Metagenome / Metatranscriptome Family F048521

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F048521
Family Type	Metagenome / Metatranscriptome
Number of Sequences	148
Average Sequence Length	39 residues
Representative Sequence	MFDGKNNRLLDSFSFRLALTAAVFAAWSGAGYILLSLA
Number of Associated Samples	108
Number of Associated Scaffolds	148

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	76.87 %
% of genes near scaffold ends (potentially truncated)	22.30 %
% of genes from short scaffolds (< 2000 bps)	74.32 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (62.838 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.838 % of family members)
Environment Ontology (ENVO)	Unclassified (27.027 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (45.946 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.57
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 148 Family Scaffolds
PF00067	p450	15.54
PF00849	PseudoU_synth_2	3.38
PF14534	DUF4440	3.38
PF02265	S1-P1_nuclease	2.03
PF13193	AMP-binding_C	2.03
PF01979	Amidohydro_1	1.35
PF15887	Peptidase_Mx	1.35
PF02580	Tyr_Deacylase	0.68
PF02559	CarD_CdnL_TRCF	0.68
PF01902	Diphthami_syn_2	0.68
PF13366	PDDEXK_3	0.68
PF12704	MacB_PCD	0.68
PF03602	Cons_hypoth95	0.68
PF04325	DUF465	0.68
PF02113	Peptidase_S13	0.68
PF04952	AstE_AspA	0.68
PF04140	ICMT	0.68
PF02777	Sod_Fe_C	0.68
PF01431	Peptidase_M13	0.68
PF07805	Obsolete Pfam Family	0.68
PF00365	PFK	0.68
PF08281	Sigma70_r4_2	0.68
PF03551	PadR	0.68
PF13030	DUF3891	0.68

COG ID	Name	Functional Category	% Frequency in 148 Family Scaffolds
COG2124	Cytochrome P450	Defense mechanisms [V]	15.54
COG0564	Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific	Translation, ribosomal structure and biogenesis [J]	3.38
COG1187	Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605	Translation, ribosomal structure and biogenesis [J]	3.38
COG3590	Predicted metalloendopeptidase	Posttranslational modification, protein turnover, chaperones [O]	0.68
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.68
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.68
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.68
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.68
COG2102	Diphthamide synthase (EF-2-diphthine--ammonia ligase)	Translation, ribosomal structure and biogenesis [J]	0.68
COG2027	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.68
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.68
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.68
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.68
COG1490	D-aminoacyl-tRNA deacylase	Translation, ribosomal structure and biogenesis [J]	0.68
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.68
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.68
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	0.68

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.84 %
Unclassified	root	N/A	37.16 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.84 %
Unclassified	root	N/A	37.16 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.84 %
Unclassified	root	N/A	37.16 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.16 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	16.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.35 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.68 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.16 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	6.08 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5.41 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	3.38 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.68 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.08 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	4.73 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	3.38 %
Candidatus Angelobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter	0.68 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	0.68 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.08 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4.05 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	3.38 %
