| Basic Information | |
|---|---|
| Family ID | F048523 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AVAAMRAALADDLDVPAALRIAEEEGGQAARSLGTLLGLW |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.37 % |
| % of genes near scaffold ends (potentially truncated) | 94.59 % |
| % of genes from short scaffolds (< 2000 bps) | 91.89 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.973 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.568 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.919 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF01895 | PhoU | 14.86 |
| PF02583 | Trns_repr_metal | 6.08 |
| PF01844 | HNH | 4.05 |
| PF12706 | Lactamase_B_2 | 3.38 |
| PF03551 | PadR | 2.70 |
| PF13649 | Methyltransf_25 | 2.70 |
| PF00425 | Chorismate_bind | 2.03 |
| PF13421 | Band_7_1 | 2.03 |
| PF00581 | Rhodanese | 2.03 |
| PF00392 | GntR | 2.03 |
| PF01545 | Cation_efflux | 2.03 |
| PF07992 | Pyr_redox_2 | 1.35 |
| PF03466 | LysR_substrate | 1.35 |
| PF08044 | DUF1707 | 1.35 |
| PF13302 | Acetyltransf_3 | 1.35 |
| PF02720 | DUF222 | 1.35 |
| PF00903 | Glyoxalase | 1.35 |
| PF02613 | Nitrate_red_del | 1.35 |
| PF01925 | TauE | 1.35 |
| PF02774 | Semialdhyde_dhC | 0.68 |
| PF13193 | AMP-binding_C | 0.68 |
| PF10009 | DUF2252 | 0.68 |
| PF07282 | OrfB_Zn_ribbon | 0.68 |
| PF03803 | Scramblase | 0.68 |
| PF00753 | Lactamase_B | 0.68 |
| PF05872 | HerA_C | 0.68 |
| PF12681 | Glyoxalase_2 | 0.68 |
| PF00210 | Ferritin | 0.68 |
| PF01022 | HTH_5 | 0.68 |
| PF06013 | WXG100 | 0.68 |
| PF12849 | PBP_like_2 | 0.68 |
| PF00654 | Voltage_CLC | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF04978 | DUF664 | 0.68 |
| PF01435 | Peptidase_M48 | 0.68 |
| PF02771 | Acyl-CoA_dh_N | 0.68 |
| PF00501 | AMP-binding | 0.68 |
| PF00582 | Usp | 0.68 |
| PF04149 | DUF397 | 0.68 |
| PF02585 | PIG-L | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 6.08 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.70 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.70 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.70 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 2.03 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 2.03 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 2.03 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.35 |
| COG2180 | Nitrate reductase assembly protein NarJ, required for insertion of molybdenum cofactor | Posttranslational modification, protein turnover, chaperones [O] | 1.35 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.68 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.68 |
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.68 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.68 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.68 |
| COG4842 | Secreted virulence factor YukE/EsxA, WXG100 family | Defense mechanisms [V] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.65 % |
| Unclassified | root | N/A | 26.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004594|Ga0068976_1233444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300004606|Ga0068962_1068159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300004615|Ga0068926_1015894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300005171|Ga0066677_10194703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300005329|Ga0070683_101766056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300005444|Ga0070694_101100691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 663 | Open in IMG/M |
| 3300005445|Ga0070708_100309132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
| 3300005468|Ga0070707_101472758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300005524|Ga0070737_10155648 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005575|Ga0066702_10542121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300005764|Ga0066903_104955674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300006028|Ga0070717_10398295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1236 | Open in IMG/M |
