| Basic Information | |
|---|---|
| Family ID | F048547 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 50 residues |
| Representative Sequence | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 15.54 % |
| % of genes from short scaffolds (< 2000 bps) | 80.41 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.973 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.162 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.432 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF13416 | SBP_bac_8 | 20.27 |
| PF01547 | SBP_bac_1 | 14.19 |
| PF01546 | Peptidase_M20 | 10.81 |
| PF01740 | STAS | 4.05 |
| PF00528 | BPD_transp_1 | 2.03 |
| PF07969 | Amidohydro_3 | 1.35 |
| PF03949 | Malic_M | 0.68 |
| PF03992 | ABM | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.68 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.32 % |
| Unclassified | root | N/A | 0.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459007|GJ61VE201B7D8D | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 516 | Open in IMG/M |
| 3300000955|JGI1027J12803_102202519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 653 | Open in IMG/M |
| 3300003659|JGI25404J52841_10005110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2702 | Open in IMG/M |
| 3300003659|JGI25404J52841_10015466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1655 | Open in IMG/M |
| 3300003911|JGI25405J52794_10068986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300004153|Ga0063455_101228466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
| 3300004633|Ga0066395_10522526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300004801|Ga0058860_11471246 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005167|Ga0066672_10172383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1367 | Open in IMG/M |
| 3300005171|Ga0066677_10041289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2264 | Open in IMG/M |
| 3300005172|Ga0066683_10042913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2650 | Open in IMG/M |
| 3300005175|Ga0066673_10881697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 509 | Open in IMG/M |
| 3300005178|Ga0066688_10880934 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005328|Ga0070676_10044313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2589 | Open in IMG/M |
| 3300005328|Ga0070676_11537117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 513 | Open in IMG/M |
| 3300005334|Ga0068869_100060016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2786 | Open in IMG/M |
| 3300005339|Ga0070660_100425671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1100 | Open in IMG/M |
| 3300005340|Ga0070689_100173789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1746 | Open in IMG/M |
| 3300005366|Ga0070659_100337038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1263 | Open in IMG/M |
| 3300005439|Ga0070711_101025447 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 709 | Open in IMG/M |
| 3300005441|Ga0070700_100243406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1286 | Open in IMG/M |
| 3300005456|Ga0070678_100079476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2481 | Open in IMG/M |
| 3300005457|Ga0070662_100070228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2580 | Open in IMG/M |
| 3300005467|Ga0070706_101875421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 544 | Open in IMG/M |
| 3300005518|Ga0070699_100680471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 939 | Open in IMG/M |
| 3300005536|Ga0070697_100905612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300005549|Ga0070704_100244755 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300005552|Ga0066701_10014731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1743 | 3710 | Open in IMG/M |
| 3300005556|Ga0066707_10455424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 830 | Open in IMG/M |
| 3300005574|Ga0066694_10428136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 620 | Open in IMG/M |
| 3300005576|Ga0066708_10393677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300005577|Ga0068857_100044648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1743 | 3932 | Open in IMG/M |
| 3300005586|Ga0066691_10253595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1033 | Open in IMG/M |
| 3300005598|Ga0066706_10478338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 992 | Open in IMG/M |
| 3300005616|Ga0068852_100144262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2207 | Open in IMG/M |
| 3300005713|Ga0066905_100653759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
| 3300005981|Ga0081538_10098987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1475 | Open in IMG/M |