unclassified Candidatus Angelobacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter	0.68 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.68 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	0.68 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.08 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	3.38 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.68 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.68 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	0.68 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.68 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.08 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	3.38 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.68 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.68 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.68 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.68 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000156\|NODE_c0418026	Not Available	791	Open in IMG/M
3300000156\|NODE_c0714340	All Organisms → cellular organisms → Bacteria	5080	Open in IMG/M
3300004800\|Ga0058861_11922752	Not Available	577	Open in IMG/M
3300004803\|Ga0058862_10078420	All Organisms → cellular organisms → Bacteria	946	Open in IMG/M
3300005434\|Ga0070709_11623522	Not Available	527	Open in IMG/M
3300005439\|Ga0070711_100508688	All Organisms → cellular organisms → Bacteria	994	Open in IMG/M
3300005526\|Ga0073909_10008956	All Organisms → cellular organisms → Bacteria	3006	Open in IMG/M
3300005526\|Ga0073909_10032155	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1803	Open in IMG/M
3300005526\|Ga0073909_10122641	All Organisms → cellular organisms → Bacteria	1054	Open in IMG/M
3300005530\|Ga0070679_101581309	Not Available	603	Open in IMG/M
3300005533\|Ga0070734_10001072	All Organisms → cellular organisms → Bacteria	43825	Open in IMG/M
3300005533\|Ga0070734_10015514	All Organisms → cellular organisms → Bacteria	5253	Open in IMG/M
3300005537\|Ga0070730_10001040	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	27858	Open in IMG/M
3300005537\|Ga0070730_10076313	All Organisms → cellular organisms → Bacteria	2354	Open in IMG/M
3300005542\|Ga0070732_10004932	All Organisms → cellular organisms → Bacteria	7235	Open in IMG/M
3300005542\|Ga0070732_10115516	All Organisms → cellular organisms → Bacteria	1587	Open in IMG/M
3300005555\|Ga0066692_10192936	All Organisms → cellular organisms → Bacteria	1271	Open in IMG/M
3300005563\|Ga0068855_100050335	All Organisms → cellular organisms → Bacteria	4910	Open in IMG/M
3300005563\|Ga0068855_102134208	Not Available	563	Open in IMG/M
3300005575\|Ga0066702_10014298	All Organisms → cellular organisms → Bacteria	3687	Open in IMG/M
3300005575\|Ga0066702_10346824	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	903	Open in IMG/M
3300005575\|Ga0066702_10518433	Not Available	724	Open in IMG/M
3300005578\|Ga0068854_101282487	Not Available	659	Open in IMG/M
3300005614\|Ga0068856_100132708	All Organisms → cellular organisms → Bacteria	2495	Open in IMG/M
3300005616\|Ga0068852_100204162	All Organisms → cellular organisms → Bacteria	1871	Open in IMG/M
3300005640\|Ga0075035_1599780	All Organisms → cellular organisms → Bacteria	1134	Open in IMG/M
3300005764\|Ga0066903_100081111	All Organisms → cellular organisms → Bacteria	4237	Open in IMG/M
3300005764\|Ga0066903_100124804	All Organisms → cellular organisms → Bacteria	3595	Open in IMG/M
3300005834\|Ga0068851_10031511	All Organisms → cellular organisms → Bacteria → Acidobacteria	2634	Open in IMG/M
3300006028\|Ga0070717_10184959	All Organisms → cellular organisms → Bacteria	1818	Open in IMG/M
3300006028\|Ga0070717_10861747	Not Available	824	Open in IMG/M
3300006041\|Ga0075023_100029286	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1605	Open in IMG/M
3300006050\|Ga0075028_100014540	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3340	Open in IMG/M
3300006173\|Ga0070716_100125128	All Organisms → cellular organisms → Bacteria	1616	Open in IMG/M
3300006175\|Ga0070712_100007492	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6816	Open in IMG/M
3300006175\|Ga0070712_100506270	All Organisms → cellular organisms → Bacteria	1013	Open in IMG/M
3300006755\|Ga0079222_11898243	Not Available	581	Open in IMG/M
3300006854\|Ga0075425_102033656	Not Available	642	Open in IMG/M
3300006871\|Ga0075434_100121538	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	2627	Open in IMG/M
3300006903\|Ga0075426_11238102	Not Available	566	Open in IMG/M
3300006954\|Ga0079219_10689514	Not Available	773	Open in IMG/M
3300007788\|Ga0099795_10179320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	884	Open in IMG/M