| 3300006052|Ga0075029_100538153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300006173|Ga0070716_100062949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2152 | Open in IMG/M |
| 3300006173|Ga0070716_101533463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300006606|Ga0074062_13013060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 559 | Open in IMG/M |
| 3300006806|Ga0079220_10714557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 739 | Open in IMG/M |
| 3300006854|Ga0075425_100798481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300006871|Ga0075434_100488142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1253 | Open in IMG/M |
| 3300006903|Ga0075426_10448313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 955 | Open in IMG/M |
| 3300009101|Ga0105247_11504987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 549 | Open in IMG/M |
| 3300009137|Ga0066709_104595694 | Not Available | 505 | Open in IMG/M |
| 3300009521|Ga0116222_1450683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300009700|Ga0116217_10483177 | Not Available | 779 | Open in IMG/M |
| 3300009839|Ga0116223_10664216 | Not Available | 599 | Open in IMG/M |
| 3300010048|Ga0126373_10098611 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300010154|Ga0127503_11316010 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300010339|Ga0074046_10516509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 712 | Open in IMG/M |
| 3300010343|Ga0074044_10668685 | Not Available | 678 | Open in IMG/M |
| 3300010343|Ga0074044_10883746 | Not Available | 584 | Open in IMG/M |
| 3300010343|Ga0074044_10951428 | Not Available | 562 | Open in IMG/M |
| 3300010358|Ga0126370_11850492 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300010361|Ga0126378_10902659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300010373|Ga0134128_11127782 | Not Available | 866 | Open in IMG/M |
| 3300010376|Ga0126381_101475432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 983 | Open in IMG/M |
| 3300010379|Ga0136449_102588252 | Not Available | 724 | Open in IMG/M |
| 3300010379|Ga0136449_104629711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300010876|Ga0126361_10708568 | Not Available | 660 | Open in IMG/M |
| 3300011065|Ga0138533_1139534 | Not Available | 844 | Open in IMG/M |
| 3300011085|Ga0138581_1007604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 542 | Open in IMG/M |
| 3300011270|Ga0137391_10356435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1256 | Open in IMG/M |
| 3300012198|Ga0137364_10132160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1790 | Open in IMG/M |
| 3300012202|Ga0137363_10192230 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1632 | Open in IMG/M |
| 3300012205|Ga0137362_10476364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1080 | Open in IMG/M |
| 3300012210|Ga0137378_11031453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 737 | Open in IMG/M |
| 3300012349|Ga0137387_10365716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300012354|Ga0137366_10512063 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012357|Ga0137384_10660594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300012481|Ga0157320_1006150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 822 | Open in IMG/M |
| 3300012507|Ga0157342_1028991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 687 | Open in IMG/M |
| 3300012960|Ga0164301_10299670 | Not Available | 1081 | Open in IMG/M |
| 3300013100|Ga0157373_10814158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300013105|Ga0157369_11213023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300014164|Ga0181532_10104912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1755 | Open in IMG/M |
