Metagenome / Metatranscriptome Family F048510

Overview

Basic Information

• Family ID: F048510
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 148
• Average Sequence Length: 37 residues
• Representative Sequence: MQRVRSLLRSTPSRIGRRIAQFVAIAAASLPDAGA
• Number of Associated Samples: 118
• Number of Associated Scaffolds: 148

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 69.23 %
• % of genes near scaffold ends (potentially truncated): 27.70 %
• % of genes from short scaffolds (< 2000 bps): 75.68 %
• Associated GOLD sequencing projects: 108
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (83.784 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.568 % of family members)
• Environment Ontology (ENVO): Unclassified (26.351 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (45.946 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 44.44%
  β-sheet: 0.00%
  Coil/Unstructured: 55.56%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 148 Family Scaffolds
PF02518	HATPase_c	22.30
PF02826	2-Hacid_dh_C	20.27
PF08521	2CSK_N	5.41
PF00486	Trans_reg_C	3.38
PF12833	HTH_18	2.70
PF01145	Band_7	2.03
PF13420	Acetyltransf_4	2.03
PF03466	LysR_substrate	2.03
PF13278	Obsolete Pfam Family	1.35
PF00920	ILVD_EDD	1.35
PF03972	MmgE_PrpD	1.35
PF07729	FCD	1.35
PF03401	TctC	0.68
PF00106	adh_short	0.68
PF01494	FAD_binding_3	0.68
PF00389	2-Hacid_dh	0.68
PF12700	HlyD_2	0.68
PF02776	TPP_enzyme_N	0.68
PF13407	Peripla_BP_4	0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 148 Family Scaffolds
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	5.41
COG0129	Dihydroxyacid dehydratase/phosphogluconate dehydratase	Carbohydrate transport and metabolism [G]	2.70
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.35
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	1.35
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	1.35
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	1.35
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.68
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.68
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.68
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.68

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.78 %
Unclassified	root	N/A	16.22 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.78 %
Unclassified	root	N/A	16.22 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	83.78 %
Unclassified	root	N/A	16.22 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	83.11 %
Unclassified	root	N/A	16.22 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	78.38 %
Unclassified	root	N/A	16.22 %

Level 6

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	75.68 %
Unclassified	root	N/A	16.22 %

Level 7

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	71.62 %
Unclassified	root	N/A	16.22 %

Level 8

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	69.59 %
Unclassified	root	N/A	16.22 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.68 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.22 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	9.46 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	2.70 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.68 %
unclassified Afipia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia	0.68 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.22 %
Bradyrhizobium sp. ARR65	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	9.46 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	2.70 %
Afipia sp. GAS231	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231	0.68 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.68 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459004|F62QY1Z02HP3CQ	All Organisms → cellular organisms → Bacteria → Proteobacteria	508
2170459010|GIO7OMY02HCBD0	Not Available	509
3300001661|JGI12053J15887_10284094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	813
3300001686|C688J18823_10502489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	778
3300001867|JGI12627J18819_10090961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1263
3300004799|Ga0058863_11534226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	546
3300005434|Ga0070709_10255624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1264
3300005437|Ga0070710_10980211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	615
3300005529|Ga0070741_10063401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	4266
3300005529|Ga0070741_10320155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1449
3300005529|Ga0070741_10362385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1342
3300005529|Ga0070741_10460606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1157
3300005533|Ga0070734_10017078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	4931
3300005533|Ga0070734_10056197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2371
3300005533|Ga0070734_10464695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	721
3300005537|Ga0070730_10000079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	124437