3300009090\|Ga0099827_10203502	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	1648	Open in IMG/M
3300009093\|Ga0105240_11098386	Not Available	846	Open in IMG/M
3300009101\|Ga0105247_10138685	All Organisms → cellular organisms → Bacteria	1592	Open in IMG/M
3300009143\|Ga0099792_10236380	Not Available	1057	Open in IMG/M
3300009143\|Ga0099792_10417095	Not Available	825	Open in IMG/M
3300009176\|Ga0105242_10126234	All Organisms → cellular organisms → Bacteria	2202	Open in IMG/M
3300009545\|Ga0105237_10741210	All Organisms → cellular organisms → Bacteria	989	Open in IMG/M
3300009551\|Ga0105238_10221375	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1869	Open in IMG/M
3300010043\|Ga0126380_11635181	Not Available	576	Open in IMG/M
3300010046\|Ga0126384_12081090	Not Available	544	Open in IMG/M
3300010358\|Ga0126370_10589459	All Organisms → cellular organisms → Bacteria → Proteobacteria	958	Open in IMG/M
3300010361\|Ga0126378_12038859	Not Available	654	Open in IMG/M
3300010366\|Ga0126379_11603743	Not Available	756	Open in IMG/M
3300010366\|Ga0126379_12365837	Not Available	631	Open in IMG/M
3300010373\|Ga0134128_10192288	All Organisms → cellular organisms → Bacteria	2301	Open in IMG/M
3300010373\|Ga0134128_11245774	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300010375\|Ga0105239_11023201	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300010376\|Ga0126381_100777604	All Organisms → cellular organisms → Bacteria	1373	Open in IMG/M
3300010397\|Ga0134124_10174504	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1934	Open in IMG/M
3300010398\|Ga0126383_11547229	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
3300011269\|Ga0137392_10077462	All Organisms → cellular organisms → Bacteria	2574	Open in IMG/M
3300011332\|Ga0126317_10023021	Not Available	617	Open in IMG/M
3300012096\|Ga0137389_10152667	All Organisms → cellular organisms → Bacteria	1891	Open in IMG/M
3300012199\|Ga0137383_10764187	Not Available	706	Open in IMG/M
3300012210\|Ga0137378_10033246	All Organisms → cellular organisms → Bacteria	4581	Open in IMG/M
3300012210\|Ga0137378_10134045	All Organisms → cellular organisms → Bacteria	2291	Open in IMG/M
3300012351\|Ga0137386_10727393	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300012357\|Ga0137384_10000235	All Organisms → cellular organisms → Bacteria	40350	Open in IMG/M
3300012917\|Ga0137395_10001441	All Organisms → cellular organisms → Bacteria → Acidobacteria	11071	Open in IMG/M
3300012929\|Ga0137404_10745074	All Organisms → cellular organisms → Bacteria	888	Open in IMG/M
3300012944\|Ga0137410_10858706	Not Available	765	Open in IMG/M
3300012944\|Ga0137410_11583814	Not Available	573	Open in IMG/M
3300012955\|Ga0164298_10181386	All Organisms → cellular organisms → Bacteria	1213	Open in IMG/M
3300012960\|Ga0164301_10154572	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1408	Open in IMG/M
3300012960\|Ga0164301_11149122	Not Available	620	Open in IMG/M
3300012984\|Ga0164309_11150046	Not Available	648	Open in IMG/M
3300012986\|Ga0164304_10898987	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300012989\|Ga0164305_10646142	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300012989\|Ga0164305_11259921	Not Available	644	Open in IMG/M
3300013105\|Ga0157369_10097420	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3138	Open in IMG/M
3300013105\|Ga0157369_10992689	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300013105\|Ga0157369_11408294	Not Available	710	Open in IMG/M
3300015245\|Ga0137409_10111824	All Organisms → cellular organisms → Bacteria	2524	Open in IMG/M
3300018468\|Ga0066662_10180656	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1641	Open in IMG/M
3300018468\|Ga0066662_10920040	Not Available	860	Open in IMG/M
3300018468\|Ga0066662_11136326	Not Available	784	Open in IMG/M
3300019789\|Ga0137408_1165999	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	3337	Open in IMG/M
3300020076\|Ga0206355_1266916	Not Available	516	Open in IMG/M
3300020078\|Ga0206352_10206988	All Organisms → cellular organisms → Bacteria	1208	Open in IMG/M
3300020579\|Ga0210407_10000218	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	71374	Open in IMG/M
3300021170\|Ga0210400_10001433	All Organisms → cellular organisms → Bacteria	23753	Open in IMG/M