| 3300005983|Ga0081540_1255270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 611 | Open in IMG/M |
| 3300006032|Ga0066696_10618656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 702 | Open in IMG/M |
| 3300006041|Ga0075023_100098103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1009 | Open in IMG/M |
| 3300006048|Ga0075363_100068240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1928 | Open in IMG/M |
| 3300006050|Ga0075028_100038803 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300006162|Ga0075030_100415405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1072 | Open in IMG/M |
| 3300006172|Ga0075018_10024338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2369 | Open in IMG/M |
| 3300006172|Ga0075018_10724737 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006175|Ga0070712_100277504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1348 | Open in IMG/M |
| 3300006178|Ga0075367_10049252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2483 | Open in IMG/M |
| 3300006186|Ga0075369_10029722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2297 | Open in IMG/M |
| 3300006354|Ga0075021_10063651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2148 | Open in IMG/M |
| 3300006796|Ga0066665_10281499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300006854|Ga0075425_100732645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1134 | Open in IMG/M |
| 3300006871|Ga0075434_101909508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 600 | Open in IMG/M |
| 3300009012|Ga0066710_103322080 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009094|Ga0111539_10475134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1456 | Open in IMG/M |
| 3300009101|Ga0105247_10037163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2971 | Open in IMG/M |
| 3300009137|Ga0066709_102804854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300009156|Ga0111538_10603238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1392 | Open in IMG/M |
| 3300009176|Ga0105242_10881517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300010046|Ga0126384_11429325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 646 | Open in IMG/M |
| 3300010047|Ga0126382_12417398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium liaoningense | 510 | Open in IMG/M |
| 3300010333|Ga0134080_10274415 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010358|Ga0126370_11606983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 622 | Open in IMG/M |
| 3300010364|Ga0134066_10418953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 515 | Open in IMG/M |
| 3300010371|Ga0134125_10404293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1514 | Open in IMG/M |
| 3300010398|Ga0126383_11598144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 741 | Open in IMG/M |
| 3300010400|Ga0134122_11340343 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010401|Ga0134121_10441307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1186 | Open in IMG/M |
| 3300011106|Ga0151489_1010744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300011119|Ga0105246_10639067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 925 | Open in IMG/M |
| 3300012201|Ga0137365_11190805 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012202|Ga0137363_10187508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1651 | Open in IMG/M |
| 3300012203|Ga0137399_10811726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
| 3300012204|Ga0137374_10777458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 712 | Open in IMG/M |
| 3300012205|Ga0137362_10178808 | Not Available | 1822 | Open in IMG/M |
| 3300012211|Ga0137377_10097963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2775 | Open in IMG/M |
| 3300012355|Ga0137369_10174752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1683 | Open in IMG/M |
| 3300012358|Ga0137368_10296958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
| 3300012359|Ga0137385_10517175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1009 | Open in IMG/M |
| 3300012361|Ga0137360_10657902 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300012469|Ga0150984_123071356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 616 | Open in IMG/M |
| 3300012685|Ga0137397_10224797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1397 | Open in IMG/M |
| 3300012918|Ga0137396_10600273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 814 | Open in IMG/M |
| 3300012929|Ga0137404_11779087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300012930|Ga0137407_12213763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300012948|Ga0126375_10612769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 833 | Open in IMG/M |