3300005548|Ga0070665_100064194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	3682
3300005563|Ga0068855_100191514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2306
3300005563|Ga0068855_100298893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1783
3300005563|Ga0068855_100362388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	1595
3300005563|Ga0068855_100418163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1467
3300005577|Ga0068857_101741209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	609
3300005598|Ga0066706_10961876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	661
3300005610|Ga0070763_10359132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	812
3300005614|Ga0068856_102433999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	531
3300005764|Ga0066903_100161736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	3248
3300005764|Ga0066903_101330210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1344
3300005764|Ga0066903_108800553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	512
3300005921|Ga0070766_10113897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1618
3300005944|Ga0066788_10007805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2209
3300006028|Ga0070717_10833697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	839
3300006028|Ga0070717_11225275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	683
3300006028|Ga0070717_11555669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	600
3300006041|Ga0075023_100015163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2059
3300006173|Ga0070716_100520465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	881
3300006354|Ga0075021_10202393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1212
3300006755|Ga0079222_10218380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1165
3300006804|Ga0079221_10046706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	1921
3300006893|Ga0073928_10714069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	698
3300007265|Ga0099794_10243569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	926
3300009093|Ga0105240_10141693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	2873
3300009093|Ga0105240_10741509	Not Available	1069
3300009093|Ga0105240_11961860	All Organisms → cellular organisms → Bacteria → Proteobacteria	609
3300009093|Ga0105240_12193240	Not Available	573
3300009143|Ga0099792_10400017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	840
3300009551|Ga0105238_10003445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	15739
3300009660|Ga0105854_1070930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1068
3300010046|Ga0126384_12294444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	521
3300010154|Ga0127503_10969069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	625
3300010159|Ga0099796_10108041	Not Available	1056
3300010361|Ga0126378_10012457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	7042
3300010366|Ga0126379_11301423	Not Available	833
3300010366|Ga0126379_11951327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	690
3300010376|Ga0126381_104708151	Not Available	525
3300010376|Ga0126381_104957959	Not Available	511
3300010379|Ga0136449_102197076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	805
3300010867|Ga0126347_1424515	Not Available	523
3300011269|Ga0137392_10221573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1552
3300012200|Ga0137382_10264619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1194
3300012201|Ga0137365_11355295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	502
3300012207|Ga0137381_10993861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	724
3300012212|Ga0150985_117818804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	668
3300012923|Ga0137359_10198559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1792
3300013104|Ga0157370_10127920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2371
3300014657|Ga0181522_10469832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	756
3300017944|Ga0187786_10130989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	884
3300017947|Ga0187785_10014260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2747
3300017947|Ga0187785_10424639	Not Available	645
3300018035|Ga0187875_10603709	Not Available	579
3300020076|Ga0206355_1265808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	842
3300020170|Ga0179594_10000536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	8470
3300020170|Ga0179594_10368945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	545
3300020199|Ga0179592_10007508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4672
3300020579|Ga0210407_10039254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3521
3300020580|Ga0210403_10524159	All Organisms → cellular organisms → Bacteria	961
3300021086|Ga0179596_10073453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1491
3300021086|Ga0179596_10721392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	504
