101971081 | 3300012205 | Vadose Zone Soil | LKLGRRKFLELGSAALVGLSLKSEKKIEGSFVNDS |
| Ga0137377_106053951 | 3300012211 | Vadose Zone Soil | LKLGRRKFLGLGSGALVGLSLKSEKKVEGSFVNDSFPMGHLLRD |
| Ga0137384_113574592 | 3300012357 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSERKIEGSFVNDSFQIGHLLRDR |
| Ga0137358_101376151 | 3300012582 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLLRD |
| Ga0137358_104420451 | 3300012582 | Vadose Zone Soil | LKLDRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLLRD |
| Ga0137398_101215301 | 3300012683 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLL |
| Ga0137396_103496912 | 3300012918 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQM |
| Ga0137359_102254801 | 3300012923 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQTGHLL |
| Ga0164304_115494022 | 3300012986 | Soil | LRIGRRKFLGSGSAALVGLSLKTDRSITGSFVNDSF |
| Ga0134079_105358712 | 3300014166 | Grasslands Soil | LTISRRNFLQAGSAALIGLSVKGDLPIAGGFVNDFFQLGHKLRDRASFPQSKKV |
| Ga0181531_109875222 | 3300014169 | Bog | LKIRRRDFLRASSAALVGLSLKADTRIEGSFVNESFAA |
| Ga0137412_106855912 | 3300015242 | Vadose Zone Soil | LKLGRRKFLGLGRAALVGLSLKSEKKIEGSFVNDS |
| Ga0132258_121883482 | 3300015371 | Arabidopsis Rhizosphere | LSPSRRKFLQSTGAALVGLSLKTDQPMRGSFVNDSFQQGHLLRDRASF |
| Ga0182034_109394711 | 3300016371 | Soil | LKIGRRKFLGKGSAALIGLSLKNEKKITGSFVNEAAAAGHL |
| Ga0187817_101704412 | 3300017955 | Freshwater Sediment | LKIGRRQFLGTGSGALIGLSLKSDGKIKGSFVNEAVATGHLLRDRKPFPPPKKT |
| Ga0187822_102189672 | 3300017994 | Freshwater Sediment | LKVSRRKFLQAGSAALVGLSVKADRTIAGSFVNDSFPLGHLL |
| Ga0187810_102105562 | 3300018012 | Freshwater Sediment | LKMRTSRRKFLQSASAALIGLSIKGDRTIPGSFVNDSFQMGHQLRDRAS |
| Ga0187867_104274691 | 3300018033 | Peatland | LTASRRKFLQSTSAALIGLSIKGDRAISGRFVNDSFAL |
| Ga0187855_101938532 | 3300018038 | Peatland | LKTTRRNFLQSASAALVGLSAKGDQTLAGSFVNDSFQIGH |
| Ga0187859_106696531 | 3300018047 | Peatland | LSTTRREFLQSASAALIGLSIKGDRVIAGSFVNDSFQLGHQLRDRANFPQPTQI |
| Ga0187766_105663752 | 3300018058 | Tropical Peatland | LKLGRRKFLGLSSAALVGLSLKSEKKIEGSFVNDSFQMG |
| Ga0187771_103671933 | 3300018088 | Tropical Peatland | LTTSQRQLKASRRQFLQSASAALVGLTVKGGRAIAGSFV |
| Ga0187770_108599081 | 3300018090 | Tropical Peatland | LKTSRRDFLQTASAALIGMSIKADRQIAGSFVNDSFQL |
| Ga0066662_113699231 | 3300018468 | Grasslands Soil | LRISRRKFLQSGSAALIGLSVKGDRPITGGFVNDSFAMGHKLR |
| Ga0066662_129378131 | 3300018468 | Grasslands Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQIGHLLRDRAGFPAA |
| Ga0137408_10792851 | 3300019789 | Vadose Zone Soil | MNRRKFLTLTSAALINLSVKSDRPVAGSFVNESFQAGQSFQAGHQLRDHAAF |
| Ga0193751_11209082 | 3300019888 | Soil | LKIGRRKFLGTGSAALIGLSLKSERKIEGSFVNEAAAA |
| Ga0179592_102409352 | 3300020199 | Vadose Zone Soil | LKLDRRKFLGLGSAALVGLSLKSEKKIEGSFVNDS |
| Ga0210403_110727092 | 3300020580 | Soil | LKTSRREFLALSSAALVGLSVKSDRQIEGAFVNDSF |
| Ga0210401_112546521 | 3300020583 | Soil | LKVGRRKFLRAGSAALVGLSLKSDRPIAGSFVNDSFQMGHL |
| Ga0210404_101702422 | 3300021088 | Soil | LRVSRRKFLEASSAALIGLSVKGDRPIAGSFVNDA |
| Ga0210404_104237461 | 3300021088 | Soil | LKVGRRNFLRAGSAALVGLSLKTDRPIRGSFVNDSFQMGHLL |
| Ga0210406_100881521 | 3300021168 | Soil | LKLGRRNFLGFGSAALVGLSLKSEKKIAGSFVNDSFQMGHLLRDR |
| Ga0210396_113366671 | 3300021180 | Soil | MRRRDFLTTTSAALIGLSLKSDRPIPGSFVNESAQLGHQLRNHASFS |
| Ga0210393_104710231 | 3300021401 | Soil | MRRRDFLTTTSAALIGLSLKSDRPIPGSFVNESAQLGHQLRDHASFQTPT |
| Ga0210393_106832102 | 3300021401 | Soil | LKVGRRKFLRASSAAFVGLSLKSDRPIAGSFVNDSFQMGHLLRDSAPFPPPK |
| Ga0210385_102395352 | 3300021402 | Soil | LKLGRRKFLRAGSAALVGLSLKTDRPIAGSFVNDSFQMGHLLRE |
| Ga0210385_110655861 | 3300021402 | Soil | MNRRHFLAQTSAALIGLSLKSDRPLAGSFVNESAQLGH |
| Ga0210387_116296381 | 3300021405 | Soil | LRISRRKFLQSGSAALIGLSVKGDRPITGGLVNDSFAVGH |
| Ga0210386_117338311 | 3300021406 | Soil | LKVSRRKFLQAGSAALVGLSVKGDRPISGSFVNDSF |
| Ga0210383_117850182 | 3300021407 | Soil | LKIGRRKFLSVGSAALLGLTLKADRRIEGSFVNESAAAG |
| Ga0210410_114539582 | 3300021479 | Soil | LKVGRRKFLRAGSAALVGLSLKTDRPIRGSFVNDSFPMGHLLRDRAS |
| Ga0126371_108582682 | 3300021560 | Tropical Forest Soil | LKASRREFLQSASAALIGLSLKSDRGIAGTFVNDSFLQGHRL |
| Ga0126371_137710822 | 3300021560 | Tropical Forest Soil | MLGRRKFLRVGSAALVGLSLKSEQKIAGSFVNDSFQTGHLL |
| Ga0224544_10510091 | 3300023250 | Soil | LNFSRRKFLRTGSAALIGLSLKSEKQIEGSFINEAAAAGHLLRERTPFP |
| Ga0247673_10374471 | 3300024224 | Soil | LKVGRRKFLGAGSAALVGLSLKSDRPIAGSFVNDSFQM |
| Ga0247680_10455322 | 3300024246 | Soil | LKVGRRKFLGAGSAALVGLSLKSDRPIAGSFVNDSFQMGHM |
| Ga0179589_102053341 | 3300024288 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKRERKTEGSFVNDSFQMGHLLRDRAGFP |
| Ga0137417_14037531 | 3300024330 | Vadose Zone Soil | MKLGRRKFLGLGSAALVGLSLKSEKKIEGGFVNDSFQMGPISLF |
| Ga0209520_100846201 | 3300025319 | Soil | LNVSRRRFAQVGSAALIGLSVKADRPIAGSFVNDSFQLGHQLRD |
| Ga0207663_112878402 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LNFSRRKFLQSSSAALVGLSLKSDRTIAGSFVNDSFQQ |