| 3300012951|Ga0164300_10674122 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012955|Ga0164298_10657576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 729 | Open in IMG/M |
| 3300012960|Ga0164301_10967280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 666 | Open in IMG/M |
| 3300012961|Ga0164302_10018314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2970 | Open in IMG/M |
| 3300012984|Ga0164309_10858844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300012987|Ga0164307_11546979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 561 | Open in IMG/M |
| 3300012988|Ga0164306_11758080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 538 | Open in IMG/M |
| 3300013105|Ga0157369_10909165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 902 | Open in IMG/M |
| 3300013297|Ga0157378_10853672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 939 | Open in IMG/M |
| 3300013306|Ga0163162_12557500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 587 | Open in IMG/M |
| 3300014969|Ga0157376_11215254 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300015241|Ga0137418_10821752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 694 | Open in IMG/M |
| 3300015242|Ga0137412_10491509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 940 | Open in IMG/M |
| 3300015262|Ga0182007_10204790 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 691 | Open in IMG/M |
| 3300015265|Ga0182005_1194285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300015357|Ga0134072_10369513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 556 | Open in IMG/M |
| 3300015373|Ga0132257_104065011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300017792|Ga0163161_10263992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
| 3300018031|Ga0184634_10140706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1078 | Open in IMG/M |
| 3300018061|Ga0184619_10129303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1146 | Open in IMG/M |
| 3300018074|Ga0184640_10369218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300018076|Ga0184609_10029010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2260 | Open in IMG/M |
| 3300018081|Ga0184625_10075197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1722 | Open in IMG/M |
| 3300018431|Ga0066655_10028812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2682 | Open in IMG/M |
| 3300018433|Ga0066667_11145746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 674 | Open in IMG/M |
| 3300018468|Ga0066662_11403752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300018482|Ga0066669_11360662 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300020579|Ga0210407_10982132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300021170|Ga0210400_11132936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 632 | Open in IMG/M |
| 3300021479|Ga0210410_10158692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2017 | Open in IMG/M |
| 3300022694|Ga0222623_10054299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1542 | Open in IMG/M |
| 3300025899|Ga0207642_10446881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 782 | Open in IMG/M |
| 3300025903|Ga0207680_10195487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1375 | Open in IMG/M |
| 3300025903|Ga0207680_10279479 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300025920|Ga0207649_10281361 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300025932|Ga0207690_10075546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2337 | Open in IMG/M |
| 3300025933|Ga0207706_10044399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3939 | Open in IMG/M |
| 3300025942|Ga0207689_10656821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| 3300025949|Ga0207667_10839855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 913 | Open in IMG/M |
| 3300026075|Ga0207708_10122129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2030 | Open in IMG/M |
| 3300026089|Ga0207648_10075663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2935 | Open in IMG/M |
| 3300026118|Ga0207675_100027467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5300 | Open in IMG/M |
| 3300026121|Ga0207683_10100775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2578 | Open in IMG/M |
| 3300026324|Ga0209470_1287475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 621 | Open in IMG/M |
| 3300026325|Ga0209152_10100079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1091 | Open in IMG/M |