3300021088|Ga0210404_10637380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	606
3300021168|Ga0210406_10404745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1093
3300021374|Ga0213881_10018325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2889
3300021374|Ga0213881_10086202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1351
3300021384|Ga0213876_10045145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2331
3300021384|Ga0213876_10189175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1095
3300021384|Ga0213876_10374929	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	757
3300021403|Ga0210397_10434818	Not Available	986
3300021403|Ga0210397_10967592	Not Available	660
3300021404|Ga0210389_11233506	All Organisms → cellular organisms → Bacteria → Proteobacteria	575
3300021407|Ga0210383_11672910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	522
3300021478|Ga0210402_10324842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231	1426
3300021560|Ga0126371_10104644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	2826
3300021560|Ga0126371_10497253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1367
3300021560|Ga0126371_12281788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	654
3300022467|Ga0224712_10373746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	676
3300022508|Ga0222728_1057829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	665
3300022510|Ga0242652_1042239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	557
3300022511|Ga0242651_1051469	Not Available	510
3300022512|Ga0242676_1019427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	697
3300022529|Ga0242668_1044630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	772
3300022722|Ga0242657_1166966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	590
3300024271|Ga0224564_1124984	All Organisms → cellular organisms → Bacteria → Proteobacteria	528
3300024288|Ga0179589_10003471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3967
3300025898|Ga0207692_10578619	Not Available	720
3300025906|Ga0207699_10743156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	719
3300025909|Ga0207705_10365661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1113
3300025910|Ga0207684_10221974	Not Available	1631
3300025911|Ga0207654_11121999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	573
3300025912|Ga0207707_10000088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	90991
3300025912|Ga0207707_10026854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5031
3300025912|Ga0207707_10044581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3867
3300025917|Ga0207660_10603884	Not Available	894
3300025920|Ga0207649_11050636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	642
3300025944|Ga0207661_10004757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	9507
3300025949|Ga0207667_10504175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1227
3300026078|Ga0207702_11812903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	602
3300026215|Ga0209849_1015176	All Organisms → cellular organisms → Bacteria → Proteobacteria	1277
3300027307|Ga0209327_1074169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	503
3300027517|Ga0209113_1011530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1111
3300027645|Ga0209117_1000325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	23230
3300027725|Ga0209178_1033564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	1618
3300027826|Ga0209060_10008467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	6479
3300027826|Ga0209060_10386627	Not Available	637
3300027857|Ga0209166_10514194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	614
3300027894|Ga0209068_10034209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	2529
3300030981|Ga0102770_11191792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	653
3300031057|Ga0170834_101482598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1600
3300031231|Ga0170824_111248910	Not Available	880
3300031544|Ga0318534_10001163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	10148
3300031545|Ga0318541_10706590	Not Available	563
3300031573|Ga0310915_10005607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	6986
3300031668|Ga0318542_10156508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1135
3300031708|Ga0310686_119605813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2652
3300031716|Ga0310813_11521009	All Organisms → cellular organisms → Bacteria → Proteobacteria	623
3300031719|Ga0306917_10510079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	945
3300031771|Ga0318546_10304362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1104
3300031782|Ga0318552_10340869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	763
3300031893|Ga0318536_10260000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	882
3300031897|Ga0318520_10911289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	554
3300031941|Ga0310912_10207262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1500