3300021403\|Ga0210397_10000080	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	79024	Open in IMG/M
3300021403\|Ga0210397_10148031	All Organisms → cellular organisms → Bacteria	1639	Open in IMG/M
3300021404\|Ga0210389_10341565	All Organisms → cellular organisms → Bacteria	1175	Open in IMG/M
3300021475\|Ga0210392_11272850	Not Available	550	Open in IMG/M
3300021560\|Ga0126371_10281057	All Organisms → cellular organisms → Bacteria	1786	Open in IMG/M
3300021560\|Ga0126371_10437556	All Organisms → cellular organisms → Bacteria	1453	Open in IMG/M
3300021560\|Ga0126371_10804201	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1086	Open in IMG/M
3300021560\|Ga0126371_10828239	Not Available	1071	Open in IMG/M
3300021560\|Ga0126371_12144796	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	674	Open in IMG/M
3300022467\|Ga0224712_10096199	All Organisms → cellular organisms → Bacteria	1248	Open in IMG/M
3300022726\|Ga0242654_10378329	Not Available	539	Open in IMG/M
3300025899\|Ga0207642_10396343	Not Available	825	Open in IMG/M
3300025905\|Ga0207685_10507664	Not Available	635	Open in IMG/M
3300025905\|Ga0207685_10663375	Not Available	565	Open in IMG/M
3300025906\|Ga0207699_10115015	All Organisms → cellular organisms → Bacteria	1731	Open in IMG/M
3300025906\|Ga0207699_10592673	All Organisms → cellular organisms → Bacteria	807	Open in IMG/M
3300025910\|Ga0207684_11420665	Not Available	567	Open in IMG/M
3300025912\|Ga0207707_10273584	All Organisms → cellular organisms → Bacteria	1464	Open in IMG/M
3300025912\|Ga0207707_10398800	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300025915\|Ga0207693_10210121	All Organisms → cellular organisms → Bacteria	1530	Open in IMG/M
3300025916\|Ga0207663_10497132	Not Available	947	Open in IMG/M
3300025924\|Ga0207694_10038256	All Organisms → cellular organisms → Bacteria	3688	Open in IMG/M
3300025929\|Ga0207664_12001961	Not Available	502	Open in IMG/M
3300025934\|Ga0207686_10087149	All Organisms → cellular organisms → Bacteria	2053	Open in IMG/M
3300026319\|Ga0209647_1011888	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5785	Open in IMG/M
3300026319\|Ga0209647_1092065	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1467	Open in IMG/M
3300026322\|Ga0209687_1271386	Not Available	530	Open in IMG/M
3300026551\|Ga0209648_10000218	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	42687	Open in IMG/M
3300026551\|Ga0209648_10225875	All Organisms → cellular organisms → Bacteria	1407	Open in IMG/M
3300026555\|Ga0179593_1080416	All Organisms → cellular organisms → Bacteria	3497	Open in IMG/M
3300026557\|Ga0179587_11085923	Not Available	527	Open in IMG/M
3300027583\|Ga0209527_1003021	All Organisms → cellular organisms → Bacteria	3384	Open in IMG/M
3300027616\|Ga0209106_1124188	Not Available	578	Open in IMG/M
3300027773\|Ga0209810_1110658	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1214	Open in IMG/M
3300027817\|Ga0209112_10291867	Not Available	576	Open in IMG/M
3300027821\|Ga0209811_10033888	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1708	Open in IMG/M
3300027826\|Ga0209060_10001245	All Organisms → cellular organisms → Bacteria	29568	Open in IMG/M
3300027842\|Ga0209580_10028343	All Organisms → cellular organisms → Bacteria	2532	Open in IMG/M
3300027857\|Ga0209166_10208159	Not Available	1050	Open in IMG/M
3300027857\|Ga0209166_10541249	Not Available	596	Open in IMG/M
3300027857\|Ga0209166_10686285	Not Available	516	Open in IMG/M
3300027894\|Ga0209068_10122129	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1390	Open in IMG/M
3300027894\|Ga0209068_10215798	All Organisms → cellular organisms → Bacteria → Acidobacteria	1059	Open in IMG/M
3300030525\|Ga0210273_1211970	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300031057\|Ga0170834_100001475	Not Available	1016	Open in IMG/M
3300031231\|Ga0170824_103346457	Not Available	759	Open in IMG/M
3300031231\|Ga0170824_124191281	Not Available	777	Open in IMG/M
3300031231\|Ga0170824_127549597	Not Available	682	Open in IMG/M
3300031446\|Ga0170820_16242746	Not Available	549	Open in IMG/M
3300031474\|Ga0170818_111448852	Not Available	503	Open in IMG/M
3300031996\|Ga0308176_10504954	All Organisms → cellular organisms → Bacteria	1228	Open in IMG/M
3300031996\|Ga0308176_10726734	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300032174\|Ga0307470_10747127	Not Available	751	Open in IMG/M