| Ga0207694_102750911 | 3300025924 | Corn Rhizosphere | LSPSRRKFLQSTGAALVGLSLKTDQPMRGSFVNDSFQQGHLLRDRASFPPPKQK |
| Ga0207698_114173842 | 3300026142 | Corn Rhizosphere | LSPSRRKFLQSTGAALVGLSLKTDQPMRGSFVNDSFQQGHLLR |
| Ga0209235_10039941 | 3300026296 | Grasslands Soil | LKLGRRKFLGLGSAALVGLSLKNEKKIEGSFVNDSF |
| Ga0209240_10770761 | 3300026304 | Grasslands Soil | LKFGRRKFLGLGSAALVGLSLKSEKKIEGSFVNESFQIGHL |
| Ga0209158_12392301 | 3300026333 | Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHL |
| Ga0209377_12254612 | 3300026334 | Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIAGSFVNDS |
| Ga0257161_10186581 | 3300026508 | Soil | LKLGRRKFLSLGSAALVGLSLKSERKIEGGFVNDSFQMGHRLRDRA |
| Ga0257158_10503652 | 3300026515 | Soil | LKLGRRKFLGLGSAALVGLSLKSERKIEGGFVNDSFQMGHLLRD |
| Ga0209648_104888181 | 3300026551 | Grasslands Soil | LKFGRRKFLGLGSAALVGLSLKTERRIEGGFVNDSFQMGHLLRDRASFP |
| Ga0208098_10187591 | 3300027172 | Forest Soil | LRISRRKFLQSGSAALIGLSVKGDRPITGGFVNDSFAMGHKLRDRA |
| Ga0209421_11122201 | 3300027432 | Forest Soil | LTVSRRQFLQSASAALIGMSVKADRAIAGSFVNDSFQMGHQLRDRANY |
| Ga0209524_10551671 | 3300027521 | Forest Soil | MDRRKFLSLGSAALVGLSLKSERRIAGSFVNESFQAGHLLRDR |
| Ga0209528_11351611 | 3300027610 | Forest Soil | LKVGRRRFLGTSSAALVGLSLKSERHIEGAFVNDSFQMGHLLRDR |
| Ga0209625_10253221 | 3300027635 | Forest Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQIGHLLRDRAG |
| Ga0209588_10658162 | 3300027671 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSERKIAGSFVNDSFQIGHLLRDRASF |
| Ga0209588_12229892 | 3300027671 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSEKRIEGGFVNDSFQMGHLLRDRAAVP |
| Ga0209011_11470462 | 3300027678 | Forest Soil | MAGDQPLKTTRREFCAFGAAALVGLSVKSDRAITGEFVNDSFQLGHLLRDHA |
| Ga0209178_13614902 | 3300027725 | Agricultural Soil | LSLSRRKFLQSSSAALVGLSLKSDRPIAGSFVNDSFQQG |
| Ga0209693_101686032 | 3300027855 | Soil | LKVGRRKFLRAGSAALVGLALKTDRPITGSFVNDSLQMGHL |
| Ga0209283_103234932 | 3300027875 | Vadose Zone Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLLRDRVAF |
| Ga0209169_100640931 | 3300027879 | Soil | MRRREFLTTTSAALIGLSLKSDRPIPGSFVNESAQLGHQLRDHASF |
| Ga0209415_110823682 | 3300027905 | Peatlands Soil | LRTSRRKFLQSASAALVGLSIKGDRTITGSFVNDSFQVGHELRDRADFPQPKQVVKRAVV |
| Ga0209583_104789211 | 3300027910 | Watersheds | LRVSRRKFLQAGSAALVGLSVKGDRLIAGSFVNDAFQLGHKLR |
| Ga0209526_100225481 | 3300028047 | Forest Soil | LKLDRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQIGHLLRDRAEF |
| Ga0247675_10401771 | 3300028072 | Soil | LKIGRRKFLKAGSAALIGLSSKTESSLEGSYVNESAAAGHLLRDRYQFPAAKK |