3300031962|Ga0307479_10735236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	965
3300032160|Ga0311301_12612369	All Organisms → cellular organisms → Bacteria → Proteobacteria	560
3300032828|Ga0335080_10267297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1865
3300032892|Ga0335081_12737372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	502
3300033134|Ga0335073_11736299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	587

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.78%
Host-Associated	Host-Associated	16.22%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.05%
Plants	Host-Associated → Plants	15.54%
Aquatic	Environmental → Aquatic	4.73%
Human	Host-Associated → Human	0.68%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.70%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.76%
Freshwater	Environmental → Aquatic → Freshwater	2.03%
Sediment	Environmental → Aquatic → Sediment	2.03%
Roots	Host-Associated → Plants → Roots	2.03%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	1.35%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.68%
Digestive System	Host-Associated → Human → Digestive System	0.68%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	53.38%
Loam	Environmental → Terrestrial → Soil → Loam	18.24%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.08%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.73%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.03%
Unclassified	Host-Associated → Plants → Roots → Unclassified	2.03%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.03%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.35%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	1.35%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.68%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.68%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.68%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.05%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	20.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.46%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.73%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.05%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.03%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.03%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.03%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.03%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	2.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.03%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.35%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	1.35%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.68%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.68%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.68%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.68%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	17.57%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.14%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	7.43%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.08%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.08%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.41%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.73%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.05%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.38%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.03%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.03%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.03%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.03%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.03%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	2.03%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.35%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.35%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	1.35%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.35%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.35%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.35%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	1.35%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.35%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.68%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.68%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.68%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.68%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.68%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.68%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.68%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.68%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.68%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2170459004	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)	Environmental
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental
3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Host-Associated
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental
3300005944	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048	Environmental