| 3300026327|Ga0209266_1067351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1680 | Open in IMG/M |
| 3300026333|Ga0209158_1191965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 720 | Open in IMG/M |
| 3300026524|Ga0209690_1044685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2019 | Open in IMG/M |
| 3300026548|Ga0209161_10193615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1132 | Open in IMG/M |
| 3300027775|Ga0209177_10250889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300027866|Ga0209813_10041650 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300027911|Ga0209698_10268573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
| 3300027915|Ga0209069_10010686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4443 | Open in IMG/M |
| 3300027915|Ga0209069_10640312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
| 3300028380|Ga0268265_10830666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 903 | Open in IMG/M |
| 3300028711|Ga0307293_10122308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300030993|Ga0308190_1119439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300031058|Ga0308189_10018864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1589 | Open in IMG/M |
| 3300031199|Ga0307495_10137433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300031474|Ga0170818_111748479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 991 | Open in IMG/M |
| 3300031715|Ga0307476_10440396 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300031740|Ga0307468_100380482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1068 | Open in IMG/M |
| 3300031847|Ga0310907_10159639 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_05531940 | 2170459007 | Grass Soil | LLVLHSPRRGGEFAAKQSEFFAERRRDYIAPGRNGDTTGGLDRGGAAARA |
| JGI1027J12803_1022025192 | 3300000955 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPGRNGDTTGGLDRVGAAASA* |
| JGI25404J52841_100051103 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MRWPDDHLLVIHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDATGGLDRVGAAATP* |
| JGI25404J52841_100154662 | 3300003659 | Tabebuia Heterophylla Rhizosphere | LLVFHLQRRGGEFVAKQEEFFAERRRDYIAPSRNGDTTGGLDRVGAAASA* |
| JGI25405J52794_100689861 | 3300003911 | Tabebuia Heterophylla Rhizosphere | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGVAASACTLPS* |
| Ga0063455_1012284662 | 3300004153 | Soil | MYWLDDHLVAFHLQRRGGEFAANQGAFFAEQRRDCIAPNRNGDTIGGLDHVGAAASA* |
| Ga0066395_105225261 | 3300004633 | Tropical Forest Soil | MRWLDDHLLVFHLQRCGGEFAAKQVEFFAEQRRDCIVPNRNDDTAGGLDRVGA |
| Ga0058860_114712462 | 3300004801 | Host-Associated | LLVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA* |
| Ga0066672_101723832 | 3300005167 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066677_100412892 | 3300005171 | Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066683_100429133 | 3300005172 | Soil | LVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066673_108816971 | 3300005175 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQWRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066688_108809342 | 3300005178 | Soil | LLVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0070676_100443133 | 3300005328 | Miscanthus Rhizosphere | LVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA* |
| Ga0070676_115371172 | 3300005328 | Miscanthus Rhizosphere | RGGEFAANQGAFFAEQRRDCIAPNRNGDTIGGLDHVGAAASA* |
| Ga0068869_1000600162 | 3300005334 | Miscanthus Rhizosphere | LHWLDDPLVAFHLQRRGGEFAANQGAFFAEQRRDCIAPNRNGDTIGGLDHVGAAASA* |
| Ga0070660_1004256713 | 3300005339 | Corn Rhizosphere | LQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAAASA* |
| Ga0070689_1001737891 | 3300005340 | Switchgrass Rhizosphere | GEFAAKPHEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0070659_1003370382 | 3300005366 | Corn Rhizosphere | LLVLHLQRRGGEFAAKPGKFLAEQRRDYIAPSRNGDTTGGL |
| Ga0070711_1010254472 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0070700_1002434062 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0070678_1000794761 | 3300005456 | Miscanthus Rhizosphere | LQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA* |
| Ga0070662_1000702283 | 3300005457 | Corn Rhizosphere | LVLQLQRRGGEFAAKPGEFLAEQRRDYIAPSRNGDTTGGLDRVGAASA* |
| Ga0070706_1018754211 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | CGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0070699_1006804712 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LVFHLQRRGGEFVAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0070697_1009056122 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0070704_1002447551 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAAASA* |