3300033486\|Ga0316624_10412103	All Organisms → cellular organisms → Bacteria	1133	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.11%
Host-Associated	Host-Associated	15.54%
Engineered	Engineered	1.35%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.73%
Plants	Host-Associated → Plants	14.19%
Aquatic	Environmental → Aquatic	3.38%
Human	Host-Associated → Human	1.35%
Solid Waste	Engineered → Solid Waste	1.35%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	79.73%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.46%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.73%
Sediment	Environmental → Aquatic → Sediment	2.70%
Digestive System	Host-Associated → Human → Digestive System	1.35%
Grass	Engineered → Solid Waste → Grass	1.35%
Freshwater	Environmental → Aquatic → Freshwater	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	62.84%
Loam	Environmental → Terrestrial → Soil → Loam	15.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.46%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.73%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.70%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.35%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	1.35%
Composting	Engineered → Solid Waste → Grass → Composting	1.35%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	41.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.16%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.46%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.73%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.70%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.35%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.35%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	1.35%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	1.35%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.68%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.68%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.68%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	12.84%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	10.81%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.46%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.73%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.73%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	4.05%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.05%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.38%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.38%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.70%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.03%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.03%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.03%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.03%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.03%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.03%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.35%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.35%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	1.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.35%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	1.35%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.68%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.68%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005640	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental	Open in IMG/M
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027583	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027616	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027817	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300030525	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NODE_04180262	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MFDGKNNRLLDSFSFRAALITAVVALWSGAGYVLLALA*
NODE_07143402	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MFDGKNNRLLDSFAFRLALTAAAFALWAGAGYALIALI*
Ga0058861_119227521	3300004800	Host-Associated	SGAHMFDGKNNRILDSFSFRLALTVAVFAAWSGAGYILLSLA*
Ga0058862_100784203	3300004803	Host-Associated	GAYMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA*
Ga0070709_116235221	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MEPGADMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA*
Ga0070711_1005086881	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	VVKSGVYMFDGKNNRILDSLSFRLALTAAVFAVWYCAGYLLLSL*