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009660	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated
3300014657	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG	Environmental
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental
3300018035	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10	Environmental
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300022504	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022508	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)	Environmental
3300022510	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022511	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)	Environmental
3300022512	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)	Environmental
3300022529	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)	Environmental
3300022722	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)	Environmental
3300024271	Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5	Environmental
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026215	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)	Environmental
3300027058	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)	Environmental
3300027307	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)	Environmental
3300027517	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)	Environmental
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300030981	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental
3300033134	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4B_03617960	2170459004	Grass Soil	MQRVRSLLRSTPSRIGRRIAQFVAIAAASLPDAGA
F62_08809320	2170459010	Grass Soil	MQRVRSLLRATPGRISRRIAQFVAIAAASLPDAGA
JGI12053J15887_102840941	3300001661	Forest Soil	MQRVRSLLRATPAEIGRRFAQFVAIAAASLPDVGA*
C688J18823_105024892	3300001686	Soil	MRRLRSLLRSTPSRIGRRLAAIVTIAAASLPTAGV*
JGI12627J18819_100909611	3300001867	Forest Soil	MQRVASLLRSTPSRIGRRIAQFVAIAAASLPDVGA*
JGI12627J18819_101001812	3300001867	Forest Soil	MILRAPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA*
Ga0058863_115342262	3300004799	Host-Associated	FLPRGERILVMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA*
Ga0070709_102556241	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	PGHGRVLIMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA*
Ga0070710_109802112	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	EDISMERVRSFLRSTPSRVSRRIAQFVAIAAASLPDAGA*
Ga0070741_100634013	3300005529	Surface Soil	MERVRSLLRSTPSRISRGIARFVALAAASLPDAGA*
Ga0070741_103201552	3300005529	Surface Soil	MQRVRSLLRTTPSRIRDRIAPFVAIAAASLPDGGA*
Ga0070741_103623852	3300005529	Surface Soil	MQRVRSLLRTTPHLIKSRIAQFVAIAAASLPDAGV*
Ga0070741_104606061	3300005529	Surface Soil	MERVRSLLRSTPSRLGRRIAQIVAIAAASLPDAGA*
Ga0070734_100170784	3300005533	Surface Soil	MSMARINRLLRSAPSRIGRRIAQFVAIAAASLPDAGA*
Ga0070734_100561973	3300005533	Surface Soil	MERVRSLLRSTPSRLGRRIAQIVAIAAASLPEAGA*
Ga0070734_104646952	3300005533	Surface Soil	MSMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA*
Ga0070730_1000007947	3300005537	Surface Soil	MERVRSLLRSTPKLRRRIAELVAIAAASLPDAGA*
Ga0070665_1000641942	3300005548	Switchgrass Rhizosphere	MERVRSLLRSTPSRISRRIAQFVAIAAASLPDAGA*
Ga0068855_1001915141	3300005563	Corn Rhizosphere	PRRRRRVFGMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA*
Ga0068855_1002988931	3300005563	Corn Rhizosphere	MLRVRSLLRSTPSRIGRRIAGFVAIAAASLPDAGA*
Ga0068855_1003623882	3300005563	Corn Rhizosphere	MEWVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA*
Ga0068855_1004181632	3300005563	Corn Rhizosphere	MKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA*
Ga0068857_1017412091	3300005577	Corn Rhizosphere	MERVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA*
Ga0066706_109618762	3300005598	Soil	MRRVRSLLRATPAQIGRRLAQFVAIAAASLPDVGA*
Ga0070763_103591322	3300005610	Soil	MRRVHSLLRSAPARIGRRFAQFVAIAAASLPVAGA*
Ga0068856_1024339991	3300005614	Corn Rhizosphere	MERVRSLLRSTPSLIGRRIAQFVAIAAASLPEAGA*
Ga0066903_1001617363	3300005764	Tropical Forest Soil	MQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA*
Ga0066903_1013302102	3300005764	Tropical Forest Soil	MLRITSFMRSTPSRIGRRIAQFVAIAAASLPAVGA*
Ga0066903_1088005532	3300005764	Tropical Forest Soil	MQRVRSLLRATPGRISRRIAQFVAIAAASLPAAGA*
Ga0070766_101138972	3300005921	Soil	MRRVNSLLRSAPARIGRRFAQFVAIAAASLPIAGA*
Ga0066788_100078052	3300005944	Soil	MQRVRSLLRAAPSHIGRGIARFVAIAAASLPDVGA*
Ga0081540_10094532	3300005983	Tabebuia Heterophylla Rhizosphere	MARVRKLLQTAPSRIGRRFAQFVAIAAASLPSAGA*
Ga0070717_108336971	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MQRVASLLRSTPRRIGRRFAQFVAIAAASLPEVGA*
Ga0070717_112252753	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	REDISMERVRSLLRKTPSRISRGIARFVAIAAASLPDAGA*
Ga0070717_115556691	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MQRVRSLLRSTPSRISRGIARFVAIAAASLPGAGA*
Ga0075023_1000151632	3300006041	Watersheds	MKKVRSLLAAAPSRIGRRIAQFVAIAAASLPSAGA*
Ga0070716_1005204651	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA*