| Ga0066701_100147314 | 3300005552 | Soil | LVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRSGDTTGGLDRVGAAASA* |
| Ga0066707_104554241 | 3300005556 | Soil | LVFHLQRRGGEFAAKQGDFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066694_104281362 | 3300005574 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQWRDYTAPSRNGDTTGGLDRVGAAASA* |
| Ga0066708_103936772 | 3300005576 | Soil | LVFHLQRRGGEFAAKQGEFFAEQWRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0068857_1000446485 | 3300005577 | Corn Rhizosphere | LVLHLQRRGGEFAAKPGEFLAEQRRDYIAPSRNGDTTGGLDRVGAASA* |
| Ga0066691_102535952 | 3300005586 | Soil | LVFHLQRRGGEFAAKQGEFFAEQRGDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0066706_104783382 | 3300005598 | Soil | LVFHLQRRGGEFAAKQGEFFAEQWRDYTAPSRNGDTTGGLDRVGAAASA* |
| Ga0068852_1001442622 | 3300005616 | Corn Rhizosphere | LLVLHLQRRGGEFAAKPGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066905_1006537592 | 3300005713 | Tropical Forest Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGALDCVGAAASAWTLPS* |
| Ga0081538_100989871 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRWLDECLLVLDLQRRVGEFAAKQDEFFAEQGGDYIVSSRNGDTTGGLNRVGAAASA* |
| Ga0081540_12552701 | 3300005983 | Tabebuia Heterophylla Rhizosphere | IRLLDDHLLVFHLQRRSGEFVAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066696_106186561 | 3300006032 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQWRDYIAPRRNGDTTGGLDRVGAAASV* |
| Ga0075023_1000981032 | 3300006041 | Watersheds | LVFHLQRRGGEFAAKQGEFFAEQRRGYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0075363_1000682402 | 3300006048 | Populus Endosphere | LVLHLQRRGGEFAAKPGKFLAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0075028_1000388032 | 3300006050 | Watersheds | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTMGGLNRVGAAASA* |
| Ga0075030_1004154052 | 3300006162 | Watersheds | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTMGGLNR |
| Ga0075018_100243383 | 3300006172 | Watersheds | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTMGGLNRVGAAASA* |
| Ga0075018_107247372 | 3300006172 | Watersheds | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASASTLPS* |
| Ga0070712_1002775041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDSTGGLDRVGAAASA* |
| Ga0075367_100492523 | 3300006178 | Populus Endosphere | LVLHLQRRGGEFAAKPGEFLAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0075369_100297223 | 3300006186 | Populus Endosphere | LVLHLQRRGGEFAAKPGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0075021_100636512 | 3300006354 | Watersheds | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTMGGLDRVGAAASA* |
| Ga0066665_102814991 | 3300006796 | Soil | LLVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRSGDTTGGLDRVGAAASA* |
| Ga0075425_1007326452 | 3300006854 | Populus Rhizosphere | LLVLHLQRRGGEFAAKPGKFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0075434_1019095082 | 3300006871 | Populus Rhizosphere | MHGLDDHSVVFHLQRRGGEFAANQGALFAEQRRDCIAPNRNGDTIGGLDGGLDQVGAAASA* |
| Ga0066710_1033220801 | 3300009012 | Grasslands Soil | LLVFHLQRRGGEFAAKQGEFFAEQWRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0111539_104751342 | 3300009094 | Populus Rhizosphere | LVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAAASA* |
| Ga0105247_100371633 | 3300009101 | Switchgrass Rhizosphere | LLVLHLQRRGGEFAAKPHEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0066709_1028048541 | 3300009137 | Grasslands Soil | LVVFHLQRRGGEFAANQGGFFAEQRRDYIVANRNGDTTGGLDRVGAAGSA* |
| Ga0111538_106032381 | 3300009156 | Populus Rhizosphere | LQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGSAASA* |
| Ga0105242_108815171 | 3300009176 | Miscanthus Rhizosphere | LVFHLQRRGGEFVAKQGEFFAEQRRDYIAPSCNGDTTGGLDRVGAAARA* |
| Ga0126384_114293251 | 3300010046 | Tropical Forest Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDSTGGLDRVGAAASAWTPPS* |
| Ga0126382_124173981 | 3300010047 | Tropical Forest Soil | LVFCLQRRGGEFATKQDEFFAEQRRDYVVRRNGDTTGGLDRVGAAASACTLPS* |
| Ga0134080_102744152 | 3300010333 | Grasslands Soil | LVLHLQRCGGEFAAKQGEFFAVQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0126370_116069832 | 3300010358 | Tropical Forest Soil | MRWLDDHLLVFHLQRCGGEFAAKQVEFFAEQRRDCIVPNRNDDTAGGLDRVGAAASA* |
| Ga0134066_104189532 | 3300010364 | Grasslands Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIVPSRNGYTTGGLDRIGAAASA* |
| Ga0134125_104042932 | 3300010371 | Terrestrial Soil | LLVLHLQRRGGEFAAKPGEFFAEQRRDYVAPSRNGDTTGGLDRVGAASA* |
| Ga0126383_115981442 | 3300010398 | Tropical Forest Soil | VACIMRWLDDHLLVFHLQRCGGEFAAKQVEFFAEQRRDCIVPNRNDDTAGGLDRVGAAASA* |
| Ga0134122_113403431 | 3300010400 | Terrestrial Soil | LVFHLQRRGGEFAAKQGELFAEQRRDYIAPSRNGDATGGLDRVGAAARA* |