| 3300015372|Ga0132256_101152105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 889 | Open in IMG/M |
| 3300016294|Ga0182041_10694410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300016371|Ga0182034_10561736 | Not Available | 959 | Open in IMG/M |
| 3300016371|Ga0182034_11828017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 536 | Open in IMG/M |
| 3300017928|Ga0187806_1209468 | Not Available | 663 | Open in IMG/M |
| 3300017938|Ga0187854_10079336 | Not Available | 1572 | Open in IMG/M |
| 3300017955|Ga0187817_10384022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 896 | Open in IMG/M |
| 3300017959|Ga0187779_11148127 | Not Available | 544 | Open in IMG/M |
| 3300017966|Ga0187776_10444262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 876 | Open in IMG/M |
| 3300017970|Ga0187783_10385750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1018 | Open in IMG/M |
| 3300017970|Ga0187783_10464126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
| 3300017973|Ga0187780_11434715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300017974|Ga0187777_11225000 | Not Available | 549 | Open in IMG/M |
| 3300017999|Ga0187767_10227390 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300018007|Ga0187805_10097383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1329 | Open in IMG/M |
| 3300018007|Ga0187805_10186583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 946 | Open in IMG/M |
| 3300018033|Ga0187867_10800910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300018034|Ga0187863_10175994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300018037|Ga0187883_10023096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3423 | Open in IMG/M |
| 3300018042|Ga0187871_10236758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300018057|Ga0187858_10096358 | Not Available | 2025 | Open in IMG/M |
| 3300018431|Ga0066655_10271159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1094 | Open in IMG/M |
| 3300018433|Ga0066667_10778998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 810 | Open in IMG/M |
| 3300020199|Ga0179592_10163557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1016 | Open in IMG/M |
| 3300020582|Ga0210395_10982077 | Not Available | 626 | Open in IMG/M |
| 3300020582|Ga0210395_11225928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 551 | Open in IMG/M |
| 3300021171|Ga0210405_10761102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 744 | Open in IMG/M |
| 3300021402|Ga0210385_10639598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300021407|Ga0210383_10440189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300021474|Ga0210390_10157612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1913 | Open in IMG/M |
| 3300021479|Ga0210410_10314687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 1404 | Open in IMG/M |
| 3300021559|Ga0210409_10765451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 838 | Open in IMG/M |
| 3300021559|Ga0210409_11373543 | Not Available | 582 | Open in IMG/M |
| 3300021560|Ga0126371_10131143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2546 | Open in IMG/M |
| 3300021560|Ga0126371_10479876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
| 3300024286|Ga0247687_1061539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 570 | Open in IMG/M |
| 3300025898|Ga0207692_11012022 | Not Available | 549 | Open in IMG/M |
| 3300025914|Ga0207671_11485134 | Not Available | 524 | Open in IMG/M |
| 3300025915|Ga0207693_10170902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1712 | Open in IMG/M |
| 3300025928|Ga0207700_10365912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 1258 | Open in IMG/M |
| 3300025929|Ga0207664_10428199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 1179 | Open in IMG/M |
| 3300025929|Ga0207664_10513786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1073 | Open in IMG/M |