Ga0075021_102023932	3300006354	Watersheds	MRKVGSLLRAAPSRIGRRLAALVAIAAASLPDAGA*
Ga0079222_102183803	3300006755	Agricultural Soil	MERVRSLLRKTPSRIGRGIARFVAIAAASLPDAGA*
Ga0079221_100467063	3300006804	Agricultural Soil	MQRVRSLLRSAPFRLRRRLKLIVAIAAASLPDVGA*
Ga0073928_107140691	3300006893	Iron-Sulfur Acid Spring	MRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA*
Ga0099794_102435692	3300007265	Vadose Zone Soil	MRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA*
Ga0105240_101416932	3300009093	Corn Rhizosphere	MQRVASLLRSTPRRIGREIARFVAIAAASLPEVGA*
Ga0105240_107415092	3300009093	Corn Rhizosphere	MQRVRALLRTAPSRIKNRIAQFVAIAAASLPDAGA*
Ga0105240_119618601	3300009093	Corn Rhizosphere	MQRVRSLLRTAPSRIKNRIAQFVAIAAASLPDAGA*
Ga0105240_121932401	3300009093	Corn Rhizosphere	MQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA*
Ga0099792_104000171	3300009143	Vadose Zone Soil	MEGIGQMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA*
Ga0105238_1000344510	3300009551	Corn Rhizosphere	MERVRSLLRSTPSRISRRIAQFVAIVAASLPDAGA*
Ga0105854_10709303	3300009660	Permafrost Soil	MQRVRSLLRGAPSHIGRGIARFVAIAAASLPDVGA*
Ga0126384_122944442	3300010046	Tropical Forest Soil	MSMARINRLLRAAPARIGQRIAQFVAIAAASLPDAGA*
Ga0127503_109690691	3300010154	Soil	KSCAGEGIGQMRRVRSLLLATPAQIGRRFAQFVAIAAASLPDVGA*
Ga0099796_101080413	3300010159	Vadose Zone Soil	MRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA*
Ga0126378_100124576	3300010361	Tropical Forest Soil	VARKDILMQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA*
Ga0126379_113014232	3300010366	Tropical Forest Soil	MQRVRSLLWAAPAQIGRRFARFVAIAAASLPDVGA*
Ga0126379_119513271	3300010366	Tropical Forest Soil	QMQQVPSLLRTAPAEIGRRLARLVAIAAASLPDVGA*
Ga0126381_1047081512	3300010376	Tropical Forest Soil	MQKVASLLRSTPRRISRRFAQFVAIAAASLPEVGA*
Ga0126381_1049579591	3300010376	Tropical Forest Soil	MFIMQRVASLLRSTPRRISRRIAQFVAIAAASLPDVGA*
Ga0136449_1021970762	3300010379	Peatlands Soil	MRRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA*
Ga0126347_14245152	3300010867	Boreal Forest Soil	QMLRVRSLLRAAPAQIGRRLAQLVAIAAASLPEVGA*
Ga0137392_102215731	3300011269	Vadose Zone Soil	MRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA*
Ga0137382_102646191	3300012200	Vadose Zone Soil	MRQLASLLRSTPSRIGRRLALIVAIAAASLPTAGA*
Ga0137365_113552952	3300012201	Vadose Zone Soil	MRQLASLLRSTPSRIGRRLALIVAIAAASLPTAGA
Ga0137363_100516232	3300012202	Vadose Zone Soil	VGGPYNGAEGIGQMRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA*
Ga0137381_109938612	3300012207	Vadose Zone Soil	MQRVHSLLRSTRARIGRQLALIVAIAAASLPDAGA*
Ga0150985_1178188041	3300012212	Avena Fatua Rhizosphere	LMGARGYFMQKVRSLLRLTPSRISRGFARFVAIAAASLPDAGA*
Ga0137359_101985591	3300012923	Vadose Zone Soil	QMRRVRSLLRSTPAQIGRRLVQLVAIAAASLPDVGA*
Ga0157370_101279203	3300013104	Corn Rhizosphere	MQRIRSLLRSARVRISRRITQLVAIAAASLPDVGA*
Ga0181522_104698323	3300014657	Bog	SMQRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA*
Ga0187786_101309892	3300017944	Tropical Peatland	MQRVTSLLRATPSRIRRRIARFVAIAAASLPDVGA
Ga0187785_100142602	3300017947	Tropical Peatland	MARINKLLRSAPSRIGQRIAQFVAIAAASLPDAGA
Ga0187785_104246392	3300017947	Tropical Peatland	MQRVTSLLRATPSRIRRRIAQFVAIAAASLPDVGA
Ga0187875_106037091	3300018035	Peatland	MRQFSSLLRSARSRIGRGLAQFVAIAAASLPVAGV
Ga0206355_12658083	3300020076	Corn, Switchgrass And Miscanthus Rhizosphere	MQRVASLLRSTPRRIGREIARFVAIAAASLPEVGA
Ga0179594_100005361	3300020170	Vadose Zone Soil	MEGIGQMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA
Ga0179594_103689452	3300020170	Vadose Zone Soil	SCNGAEGIGQMRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA
Ga0179592_100075084	3300020199	Vadose Zone Soil	MRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA
Ga0210407_100392544	3300020579	Soil	MQQLRLLLRDAPAQIGRRFARFVAIAAASLPDAGA
Ga0210403_105241592	3300020580	Soil	MQQLRALLRKTPSRLRRRIAEFVAIAAASLPAAGA
Ga0179596_100734533	3300021086	Vadose Zone Soil	MRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA
Ga0179596_107213921	3300021086	Vadose Zone Soil	MRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA
Ga0210404_106373803	3300021088	Soil	QFLPRRGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0210406_104047452	3300021168	Soil	MERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0213881_100183254	3300021374	Exposed Rock	MQRVASLLRATPGRISRRLAQFVAIAAASLPEVGA
Ga0213881_100862022	3300021374	Exposed Rock	MERVRSLLRATPSRISRRIAQFVAIAAASLPDAGA
Ga0213876_100451452	3300021384	Plant Roots	MQKVRSLLRSTPSRISRGIARFVAIAAASLPDVGA
Ga0213876_101891752	3300021384	Plant Roots	MQRVASLLRATPRRISQRFAQFVAIAAASLPEVGA
Ga0213876_103749292	3300021384	Plant Roots	MSMERVRSLLRSTPRRISRHIARFVAIAAASLPDAGA
Ga0210397_104348182	3300021403	Soil	PEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0210397_109675922	3300021403	Soil	MSMERVRSLLRSTPTRISRHIARFVAIAAASLPDAGA
Ga0210389_112335062	3300021404	Soil	MHRVNSLLRLAQERIRRGVAQFVAIAAASLPAVGA
Ga0210383_116729101	3300021407	Soil	MRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA
Ga0210402_103248423	3300021478	Soil	MQRVRSLLRTTPGRISRRIAQFVAIAAASLPDAGA
Ga0126371_101046444	3300021560	Tropical Forest Soil	MQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA
Ga0126371_104972532	3300021560	Tropical Forest Soil	MLRITSFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0126371_122817881	3300021560	Tropical Forest Soil	SARWSFVMQGVRSLLRATPGRISRRIAQFVAIAAASLPAAGA
Ga0224712_103737461	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	QFLPRGERILVMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA
Ga0242642_10845092	3300022504	Soil	EQVPRGAEGIGQMQRVRSLVLAAPAQIRRRLARLVAIAAASLPDVGA
Ga0222728_10578293	3300022508	Soil	LVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242652_10422391	3300022510	Soil	HGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242651_10514691	3300022511	Soil	LPRHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242676_10194273	3300022512	Soil	HFLSWHGRITVMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA
Ga0242668_10446301	3300022529	Soil	RHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242657_11669661	3300022722	Soil	MEIPMRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA
Ga0224564_11249842	3300024271	Soil	MQRVNSLLRSAPAQIMRGIAYFVAIAAASLPAAGA
Ga0179589_100034713	3300024288	Vadose Zone Soil	MRRVASLLRATPAQIGRRLAQLVAIAAASLPEAGA
Ga0207692_105786191	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MERVRSLLRSTPSRIGRGIARFVAIAAASLPDVGA
Ga0207699_107431563	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	ISCPGHGRVLIMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA
Ga0207705_103656613	3300025909	Corn Rhizosphere	MQRVRALLRTAPSRIKNRIAQFVAIAAASLPDAGA
Ga0207684_102219743	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRRVRLLLRATPTQIGRHLAQFVAIAAASLPDVGA
Ga0207654_111219992	3300025911	Corn Rhizosphere	MLRVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA
Ga0207707_1000008872	3300025912	Corn Rhizosphere	MLRVRSLLRSTPSRIGRRIAGFVAIAAASLPDAGA
Ga0207707_100268543	3300025912	Corn Rhizosphere	MERVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA
Ga0207707_100445815	3300025912	Corn Rhizosphere	MQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA
Ga0207660_106038843	3300025917	Corn Rhizosphere	MKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA
Ga0207649_110506361	3300025920	Corn Rhizosphere	MEWVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA
Ga0207661_100047576	3300025944	Corn Rhizosphere	MQRVRSLLRTTPSRIKNRIAQFVAIAAASLPDAGA
Ga0207667_105041751	3300025949	Corn Rhizosphere	PRRRRRVFGMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA
Ga0207702_118129031	3300026078	Corn Rhizosphere	GFCEMERVRSLLRSTPSLIGRRIAQFVAIAAASLPEAGA
Ga0209849_10151763	3300026215	Soil	MQRVRSLLRAAPSHIGRGIARFVAIAAASLPDVGA
Ga0209111_10231482	3300027058	Forest Soil	MILRAPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0209327_10741691	3300027307	Forest Soil	GARKDIGMERVRSLLRSTPSRISRRIAQFVAIAAASLPDAGA
Ga0209113_10115302	3300027517	Forest Soil	MQQVAVLLRKAPSRIGQRIAQLVAIAAASLPDVGA
Ga0209117_10003259	3300027645	Forest Soil	MQQLRSLLRATPSRIGRRLAVIVAIAAASLPAAGA
Ga0209178_10335643	3300027725	Agricultural Soil	MQRVRSLLRSAPFRLRRRLKLIVAIAAASLPDVGA
Ga0209060_100084674	3300027826	Surface Soil	MSMARINRLLRSAPSRIGRRIAQFVAIAAASLPDAGA
Ga0209060_103866272	3300027826	Surface Soil	MSMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0209166_105141941	3300027857	Surface Soil	MRRVKSLLRSTPRRISRRIAEFVAIAAASLPDAGA
Ga0209068_100342094	3300027894	Watersheds	MKKVRSLLAAAPSRIGRRIAQFVAIAAASLPSAGA
Ga0102770_111917923	3300030981	Soil	AEGIGQMRRVASLLRATPAQIGRRLAQLVAIAAASLPDVGA
Ga0170834_1014825982	3300031057	Forest Soil	MRRVNSLLRSAPARIGRRFAQFVAIAAASLPIAGA
Ga0170824_1112489102	3300031231	Forest Soil	KDISMERVRSLLRSTPSRISRGIARFVAIAAASLPDAGA
Ga0318534_1000116311	3300031544	Soil	MQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0318541_107065901	3300031545	Soil	VFTMQRVRSLLRTTPRRIKSRIAQFVTIAAASLPDAGA
Ga0310915_100056079	3300031573	Soil	WRARNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0318542_101565081	3300031668	Soil	NRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0310686_1196058134	3300031708	Soil	MRRVNSLLRSAPARIGRRLARLVAIAAASLPVAGA
Ga0310813_115210092	3300031716	Soil	MQKVRLLLRSTPSLLSRRIAQFVAIAAASLPDAGA
Ga0306917_105100792	3300031719	Soil	MQQLHLLLRDAPVRIRRRFARFVVIAAASLPDVGA
Ga0318546_103043622	3300031771	Soil	MQRVRSLLRTTPRRIKSRIAQFVTIAAASLPDAGA
Ga0318552_103408692	3300031782	Soil	MTMARINRLLRSAPSRIGKRIAQFVAIAAASLPDAGA
Ga0318536_102600002	3300031893	Soil	AREDMTMARINRLLRSAPSRIGKRIAQFVAIAAASLPDAGA
Ga0318520_109112892	3300031897	Soil	AREDFSMARINKLLRSAPSRIGQRIAQFVAIAAASLPDAGA
Ga0310912_102072621	3300031941	Soil	RARNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0307479_107352362	3300031962	Hardwood Forest Soil	MQRVRSLLRSTPSRISRGIARFVAIAAASLPDVGA
Ga0311301_126123692	3300032160	Peatlands Soil	MRRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA
Ga0335080_102672972	3300032828	Soil	MRRVRSLLRAAPSQISRRIAQFVAIAAASLPDAGA
Ga0335081_127373722	3300032892	Soil	REDMSMARINRLLRAAPARIGQRIAQFVAIAAASLPDAGA
Ga0335073_117362992	3300033134	Soil	MAKVRKFLRKAPARIGRRFAQFVAIAAASLPAAGA