| Ga0308309_114003781 | 3300028906 | Soil | MRRRDFLTTTSAALIGLSLKSDHPIPGSFVNESAQLGHQLRDHAS |
| Ga0311368_100091611 | 3300029882 | Palsa | LRTSRREFLQSASAALIGLSIKGGKPVEGSFVNDSFHLGHQ |
| Ga0311330_101681241 | 3300029945 | Bog | LSTTRREFLQSASAALIGLSIKGDRVIAGSFVNDSFQF |
| Ga0311342_101070315 | 3300029955 | Bog | LSTTRREFLQSASAALIGLSIKGDRVIAGSFVNDSFQLGHQLRDRANFPQPIQIV |
| Ga0311338_111695331 | 3300030007 | Palsa | LKASRRQFLQSASAALIGLSIKGDRTIAGTFVNDSFQMGHQLRDRATFS |
| Ga0265720_10251801 | 3300030764 | Soil | LKVGRRKFLRASSAALVGLSLKTDRPIAGSFVNDSFQMGHL |
| Ga0265750_10168632 | 3300030813 | Soil | LKVGRRKFLRASSAALVGLSLKTDRPIAGSFVNDSFQMGHLLRDR |
| Ga0170834_1000285492 | 3300031057 | Forest Soil | LKLGRRKFLGLGSAALVGLSLKSEKKIEGSFVNDSFQMGHLLRDRAGL |
| Ga0170834_1019222811 | 3300031057 | Forest Soil | LKVGRRKFLRSGSAALVGLSLKTDRPIAGSFVNDSFQ |
| Ga0265760_100709171 | 3300031090 | Soil | LKVGRRKFLHSGSAALIGLSLKADRPIAGSFVNDSFQMGHLLRD |
| Ga0170824_1013387552 | 3300031231 | Forest Soil | LKLGRRKFLGLASAALVGLSLKSEKKIEGSFVNDSFQMGQ |
| Ga0170818_1124991162 | 3300031474 | Forest Soil | LKIGRRKFLGTGSAALIGLSLKSERKIEGSFVNEAAAAGHLLRDRKSF |
| Ga0318560_101408832 | 3300031682 | Soil | LKLSRRKFLQAGSAALIGLSVKADRAITGGFVNDSSQLGHLLR |
| Ga0310686_1007575372 | 3300031708 | Soil | LKLDRRAFIRTGSAALVGLSVKGDREIEGAFVNDSFQMG |
| Ga0307476_112813552 | 3300031715 | Hardwood Forest Soil | LKLGRRKFLGLGGAALVGLSLKGERKIEGSFVNDSFPMGHLLRDRA |
| Ga0307469_108674102 | 3300031720 | Hardwood Forest Soil | LRMSRRKFLETGSAALIGLSIKGDRFIAGGFVNESFQLGHKLRDH |
| Ga0318501_102430411 | 3300031736 | Soil | LKLSRRKFLQAGSAALIGLSVKADRAITGGFVNDSFQ |
| Ga0307475_114991421 | 3300031754 | Hardwood Forest Soil | LKASRRQFLQSGSAALIGLSLKGDRAIAGSFVNDSFQLGHQLRDRAQFP |
| Ga0307479_1000429115 | 3300031962 | Hardwood Forest Soil | LRIGRRKFLGTGSAALIGLSLKSERKIEGSFVNEAATAGHLLRDRKSF |
| Ga0318558_104354281 | 3300032044 | Soil | LKLSRRKFLQAGSAALIGLSVKADRAITGGFVNDSFQLGHLLRDRAAFP |
| Ga0307471_1003019882 | 3300032180 | Hardwood Forest Soil | LKPSRRQFLQSGSAALIGLSIKGDRAIAGSFVNDSFQLGHQLRDR |
| Ga0310812_105767231 | 3300032421 | Soil | LSLSRRKFLQSSSAALVGLSLKSDRPIAGSFVNDSFKQGHLLRD |
| Ga0335080_117949572 | 3300032828 | Soil | LKIGRRNFLKAASAGLVGLSLKADDKIEGSFVNESAAAGHLL |
| Ga0335070_110490961 | 3300032829 | Soil | MSTRRQFLKQCSAAVIGLTIKGGRPIAGSFVNDSFPAGHKLR |
| Ga0335075_106006712 | 3300032896 | Soil | LKVGRRKFLRAGSAALVGLSFKTDRPIAGSFVNDSFQMGHRLRDHAF |
| Ga0335071_109145802 | 3300032897 | Soil | LSASRRQFLQSASAALIGLSIKGDRKIAGSFANDSFQLGHQLRDRAKFPSR |
| ⦗Top⦘ |