| 3300026142|Ga0207698_10782370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300026551|Ga0209648_10775794 | Not Available | 523 | Open in IMG/M |
| 3300026557|Ga0179587_10616568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 714 | Open in IMG/M |
| 3300026908|Ga0207787_1027207 | Not Available | 562 | Open in IMG/M |
| 3300026984|Ga0208732_1029686 | Not Available | 511 | Open in IMG/M |
| 3300027703|Ga0207862_1014375 | Not Available | 2337 | Open in IMG/M |
| 3300027738|Ga0208989_10134859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 833 | Open in IMG/M |
| 3300027765|Ga0209073_10271405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 665 | Open in IMG/M |
| 3300027905|Ga0209415_10450027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
| 3300028783|Ga0302279_10374524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300030046|Ga0302305_1070713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1470 | Open in IMG/M |
| 3300030399|Ga0311353_11453907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 557 | Open in IMG/M |
| 3300031040|Ga0265754_1039627 | Not Available | 515 | Open in IMG/M |
| 3300031090|Ga0265760_10244878 | Not Available | 619 | Open in IMG/M |
| 3300031199|Ga0307495_10139349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 617 | Open in IMG/M |
| 3300031236|Ga0302324_101391287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 919 | Open in IMG/M |
| 3300031543|Ga0318516_10139912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1387 | Open in IMG/M |
| 3300031719|Ga0306917_11290035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 565 | Open in IMG/M |
| 3300031719|Ga0306917_11451713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 528 | Open in IMG/M |
| 3300031724|Ga0318500_10053253 | Not Available | 1726 | Open in IMG/M |
| 3300031764|Ga0318535_10550171 | Not Available | 512 | Open in IMG/M |
| 3300031770|Ga0318521_10315199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 922 | Open in IMG/M |
| 3300031771|Ga0318546_10266099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1182 | Open in IMG/M |
| 3300031797|Ga0318550_10231104 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031799|Ga0318565_10570976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 544 | Open in IMG/M |
| 3300031805|Ga0318497_10087771 | Not Available | 1656 | Open in IMG/M |
| 3300031805|Ga0318497_10353912 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031820|Ga0307473_11053121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 597 | Open in IMG/M |
| 3300031845|Ga0318511_10240961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 810 | Open in IMG/M |
| 3300031845|Ga0318511_10600947 | Not Available | 513 | Open in IMG/M |
| 3300031890|Ga0306925_10650352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1108 | Open in IMG/M |
| 3300031910|Ga0306923_11022762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300031912|Ga0306921_10060068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4337 | Open in IMG/M |
| 3300031954|Ga0306926_12761315 | Not Available | 532 | Open in IMG/M |
| 3300032008|Ga0318562_10341002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300032065|Ga0318513_10278889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 811 | Open in IMG/M |
| 3300032089|Ga0318525_10496998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300032090|Ga0318518_10450538 | Not Available | 659 | Open in IMG/M |
| 3300032090|Ga0318518_10719205 | Not Available | 508 | Open in IMG/M |
| 3300032160|Ga0311301_12201577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300032261|Ga0306920_102618215 | Not Available | 691 | Open in IMG/M |
| 3300032770|Ga0335085_10752019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1078 | Open in IMG/M |
| 3300032783|Ga0335079_11955307 | Not Available | 566 | Open in IMG/M |
| 3300032805|Ga0335078_10655722 | Not Available | 1311 | Open in IMG/M |