Ga0073909_100089562	3300005526	Surface Soil	MFDGKNNRILDSFSFRLALTAAVFAVWSSAGYVLLSLA*
Ga0073909_100321552	3300005526	Surface Soil	MFDSKNNRILDSLSFRLALMAAVFAVWSGAGYILLAL*
Ga0073909_101226412	3300005526	Surface Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA*
Ga0070679_1015813092	3300005530	Corn Rhizosphere	SGAYMFDGKNNRLLDSFSFRLAVTAAVFAVWSGAGYALLYLA*
Ga0070734_1000107212	3300005533	Surface Soil	MFDGKNNRILDSFSFRMALTAAVFAAWSGAGYLLLSLA*
Ga0070734_100155143	3300005533	Surface Soil	MFEGKNNRILDSFTFRLALTVAILAAWSGAGYLLLSV*
Ga0070730_1000104024	3300005537	Surface Soil	MFDGKNNRLLDSFSFRVVLITAVLALWSGASYVLLALA*
Ga0070730_100763132	3300005537	Surface Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWTGAGYVLLYLA*
Ga0070732_100049324	3300005542	Surface Soil	MFDGKNNRLLDSFSFRLALTAAVFAAWSGAGYILLSLA*
Ga0070732_101155162	3300005542	Surface Soil	MFDGNNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA*
Ga0066692_101929362	3300005555	Soil	MFEGKNNRLLDSFSFRLALMVAIFAAWSGAGYLLLSLS*
Ga0068855_1000503353	3300005563	Corn Rhizosphere	MFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA*
Ga0068855_1021342082	3300005563	Corn Rhizosphere	MFDGKNNRILDSFSFRLALTAAVFAAWSGAGYILLYLA*
Ga0066702_100142982	3300005575	Soil	MFDGKNNRLLDSFSFRVALTAAIFALWSGAGYVLLALA*
Ga0066702_103468241	3300005575	Soil	MFDGKNNRILDSFSFRLAVTAAVFALWSGAGYVLLALA*
Ga0066702_105184331	3300005575	Soil	MFDGKNNRLLDSFSFRLALTAAVFATWAGAGYMLLSLA*
Ga0068854_1012824872	3300005578	Corn Rhizosphere	SGAHMFDGKNNRLLDSFSFRLAVTAAVFAAWSGAGYILLYLA*
Ga0068856_1001327082	3300005614	Corn Rhizosphere	MFDSKNNRLLDSFSFRLALTAAIFAAWTGAGYLLLSLA*
Ga0068852_1002041623	3300005616	Corn Rhizosphere	LGAHMFDGKNNRMLDSFSFRLALTAAIFAAWTGAGYLLLSLA*
Ga0075035_15997802	3300005640	Permafrost Soil	MFDGRNNRILDSFSFRLALTAAVFAAWSGAAYMLLSLA*
Ga0066903_1000811112	3300005764	Tropical Forest Soil	MFDGKNNRLLDSFSFRIGLTVVALALWSGAGYALLSLL*
Ga0066903_1001248042	3300005764	Tropical Forest Soil	MFDGKNNRLLDSFSFRIVATVSIFLAWFGAGYLLLTLA*
Ga0068851_100315112	3300005834	Corn Rhizosphere	MFDGKNNRMLDSFSFRLALTAAIFAAWTGAGYLLLSLA*
Ga0070717_101849593	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	SGAHMFDGKNNRLLDSFSFRLALTAAVFAVWSGAGYILLSLA*
Ga0070717_108617471	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRLLDSFSFRLAVTAAVFAAWSGAGYVLLYLA*
Ga0075023_1000292862	3300006041	Watersheds	MFEGKNNRLLDSFSFRLALMVAIFAAWSGAGYLLLSLG*
Ga0075028_1000145404	3300006050	Watersheds	MFDGKNNRLLDSFTLRLTLTLGVFAAWAGASYILLALA*
Ga0070716_1001251281	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRLLDSFSFRIALTVVVFALWSGAGYALLSLL*
Ga0070712_1000074929	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRLLDSFSFRLAVTAAVFAVWSGAGYVLLYLA*
Ga0070712_1005062702	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	GVYMFDGKNNRILDSLSFRLALTAAVFAVWYCAGYLLLSL*
Ga0079222_118982431	3300006755	Agricultural Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWTGAGYVLLYMA*
Ga0075425_1020336562	3300006854	Populus Rhizosphere	MFDGKNNRLLDSFAFRLALLAAVLAVWSGAGYVLLALA*
Ga0075434_1001215383	3300006871	Populus Rhizosphere	MFDGKNNRLLDSFAFRLALLAGILALWSGAGYLLLALA*
Ga0075426_112381021	3300006903	Populus Rhizosphere	MFDGKNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYMA*
Ga0079219_106895142	3300006954	Agricultural Soil	MFDGKNNRLLDSFSFRLALTAAVFVVWSGAGYVLLYLA*
Ga0099795_101793202	3300007788	Vadose Zone Soil	MFDGKNNRLLDSMYFRLLLTTGGFLVWFGASYLLLSLS*
Ga0099827_102035025	3300009090	Vadose Zone Soil	FDGKNNRLLDSMYFRLLLTTAGFLVWCGASYMLLSLS*
Ga0105240_110983861	3300009093	Corn Rhizosphere	MFDGKNNRILDSFSFRLAITAAVFAAWTGAGYVLLY
Ga0105247_101386852	3300009101	Switchgrass Rhizosphere	MFDSKNNRLLDSFSFRLALTAAIFAAWTGAGYVLLSLA*
Ga0099792_102363802	3300009143	Vadose Zone Soil	MVKGVHMFDGKNNQILDSFSFRLALTAAVFAAWSGAGYVLLYLA*
Ga0099792_104170952	3300009143	Vadose Zone Soil	MFDGKNNRILDSFSFRVAVTAAVFAAWSAAGYVLLYLA*
Ga0105242_101262342	3300009176	Miscanthus Rhizosphere	MFDGKNNRILDSFSFRLALTVAVFAAWSGAGYILLSLA*
Ga0105237_107412102	3300009545	Corn Rhizosphere	MFDGKNNRILDSFSFRLAITAAVFAAWTGAGYVLLYLA*
Ga0105238_102213753	3300009551	Corn Rhizosphere	MFDGKNNRLLDSFSFRLAVTAAVFAAWSGAGYILLYLA*
Ga0126380_116351811	3300010043	Tropical Forest Soil	MFDSKNNRLLDSFSFRVTLIVVVFALWSGAGYALLSLL*
Ga0126384_120810901	3300010046	Tropical Forest Soil	MFDNKNNRLLDSFSFRAALITAVLALWSGAGYMLLALA*
Ga0126370_105894592	3300010358	Tropical Forest Soil	MFDGKNNRLLDSFSFRIVATVSLFLAWFGAGYLVLALA*