| Ga0134121_104413072 | 3300010401 | Terrestrial Soil | MYWLDDHLVAFHLQRRGGEFAASQGAFFAGQRHDCIAPNRNGDTTGGLDHVGAAASA* |
| Ga0151489_10107442 | 3300011106 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDATGGLDRACAAAST* |
| Ga0105246_106390672 | 3300011119 | Miscanthus Rhizosphere | LLVLHLQRRGGEFAAKPGKFLAEQRRDYIAPSRNGDTTGGLDRVGAASA* |
| Ga0137365_111908051 | 3300012201 | Vadose Zone Soil | LLVFHLQRRGGEFAAKQGDFFAEQRRDYIAPSRNGDTTGGPDRVGAAASA* |
| Ga0137363_101875083 | 3300012202 | Vadose Zone Soil | CAIRWLDDHLLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0137399_108117262 | 3300012203 | Vadose Zone Soil | LVFHLQRRGGEFAATQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0137374_107774581 | 3300012204 | Vadose Zone Soil | LLVFHLQRRGGEFAAKQGEFFAEQQRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0137362_101788083 | 3300012205 | Vadose Zone Soil | LLVFHLQRRGGEFVAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0137377_100979633 | 3300012211 | Vadose Zone Soil | LVFHLQRRGGEFAAKQGDFFAEQRRDYIAPSRNGDTTGGPDRVGAAASA* |
| Ga0137369_101747522 | 3300012355 | Vadose Zone Soil | LVFHLPRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0137368_102969582 | 3300012358 | Vadose Zone Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDSVGAAASA* |
| Ga0137385_105171752 | 3300012359 | Vadose Zone Soil | VRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0137360_106579021 | 3300012361 | Vadose Zone Soil | LVFHLQRRGGEFATKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0150984_1230713561 | 3300012469 | Avena Fatua Rhizosphere | LLVFHLQRRGDEFAAKQGEFFAEQRRDYVVPNRNGDTTGGLDRVGAAASA* |
| Ga0137397_102247973 | 3300012685 | Vadose Zone Soil | LLVFHLQRRGGEFAATQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0137396_106002731 | 3300012918 | Vadose Zone Soil | LLVFHLQRRGGEFAATQGEFFAEQRRDYIVPNRYGDATGGLDRVGAAASA* |
| Ga0137404_117790872 | 3300012929 | Vadose Zone Soil | MFHLQRRGGEFVAKRGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0137407_122137632 | 3300012930 | Vadose Zone Soil | LLDDHLLVFHLQRRGGEFAATQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0126375_106127692 | 3300012948 | Tropical Forest Soil | LVFHLQRRVGEFAAKQGEFFAEQRRDCIVPNRNGDTTSGLDRVGAAASA* |
| Ga0164300_106741221 | 3300012951 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGVLERVAAAASA* |
| Ga0164298_106575761 | 3300012955 | Soil | LQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0164301_109672801 | 3300012960 | Soil | RRPDDHLLVFHLQRRVGEFAAKQGAFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0164302_100183143 | 3300012961 | Soil | LVFHLHRRGGEFATKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0164309_108588442 | 3300012984 | Soil | LVFHLQRRGGEFATKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0164307_115469791 | 3300012987 | Soil | LDDHLLVFHLQRRGDEFAAKQGEFFAEQRRDYVVPNRNGDTTGGLDRVGAAASA* |
| Ga0164306_117580801 | 3300012988 | Soil | LVFHLQRSGGEFAVKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0157369_109091652 | 3300013105 | Corn Rhizosphere | LVFHLQRSGGELAAKRGESFAEQRHDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0157378_108536722 | 3300013297 | Miscanthus Rhizosphere | LVLQLQRRGGEFGAKPGKFLAEQRRDYIAPSRNGDTTGGLDRVGAAASA* |
| Ga0163162_125575002 | 3300013306 | Switchgrass Rhizosphere | MQRRGGEFAAKQGEFFADQRRDYIVPSRNGDTTGGLDRVGAAASA* |
| Ga0157376_112152542 | 3300014969 | Miscanthus Rhizosphere | LVFHLQRRCGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASACTPPS* |
| Ga0137418_108217522 | 3300015241 | Vadose Zone Soil | AIRWLDDHLLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0137412_104915092 | 3300015242 | Vadose Zone Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA* |
| Ga0182007_102047902 | 3300015262 | Rhizosphere | DHLMVFRLQRRGGEFAANQGGFFAVQRRDCIAPNRNGDTIGGLDHVGAAASA* |
| Ga0182005_11942851 | 3300015265 | Rhizosphere | LLVLHFQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA* |
| Ga0134072_103695131 | 3300015357 | Grasslands Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPSRNGYTTGGLDRIGAAASA* |
| Ga0132257_1040650111 | 3300015373 | Arabidopsis Rhizosphere | LLVFHLQRRGGEFVAKQGELFAEQRRDYIVPNRNGDTTGGLDRVGAAAST* |
| Ga0163161_102639922 | 3300017792 | Switchgrass Rhizosphere | LVLHLQRRGGEFAAKPGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0184634_101407062 | 3300018031 | Groundwater Sediment | LLVFHLQRRGGEFVAKQDEFFAEQRRDYFAPSRNGDTTGGLDRVGAAASA |
| Ga0184619_101293031 | 3300018061 | Groundwater Sediment | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPSRSGDTTGGLDRVGAAASACTLPS |
| Ga0184640_103692181 | 3300018074 | Groundwater Sediment | LLVFHLQRRGGEFVAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAAST |
| Ga0184609_100290101 | 3300018076 | Groundwater Sediment | MQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGTAAST |
| Ga0184625_100751972 | 3300018081 | Groundwater Sediment | LVFHLQRRGGEFVAKQDEFFAEQRRDYFAPSRNGDTTGGLDRVGAAASA |
| Ga0066655_100288121 | 3300018431 | Grasslands Soil | LVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0066667_111457461 | 3300018433 | Grasslands Soil | LVFHLQRRGGEFAAKQGEFFAEQWRDYIAPRRNGDTTGGLDRVGAAASA |
| Ga0066662_114037522 | 3300018468 | Grasslands Soil | LLVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRSGDTTGGLDRVGAAASA |
| Ga0066669_113606621 | 3300018482 | Grasslands Soil | LVFHLQRRGGEFAAKQGEFFAEQWRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0210407_109821322 | 3300020579 | Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA |
| Ga0210400_111329362 | 3300021170 | Soil | DHLLVFHLQRRGGEFAAKQGEFYAEQRRDCIAPSRNGDTTGGLDRVGAAASA |
| Ga0210410_101586921 | 3300021479 | Soil | LLVFHLQRRGGEFAAKPGEFFAEQRRDYIAPSRNGDSTGGLDRVGAAASA |
| Ga0222623_100542991 | 3300022694 | Groundwater Sediment | LVFHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGTAAST |
| Ga0207642_104468812 | 3300025899 | Miscanthus Rhizosphere | LLVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA |
| Ga0207680_101954872 | 3300025903 | Switchgrass Rhizosphere | LVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA |
| Ga0207680_102794792 | 3300025903 | Switchgrass Rhizosphere | LHWLDDPLVAFHLQRRGGGFAANQGAFFAEQRRDCIAPNRNGDTIGGLDHVGDAASA |
| Ga0207649_102813612 | 3300025920 | Corn Rhizosphere | LQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAAASA |
| Ga0207690_100755462 | 3300025932 | Corn Rhizosphere | LLVLHLQRRGGEFAAKPGKFLAEQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0207706_100443992 | 3300025933 | Corn Rhizosphere | LVLHLQRRGGEFAAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAASA |
| Ga0207689_106568212 | 3300025942 | Miscanthus Rhizosphere | RRGGEFAANQGAFFAEQRRDCIAPNRNGDTIGGLDHVGAAASA |
| Ga0207667_108398552 | 3300025949 | Corn Rhizosphere | LHWLDDPLVAFHLQRRGGEFAASQGAFFAGQRHDCIAPNRNGDTTGGLDHVGAAASA |
| Ga0207708_101221293 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAASA |
| Ga0207648_100756632 | 3300026089 | Miscanthus Rhizosphere | LLVLQLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA |
| Ga0207675_1000274676 | 3300026118 | Switchgrass Rhizosphere | LVLHLQRRGGEFAAKPGEFFAEQRRDYIAPSRNGDTTGGLDCVGAAASA |
| Ga0207683_101007752 | 3300026121 | Miscanthus Rhizosphere | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAASA |
| Ga0209470_12874752 | 3300026324 | Soil | AIRWLDDHLLVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0209152_101000791 | 3300026325 | Soil | LLVFHVQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0209266_10673512 | 3300026327 | Soil | LLVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0209158_11919651 | 3300026333 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0209690_10446851 | 3300026524 | Soil | LVFHLQRRGGEFAAKQGEFFAVQRRDYIAPSRSGDTTGGLDRVGAAASA |
| Ga0209161_101936152 | 3300026548 | Soil | LVFHLQRRGGEFAAKQGEFFAEQWRDYTAPSRNGDTTGGLDRVGAAASA |
| Ga0209177_102508892 | 3300027775 | Agricultural Soil | LLVLHLQRRGGEFAAKPGEFLAEQRRDYIAPSRNGDTTGGLDRVGAAASA |
| Ga0209813_100416502 | 3300027866 | Populus Endosphere | LQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAASA |
| Ga0209698_102685732 | 3300027911 | Watersheds | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTMGGLNRVGAAASA |
| Ga0209069_100106863 | 3300027915 | Watersheds | LLVFHLQRRGGEFAAKQGEFFAEQRRGYIVPNRNGDTTGGLDRVGAAASA |
| Ga0209069_106403121 | 3300027915 | Watersheds | HLLVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTMGGLNRVGAAASA |
| Ga0268265_108306662 | 3300028380 | Switchgrass Rhizosphere | LVLHLQRRGGEFAAKPGEFLAEQRRDYVAPSRNGDTTGGLDRVGAAASA |
| Ga0307293_101223081 | 3300028711 | Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIVPSRNGYTTGGLDRIGAAASA |
| Ga0308190_11194391 | 3300030993 | Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPSRNGYTTGGLDRIGAAASA |
| Ga0308189_100188642 | 3300031058 | Soil | LVFHLQRRGGEFVAKQGEFFAEQRRDYIVPNRNGDTTGGLDRVGAAAST |
| Ga0307495_101374332 | 3300031199 | Soil | LLVFHLQRRGGEFVAKQGEFFAEQRRDYVVPNRNGDTTGGLDRVGAAASACTPPS |
| Ga0170818_1117484792 | 3300031474 | Forest Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDRVGAAASP |
| Ga0307476_104403962 | 3300031715 | Hardwood Forest Soil | LVFHLQRRGGEFAGKQGEFAEQRRDHIAPSRNGDTTGGLDRVGAAASA |
| Ga0307468_1003804822 | 3300031740 | Hardwood Forest Soil | LLVFHLQRRGGEFAAKQGEFFAEQRRDYIVPSRNGDTTGGLDRVGAAASA |
| Ga0310907_101596392 | 3300031847 | Soil | LVFHLQRRGGEFAAKQGEFFAEQRRDYIAPSRNGDTTGGLDCVGAAASA |
| ⦗Top⦘ |