| 3300032829|Ga0335070_12011787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 520 | Open in IMG/M |
| 3300032892|Ga0335081_10075850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5113 | Open in IMG/M |
| 3300032892|Ga0335081_10283842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2206 | Open in IMG/M |
| 3300032954|Ga0335083_11066558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 633 | Open in IMG/M |
| 3300032955|Ga0335076_10007912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10716 | Open in IMG/M |
| 3300033134|Ga0335073_10529986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1336 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.70% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004594 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068976_12334442 | 3300004594 | Peatlands Soil | ALAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW* |
| Ga0068962_10681592 | 3300004606 | Peatlands Soil | ASPALAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW* |
| Ga0068926_10158942 | 3300004615 | Peatlands Soil | ICFFFFSFYLAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW* |
| Ga0066677_101947031 | 3300005171 | Soil | PERKAAGDGGPAVAAMRAALAHDLDVPTALRIAEEDGGQAARSLGTLLGLW* |
| Ga0070683_1017660561 | 3300005329 | Corn Rhizosphere | AAVAATRAALASDLDVPAALRIAESEGGQAARSLGALLGLW* |
| Ga0070694_1011006911 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0070708_1003091322 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAVRAALADNLDVPTAIAIAQESGGQAARVLGTLLGLW* |
| Ga0070707_1014727581 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPAVAAMRAALAHDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0070737_101556483 | 3300005524 | Surface Soil | TAAVTAIRSVLAADLDVPAALGIAEEAGGEAARSLGSLLGLW* |
| Ga0066702_105421211 | 3300005575 | Soil | MRAALAHDLDVPTALRIAEEDGGQAARSLGTLLGLW* |
| Ga0066903_1049556741 | 3300005764 | Tropical Forest Soil | AALDDDLDVPAALRIAEDDGGPAARALGSLLGLW* |
| Ga0070717_103982951 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0075029_1005381532 | 3300006052 | Watersheds | VAGRAGPAVAAMRAALANDLDVPTALNIAEDGGGQAARSLGSLLGLW* |
| Ga0070716_1000629495 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TRAALASDLDVPAALRVAEEEGGQAARSLGALLGLW* |
| Ga0070716_1015334632 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAAMRAALAHDLDVPAALHIAEEEGGQAARSLGTLLGLW* |
| Ga0074062_130130601 | 3300006606 | Soil | RDVAGGGAPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0079220_107145572 | 3300006806 | Agricultural Soil | AAGSDGGAGVTAMRAALAHDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0075425_1007984811 | 3300006854 | Populus Rhizosphere | ATRQALASDLDVPAALRIAESEGAQAARSLGALLGLW* |
| Ga0075434_1004881421 | 3300006871 | Populus Rhizosphere | GTAAVAATRAALASDLDVPAALRVAEEEGGQAARSLGALLGLW* |
| Ga0075426_104483131 | 3300006903 | Populus Rhizosphere | RAERHVAGDGGPAVAAMRAALARDLDVPTALQIAEEEGGQAARSLGTLLGLW* |
| Ga0105247_115049871 | 3300009101 | Switchgrass Rhizosphere | GPAVAAMRAALARDLDVPTALRIAEEEGGRAARSLGTLLGLW* |
| Ga0066709_1045956941 | 3300009137 | Grasslands Soil | DAAGDGGPAVAAMRAALAHDLDVPAALRIAEDEGGQAARSLGTLLGLW* |
| Ga0116222_14506832 | 3300009521 | Peatlands Soil | AALANDLDVPAAMNIAEDPGGQAARSLGSLLGLW* |
| Ga0116217_104831772 | 3300009700 | Peatlands Soil | HDDTAVAAVRAALAHDLDVPAALRIAEDEGGPAARSLGSLLGLW* |
| Ga0116217_109102062 | 3300009700 | Peatlands Soil | AGRPGRSVAGTGDTAVAAVRAALASDLDVPAALGIAEDEGGPAARTVGSLLALW* |
| Ga0116223_106642161 | 3300009839 | Peatlands Soil | AVRAALAHDLDVPAALRIAEDEGGPAARSLGSLLGLW* |
| Ga0126373_100986117 | 3300010048 | Tropical Forest Soil | GRAVAGHGDGAAAAVRAALDSDLDVPAALRVAEDSGGQAARVLGSQLGLW* |
| Ga0127503_113160101 | 3300010154 | Soil | MRAALANDLDVPAALDIAEDDGGQAARSLGSLLGLW* |
| Ga0074046_105165092 | 3300010339 | Bog Forest Soil | VAAVRAALATDLDVPAALRIAEDDGGQAARVLGSLLGLW* |