Ga0126378_120388591	3300010361	Tropical Forest Soil	MFDGKNNRLLDSFAFRMTLTIAIFALWSGAGYALLSML*
Ga0126379_116037432	3300010366	Tropical Forest Soil	MFDGKNNRILDSFVFRLAVSSAVFAAWAGGGYILLSLS*
Ga0126379_123658371	3300010366	Tropical Forest Soil	MFDGKNNRLLDSFAFRLALLATILAIWSGAGYVLLSLA*
Ga0134128_101922882	3300010373	Terrestrial Soil	MFDGKNNRLLDSFTFRMALTAAIFAAWSGAGYLLLSLA*
Ga0134128_112457742	3300010373	Terrestrial Soil	FDGKNNRLLDSFSLRLLMTATVFAAWFGAGYVLLALA*
Ga0105239_110232011	3300010375	Corn Rhizosphere	KNNRLLDSFSFRLAVTAAVFAAWSGAGYILLYLA*
Ga0126381_1007776042	3300010376	Tropical Forest Soil	MFDGKNNRLLDSAYFRLTVTAAAFLVWFGAGYLLLTLA*
Ga0134124_101745043	3300010397	Terrestrial Soil	MKPGADMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA*
Ga0126383_115472292	3300010398	Tropical Forest Soil	MSENQELLMFDGKNNRILDSLSFRLALTAAVFAVWYGAGYLLLSL*
Ga0126383_123409271	3300010398	Tropical Forest Soil	MFDGKNNRLLDSFYFRALATTGAFLAWFGIGYLVLALA*
Ga0137392_100774622	3300011269	Vadose Zone Soil	MDGQGVHMFDGKNNQILDSFSFRLALTAAVFVAWSGAGYVLLYLA*
Ga0126317_100230211	3300011332	Soil	GAYMFDGKNNRILDSFSFRIALTAAVFATWAGAGYILLSLA*
Ga0137389_101526672	3300012096	Vadose Zone Soil	MFDSKNNRLLDSFSFRLFMTAAVFAAWFGAGYVLLSLA*
Ga0137383_107641871	3300012199	Vadose Zone Soil	MFDGKNNRLLDSFSFRFVITAAAFIAWVGASYVLLSLA*
Ga0137378_100332467	3300012210	Vadose Zone Soil	MFDGKNNRLLDSFSFRFMMTAAAFVVWLGAGYVLLSLR*
Ga0137378_101340453	3300012210	Vadose Zone Soil	MFDGKNNRLLDSFSFRFLMTATVFAVWLGAGYVLLSRV*
Ga0137386_107273931	3300012351	Vadose Zone Soil	MVLFLGDWHMFDGKNNRLLDSFSFRFLMTATVFAVWLGAGYVLLSRV*
Ga0137384_1000023527	3300012357	Vadose Zone Soil	MFDSKNNRLLDSFSFRLIMTAAVFAAWFGAGYALLALA*
Ga0137395_1000144110	3300012917	Vadose Zone Soil	MFDGKNNRLLDSFAFRLALTAAIFAAWSGAGYVLLSLA*
Ga0137404_107450741	3300012929	Vadose Zone Soil	MFDGKNNRLLDSFLFRFLMTAAAFVAWVGAGYVLLSLA*
Ga0137410_108587061	3300012944	Vadose Zone Soil	MFDGKNNRLLDSFFFRFLMTAAAFVAWVGAGYVLLSLA*
Ga0137410_115838142	3300012944	Vadose Zone Soil	MFDGKNNRMLDSFSFRLAVTAAVFAAWSYAGYVLLSLA*
Ga0164298_101813861	3300012955	Soil	MFDGKNNRILDSFSFRMALTAAVFAAWSGAGLVLLYLA*
Ga0164301_101545722	3300012960	Soil	MFDGKNNRILDSFSFRLALTAAVFAAWTGAGYVLLYLA*
Ga0164301_111491222	3300012960	Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWVGAGYLLFSME*
Ga0164309_111500462	3300012984	Soil	MEPGADMFDGKNNRLLDSFSFRLAVTAAVFAAWSGAGYVLLYLA*
Ga0164304_108989871	3300012986	Soil	KNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA*
Ga0164305_106461421	3300012989	Soil	VHMLDGKKNRLLDSFSFRLALTAAVVAVWSGAGYVLLYLA*
Ga0164305_112599212	3300012989	Soil	MFDGKNNRLLDSFSFRLVLTAAVFAVWAGAGYLLFSLA*
Ga0157369_100974203	3300013105	Corn Rhizosphere	MFDGKNNRLLDSFSFRLAVTAAVFAVWSGAGYALLYLA*
Ga0157369_109926893	3300013105	Corn Rhizosphere	LKLERSGAYMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA*
Ga0157369_114082942	3300013105	Corn Rhizosphere	LKLERSGAYMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYILLYLA*
Ga0137409_101118242	3300015245	Vadose Zone Soil	MFDGKNNRILDSLSFRLALTAAVFAVWYGAGYLLLAL*
Ga0066662_101806562	3300018468	Grasslands Soil	MFDGKNNRLLDSFSFRVALTAAIFALWSGAGYVLLALA
Ga0066662_109200401	3300018468	Grasslands Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA
Ga0066662_111363262	3300018468	Grasslands Soil	MFEGKNNRLLDSFSFRVALTVAVFAVWSVAGYIVILLA
Ga0137408_11659992	3300019789	Vadose Zone Soil	MFDGKNNQILDSFSFRLALTAAVFAAWSGAGYVLLYLA
Ga0206355_12669161	3300020076	Corn, Switchgrass And Miscanthus Rhizosphere	FDGKNNRLLDSFSFRLAVTAAVFAAWSGAGYILLYLA
Ga0206352_102069883	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	FSGAHMFDGKNNRMLDSFSFRLALTAAIFAAWTGAGYLLLSLA
Ga0210407_1000021831	3300020579	Soil	MFDGKNNRLLDNMYFRLALITGGFLAWCGVGYALLSF
Ga0210400_1000143321	3300021170	Soil	MFDGKNNHILDSFSFRLALTAAVFAAWSCAGYVLLYLA
Ga0210397_1000008067	3300021403	Soil	MFDSKNNRMLDSMSFRLALIAAVLVLWSGAGYWLLSV
Ga0210397_101480313	3300021403	Soil	MFEGKNNRVLDSFSFRVALLVAVLAAWSGAGYLLLSV
Ga0210389_103415652	3300021404	Soil	MFDGKMFDSKNNRILDSVSFRLALTMAVLAMWSGAGYWLLSL
Ga0210392_112728501	3300021475	Soil	MFEGKNNRILDSFTFRLALTVAILAAWSGAGYLLLSV
Ga0126371_102810573	3300021560	Tropical Forest Soil	MFDGKNNRLLDSFAFRVGLTAVVFAVWTGAGYALLSLL
Ga0126371_104375562	3300021560	Tropical Forest Soil	MFDGKNNRMLDSFSFRIALTAAIFAAWSGAGYLLLSLA
Ga0126371_108042011	3300021560	Tropical Forest Soil	MFDSKNNRLLDSFSFRVTLIVVAFALWSGAGYALLSLL
Ga0126371_108282392	3300021560	Tropical Forest Soil	MFDGKNNRLLDSFSFRLALTAVAFALWAGAGYALIALI