| Ga0074044_106686852 | 3300010343 | Bog Forest Soil | AALANDLDVPAALNVAEEDGGQAARSLGSLLGLW* |
| Ga0074044_108837462 | 3300010343 | Bog Forest Soil | AMRAALANDLDVPAALNIAEEDGGQAARSLGSLLGLW* |
| Ga0074044_109514281 | 3300010343 | Bog Forest Soil | AMRAALANDLDVPAALNIAEDVGGQAARSLGSLLGLW* |
| Ga0126370_118504922 | 3300010358 | Tropical Forest Soil | AAAVEAVRAALADNLDVPLAIAIAEESGGQAARVLGTLIGLW* |
| Ga0126378_109026593 | 3300010361 | Tropical Forest Soil | GAIRETLASDLDVPTAIGIAEDEGGQAARMVCSILGLW* |
| Ga0134128_111277822 | 3300010373 | Terrestrial Soil | AGDGGPAGAAMRAALARDLDVPTALRIAQEEGGQAARSLGTLLGLW* |
| Ga0126381_1014754322 | 3300010376 | Tropical Forest Soil | AAMRAALADDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0136449_1025882521 | 3300010379 | Peatlands Soil | AAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW* |
| Ga0136449_1046297112 | 3300010379 | Peatlands Soil | GPAVAAMRAALANDLDVPTALNIAEEGGGQATRSLGSLLGLW* |
| Ga0126361_107085682 | 3300010876 | Boreal Forest Soil | AVRAALADDLDVPGALGIAEEAGGSAARSAGSLLGLW* |
| Ga0138533_11395341 | 3300011065 | Peatlands Soil | LICFFFFSFYLAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW* |
| Ga0138581_10076042 | 3300011085 | Peatlands Soil | AWPEVPAPALAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW* |
| Ga0137391_103564352 | 3300011270 | Vadose Zone Soil | AVAAVHAALASDLDVPAALDIAEDQGGQAARVLGSVLGLW* |
| Ga0137364_101321603 | 3300012198 | Vadose Zone Soil | ERKAVGDGGPAVAAMRAALAHDLDVPTALRIAEEDGGQAARSLGTLLGLW* |
| Ga0137363_101922302 | 3300012202 | Vadose Zone Soil | RATLAHDLNVPAAFAVAEEAGGQAARVLGSLLGLW* |
| Ga0137362_104763642 | 3300012205 | Vadose Zone Soil | AALARDLDVPAALHIAEEEGGQAARSLGTLLGLW* |
| Ga0137378_110314532 | 3300012210 | Vadose Zone Soil | RPERNAAGDGGPAVAAMRAALAHDLDVPAALQIAEDESGQAARSLGTLLGLW* |
| Ga0137387_103657161 | 3300012349 | Vadose Zone Soil | GSSGSGGAAVAGTRTALARDLDVPAALRIAESEGGQAARSLGALLGLW* |
| Ga0137366_105120631 | 3300012354 | Vadose Zone Soil | GSAALEAVHEALARDLDVPAALRIAEDSGGQAARVLGSLLGLW* |
| Ga0137384_106605941 | 3300012357 | Vadose Zone Soil | DDLDVPAALAIAEEAGGAVARGLIATLGLSEPPR* |
| Ga0157320_10061502 | 3300012481 | Arabidopsis Rhizosphere | GHGATAVAAMRAALARDLDVPAALRIAEEEGGQAARSLGTLLGLW* |
| Ga0157342_10289913 | 3300012507 | Arabidopsis Rhizosphere | RAALARDLDVPAALQIAEEEGGQAARSLGTLLGLW* |
| Ga0164301_102996702 | 3300012960 | Soil | VAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0157373_108141581 | 3300013100 | Corn Rhizosphere | MRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0157369_112130231 | 3300013105 | Corn Rhizosphere | GAAGRAERDVAGDGCPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0181532_101049122 | 3300014164 | Bog | VAAVRAALASDLDVPAALRIAEDNGGQAARVLGSLLGLW* |
| Ga0132256_1011521052 | 3300015372 | Arabidopsis Rhizosphere | GAAGRAGRDVAGDGGPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW* |
| Ga0182041_106944101 | 3300016294 | Soil | GAVRAALADDLDVPAALRIAEDDGGPAARSLAALLGLW |
| Ga0182034_105617362 | 3300016371 | Soil | AVTAMRAALADDLDVPAALRVAENDGGQAARSLGSLLGLW |
| Ga0182034_118280172 | 3300016371 | Soil | RAALADDLDVPAALRIAEEEGGQAARSLGALLGLW |
| Ga0187806_12094681 | 3300017928 | Freshwater Sediment | IRAALRADLDVPAALAVAEDAGGQPARALSALLGLW |
| Ga0187854_100793362 | 3300017938 | Peatland | VAAVRAALASDLDVPAALRIAEDNGGQAARVLGSLLGLW |
| Ga0187817_103840222 | 3300017955 | Freshwater Sediment | MRAALADDLDVPAALRIAEDEGGQAARILGSLLGLW |
| Ga0187779_101552484 | 3300017959 | Tropical Peatland | AAGRPGRGPAGHDEAAVTAVRAALADDLDVPAALRIAESEGGPAARSLGSLLGLW |
| Ga0187779_111481272 | 3300017959 | Tropical Peatland | VRAALADDLDVPAALRIAEDDGGPAARGLGSLLGLW |
| Ga0187776_104442623 | 3300017966 | Tropical Peatland | RAALADDLDVPAALRVAENDGGQAARSLGSLLGLW |
| Ga0187783_103857503 | 3300017970 | Tropical Peatland | VAGSGGAAVTAMHAALADDLDVPAALRIAEDDGGQAARHLGSLLGLW |
| Ga0187783_104641262 | 3300017970 | Tropical Peatland | RAALARDLDVPAALRIAEEEGGPAARALGSLLGLW |
| Ga0187780_114347152 | 3300017973 | Tropical Peatland | VTAMRAALADDLDVPAALRIAEDDGGQAARTLGSLLGLW |
| Ga0187777_112250003 | 3300017974 | Tropical Peatland | VGGNGGPAVAAMRAALASDLDVPAALRIAEDEGGQAARSLGSLLGLW |
| Ga0187767_102273902 | 3300017999 | Tropical Peatland | AGAAAGAVRAALEADLDVPAALRIAEDDGGPAARGLGSLLGLW |
| Ga0187805_100973831 | 3300018007 | Freshwater Sediment | ATAVRAALTNGLDVPAALGIAEQEGGQAARSLGSLLGLW |
| Ga0187805_101865831 | 3300018007 | Freshwater Sediment | RTALAEDLDVPAALRIAEQEGGQAARVLGSLLGLW |
| Ga0187867_108009101 | 3300018033 | Peatland | AEPTAIRMSLASDLDVPTALAIAEDSGGQAARVPGALLGL |
| Ga0187863_101759943 | 3300018034 | Peatland | SGAAVAAVRAALASDLDVPAALRIAEDNGGQAARVLGSLLGLW |
| Ga0187883_100230965 | 3300018037 | Peatland | GLAEPTAIRMSLASDLDVPTALAIAEDSGGQAARVPGALLGL |
| Ga0187871_102367583 | 3300018042 | Peatland | AAMRAALASDLDVPAALNIAEDGGGQAARSLGSLLGLW |
| Ga0187858_100963582 | 3300018057 | Peatland | VAAVRAALASDLDVPAALRIAEDNGGQAARVLGSLL |
| Ga0066655_102711592 | 3300018431 | Grasslands Soil | GRPERDAAGDGGPAVAAMRAALARDLDVPAALQIAEEEGGQAARSLGTLLGLW |
| Ga0066667_107789982 | 3300018433 | Grasslands Soil | AAMRAALAHDLDVPTALRIAEEDGGQAARSLGTLLGLW |
| Ga0179592_101635572 | 3300020199 | Vadose Zone Soil | PAVAAMRAALAHDLDVPAALRIAEDEGGQAARSLGTLLGLW |
| Ga0210395_109820771 | 3300020582 | Soil | GSGGTAVAAMRAALADDLDVPAALRIAEDGGGQAARSLGSLLGLW |
| Ga0210395_112259281 | 3300020582 | Soil | GDGGPAVAAMRAALAHDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0210405_107611022 | 3300021171 | Soil | DGGPAVAAMRAALAHDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0210385_106395983 | 3300021402 | Soil | AAGSGGTAVAAMRAALAGDLDVPAALRIAEDGGGQAARSLGSLLGLW |
| Ga0210383_104401893 | 3300021407 | Soil | AMRAALADDLDVPAALRIAEDGGGQAARSLGSLLGLW |
| Ga0210390_101576121 | 3300021474 | Soil | RGVAGSAGQAVAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW |
| Ga0210410_103146871 | 3300021479 | Soil | VAAMRAALARDLDVPAALQIAEEEGGQAARSLGTLLGLW |
| Ga0210409_107654511 | 3300021559 | Soil | RSAMARDLDVPTALEIAEDAGGPVASELAHFLGLR |
| Ga0210409_113735431 | 3300021559 | Soil | AMRAALARDLDVPAALQIAEQEGGQAARSLGTLLGLW |
| Ga0126371_101311435 | 3300021560 | Tropical Forest Soil | VRAALADDLDVPAALRIAEDDGGPAARGLAALLGLW |
| Ga0126371_104798761 | 3300021560 | Tropical Forest Soil | AVAAMRAALARDLDVPAALRIAEEEGGQAARSLGPLLGLW |
| Ga0247687_10615391 | 3300024286 | Soil | AVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0207692_110120222 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAATRRALASGLDVPAALGIAESEGAQAARSLGALLGLW |
| Ga0207671_114851341 | 3300025914 | Corn Rhizosphere | AERDVAGDGGPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0207693_101709021 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGRAERDVAGDGGPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0207700_103659123 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAALARDLDVPAALQIAEQEGGQAARSLGTLLGLW |
| Ga0207664_104281993 | 3300025929 | Agricultural Soil | MRAALAHDLDVPAALHIAEEEGGQAARSLGTLLGLW |
| Ga0207664_105137861 | 3300025929 | Agricultural Soil | AGDGGPAVAAMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0207698_107823701 | 3300026142 | Corn Rhizosphere | AMRAALARDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0209648_107757941 | 3300026551 | Grasslands Soil | AAGNGGAAVAAVRAALASDLDVPAALRIAEDDGGQAPRVLGSLLGLW |
| Ga0179587_106165681 | 3300026557 | Vadose Zone Soil | VAAMRAALAHDLDVPAALRIAEDEGGQAARSLGTLLGLW |
| Ga0207787_10272071 | 3300026908 | Tropical Forest Soil | AMRAALADDLDVPAALRVAENDGGQAARRLGSLLGLW |
| Ga0208732_10296861 | 3300026984 | Forest Soil | GDGGPAVAAMRAALARDLDVPAALQIAEEEGGQAARSLGTLLGLW |
| Ga0207862_10143751 | 3300027703 | Tropical Forest Soil | AAAVTAMRAALADDLDVPAALRVAENDGGQAARRLGSLLGLW |
| Ga0208989_101348592 | 3300027738 | Forest Soil | GDAAVAAVRAALARDLDVPAALRIAEDDGGPAARTLGSLLGLW |
| Ga0209073_102714052 | 3300027765 | Agricultural Soil | AATRAALAGDLDVPAALRVAEEEGGQAARSLGALLGLW |
| Ga0209415_104500271 | 3300027905 | Peatlands Soil | AVRAALASDLDVPAALRIAEDDSGGQAARVLGSLLGLW |
| Ga0302279_103745241 | 3300028783 | Bog | AAVAAVRAALASDLDVPAALRIAEDNGGQAARVLGSLLGLW |
| Ga0302305_10707131 | 3300030046 | Palsa | AGSGAAVAAVRAALASDLDVPAALRIAEDNGGQAARVLGSLLGLW |
| Ga0311353_114539072 | 3300030399 | Palsa | AVSAVRAALAHDLDVPAALQIAADQGGQAARVLGSLLGLW |
| Ga0265754_10396271 | 3300031040 | Soil | AMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW |
| Ga0265760_102448781 | 3300031090 | Soil | QAVAAMRAALANDLDVPAALNIAEDGGGQAARSLGSLLGLW |
| Ga0307495_101393491 | 3300031199 | Soil | ERDVAGHGAPAVAAMRAALARDLDVPAALRIAEEEGGQAARSLGTLLGLW |
| Ga0302324_1013912873 | 3300031236 | Palsa | TQSALANDLDVPAALKIAEEAGGAAARDLGAFLGLR |
| Ga0318516_101399122 | 3300031543 | Soil | ARAAVRQIRAALRADLDVPAALAIAEEAGGDAARALRSLLGLW |
| Ga0306917_112900351 | 3300031719 | Soil | RPDGGGDGGTAVAAMRAALARDLDVPTALQIAEEEGGQAARSLGTLLGLW |
| Ga0306917_114517132 | 3300031719 | Soil | AVAAIRAALADDLDVPAALRIAEEEGGQAARSLGTLLGLW |
| Ga0318500_100532531 | 3300031724 | Soil | RDLRVRADLDVPAALAIAEEAGGDAARTLRSLLGLW |
| Ga0318535_105501711 | 3300031764 | Soil | RAALADDLDVPAALHVAENDGGQAARSLGSLLGLW |
| Ga0318521_103151992 | 3300031770 | Soil | RAALADDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0318546_102660992 | 3300031771 | Soil | RIRAALRADLDVPAALAIAEEAGGDAARSLRSLLGLW |
| Ga0318550_102311041 | 3300031797 | Soil | AGAVRAAMADDLDVPTALRIAEDDGGPAARGLGSLLGLW |
| Ga0318565_105709761 | 3300031799 | Soil | AMRAALADDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0318497_100877712 | 3300031805 | Soil | ALTAMRAALADDLDVPAALRVAENDGGQAARSLGSLLGLW |
| Ga0318497_103539121 | 3300031805 | Soil | RAALAGDLDVPAALHIAEEDGGPAARGLGSLLGLW |
| Ga0307473_110531212 | 3300031820 | Hardwood Forest Soil | AARDGGAAMRAALAHDLDVPTALRIAEDEGGQAARSLGTLLGLW |
| Ga0318511_102409612 | 3300031845 | Soil | AVAAMRAALADDLDVPAALRIAEEEGGQAARSLGTLLGLW |
| Ga0318511_106009471 | 3300031845 | Soil | AVRQIRAALRADLDVPAALAIAEEAGGDAARTLRSLLGLW |
| Ga0306925_106503521 | 3300031890 | Soil | ADADRAALADDLDVPAALRIAEDDGGPAARGLASLLGLW |
| Ga0306923_110227621 | 3300031910 | Soil | AAGRIRAALRADLDVPAALAIAEEAGGDAARTLRSLLGLW |
| Ga0306921_100600681 | 3300031912 | Soil | AAGAVRAAMADDLDVPTALRIAEDDGGPAARGLGSLLGLW |
| Ga0306926_127613151 | 3300031954 | Soil | AMRAALADDLDVPAALRVAENDGGQAARSLGSLLGLW |
| Ga0318562_103410022 | 3300032008 | Soil | VRAALADDLDVPAALRIAEDDGGPAARSLAALLGLW |
| Ga0318513_102788891 | 3300032065 | Soil | PECAAGRGGDAAVAAMRAALARNLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0318525_104969981 | 3300032089 | Soil | AVRAALADDLDVPAALRIAEEEGGPAARTLGSLLGLW |
| Ga0318518_104505381 | 3300032090 | Soil | TAMRAALADDLDVPAALRVAENDGGQAARSLGSLLGLW |
| Ga0318518_107192051 | 3300032090 | Soil | AAVRRIRAALRADLDVPAALAIAEETGGDAARTVRSLLGLW |
| Ga0311301_122015772 | 3300032160 | Peatlands Soil | AMRAALANDLDVPAALNIAEDDGGQAARSLGSLLGLW |
| Ga0306920_1026182151 | 3300032261 | Soil | MRAALADDLDVPAALHVAENDGGQAARSLGSLLGLW |
| Ga0335085_107520192 | 3300032770 | Soil | DGGTAVVAMRAALANDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0335079_119553071 | 3300032783 | Soil | AAWPRMTRPSPRARTALASDLDVPAALHIAEEEGGPAARAVGSLLGLW |
| Ga0335078_106557222 | 3300032805 | Soil | GGAGATAVVAMRAALANDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0335070_120117871 | 3300032829 | Soil | TAVGAMRAALADDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0335081_100758506 | 3300032892 | Soil | AADDGAAAAAARAALANDLDVPAALQIAETDGGPVARSLGSLLGLW |
| Ga0335081_102838422 | 3300032892 | Soil | MTRPSPRARTALASDLDVPAALHIAEEEGGPAARAVGSLLGLW |
| Ga0335083_110665581 | 3300032954 | Soil | TAMRAALAHDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0335076_1000791211 | 3300032955 | Soil | PMRAALAKDLDVPTALRIAEEEGGQAARSLGTLLGLW |
| Ga0335073_105299861 | 3300033134 | Soil | RAALARDLDVPAALQTAEDAGGPAARALGSLLGLW |
| ⦗Top⦘ |