Ga0126371_121447962	3300021560	Tropical Forest Soil	GKNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA
Ga0224712_100961991	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRMLDSFSFRLALTAAIFAAWTGAGYLLLSLA
Ga0242654_103783291	3300022726	Soil	DGKNNRVLDSFSFREAVTAAVFAAWSAAGYALLYLA
Ga0207642_103963431	3300025899	Miscanthus Rhizosphere	MFDSKNNRLLDSFSFRLALTAAIFAAWTGAGYLLLSLA
Ga0207685_105076642	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRILDSFSFRLALTAAVFAVWSGAGYILLSLA
Ga0207685_106633751	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MFDSKNNRLLDSFSFRLALTAAVFVVWSGAGYVLLYLA
Ga0207699_101150151	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRLLDSFAFRLALTAVLFAAWSGAGYVLLAL
Ga0207699_105926731	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	NLMEPGADMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA
Ga0207684_114206651	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRILDSFSFRLAITAAVFAAWTGAGYVLLYLA
Ga0207707_102735842	3300025912	Corn Rhizosphere	MFDGKNNRILDSFSFRLALTAAVFAAWSGAGYILLYLA
Ga0207707_103988002	3300025912	Corn Rhizosphere	MFDGKNNRLLDSFSFRLAVTAAVFAVWSGAGYALLYLA
Ga0207693_102101212	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MEPGADMFDGKNNRILDSFSFRLALTAAVFAVWSGAGYILLSLA
Ga0207663_104971321	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MFDGKNNRMLDSFSFRLALTAAVFAVWAGAGYLLFSLA
Ga0207694_100382563	3300025924	Corn Rhizosphere	MFDGKNNRLLDSFSFRLAVTAAVFAAWSGAGYILLYLA
Ga0207664_120019611	3300025929	Agricultural Soil	GVHMFDGKNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA
Ga0207686_100871494	3300025934	Miscanthus Rhizosphere	MFDGKNNRILDSFSFRLALTVAVFAAWSGAGYILLSLA
Ga0209647_10118885	3300026319	Grasslands Soil	MFDGKNNRLLDSFAFRLALTAAIFAAWSGAGYVLLSLA
Ga0209647_10920651	3300026319	Grasslands Soil	KMDGQGVHMFDGKNNQILDSFSFRLALTAAVFVAWSGAGYVLLYLA
Ga0209687_12713861	3300026322	Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWSCAGYVLLYLA
Ga0209648_1000021830	3300026551	Grasslands Soil	MFDGKNNRLLDSFSFRILVTVGVFLAWVGAGYAVLALA
Ga0209648_102258753	3300026551	Grasslands Soil	MFDGKNNRLLDSMYFRLLLTTAGFLVWCGASYMLLSL
Ga0179593_10804166	3300026555	Vadose Zone Soil	MFDGKNNRLLDSMYFRLLLTTGGFLVWFGASYLLLSLS
Ga0179587_110859232	3300026557	Vadose Zone Soil	MDGHGVHMFDGKNNQILDSFSFRLALTAAVFAAWSGAGYILLYLA
Ga0209527_10030212	3300027583	Forest Soil	MFDGKNNRILDSFSFRVAVTAAVFAVWSAAGYVLLYLA
Ga0209106_11241881	3300027616	Forest Soil	MFDGKNNRMLDSFSFRLAVTAAVFAAWSYAGYVLLSLA
Ga0209810_11106582	3300027773	Surface Soil	MFEGKNNRILDSFSFRFALTAAVFAVWTGAGYLLLSL
Ga0209112_102918671	3300027817	Forest Soil	MFDGKMFEGKNNRILDSFSFRMALIVAIFAAWSGAGYWLLSSL
Ga0209811_100338883	3300027821	Surface Soil	MFDGKNNRILDSFSFRLALTAAVFAVWSSAGYVLLSLA
Ga0209060_1000124510	3300027826	Surface Soil	MFDGKNNRILDSFSFRMALTAAVFAAWSGAGYLLLSLA
Ga0209580_100283432	3300027842	Surface Soil	MFDGNNNRLLDSFSFRLALTAAVFAVWSGAGYVLLYLA
Ga0209166_102081592	3300027857	Surface Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWTGAGYVLLYLA
Ga0209166_105412492	3300027857	Surface Soil	GKNNRLLDSFSFRAALITAVVALWSGAGYVLLALA
Ga0209166_106862851	3300027857	Surface Soil	MFDGKNNRLLDSFSFRLALTAAVFAVWSGAGYLLLSLA
Ga0209068_101221291	3300027894	Watersheds	MFDGKNNRILDSFSFRLALTAAVFAVWSGAGYVLLSLA
Ga0209068_102157982	3300027894	Watersheds	MFDGKNNRLLDSFTLRLTLTLGVFAAWAGASYILLALA
Ga0210273_12119701	3300030525	Soil	GKNNRLLDSFFFRFLVTAAAFAAWFGASYVLLSLS
Ga0170834_1000014752	3300031057	Forest Soil	MFDGKNNRILDSFSFRMALTAAVFATWAGAGYILLSLA
Ga0170824_1033464571	3300031231	Forest Soil	MFDGKMFDSKNNRILDSVSFRVALATAIFAAWYGAGYWLLSV
Ga0170824_1241912812	3300031231	Forest Soil	MGSQEFFMFEGKNNRILDSFTFRLALTVAILAAWSGAGYLLLSV
Ga0170824_1275495972	3300031231	Forest Soil	MFDGKNNRLLDSFPFRLLMTAAVFAAWFGAGYVLLALA
Ga0170820_162427461	3300031446	Forest Soil	MFDSKNNRLLDSFPFRLLMTAAVFAAWFGAGYVLLALA
Ga0170818_1114488521	3300031474	Forest Soil	FDGKNNRILDSFSFRLALTAAVFATWVGAGYILLSLA
Ga0308176_105049542	3300031996	Soil	PIEIERSGAYMFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLYLA
Ga0308176_107267341	3300031996	Soil	MFDGKNNRILDSFSFRLALTAAVFAAWSGAGYVLLY
Ga0307470_107471272	3300032174	Hardwood Forest Soil	MFDGKNNRILDSFSFRLALTAAVFLSWSGAGYVLLSLA
Ga0316624_104121031	3300033486	Soil	MFDGKNNRLLDSLSFRLALTAAVFAVWSGAGYVLLYLA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F048521

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences