| Basic Information | |
|---|---|
| Family ID | F048383 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MELLLFIGLLSLVVSGGLLLAVMSNDPYAQDSTYSLADHELADLANPP |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.69 % |
| % of genes near scaffold ends (potentially truncated) | 39.86 % |
| % of genes from short scaffolds (< 2000 bps) | 79.73 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.162 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (13.514 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (76.351 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF08238 | Sel1 | 2.70 |
| PF04392 | ABC_sub_bind | 2.03 |
| PF03466 | LysR_substrate | 2.03 |
| PF00072 | Response_reg | 1.35 |
| PF11746 | DUF3303 | 1.35 |
| PF09362 | DUF1996 | 1.35 |
| PF00665 | rve | 1.35 |
| PF03372 | Exo_endo_phos | 1.35 |
| PF08734 | GYD | 1.35 |
| PF13817 | DDE_Tnp_IS66_C | 1.35 |
| PF13683 | rve_3 | 0.68 |
| PF02518 | HATPase_c | 0.68 |
| PF08241 | Methyltransf_11 | 0.68 |
| PF07883 | Cupin_2 | 0.68 |
| PF14026 | DUF4242 | 0.68 |
| PF02353 | CMAS | 0.68 |
| PF06779 | MFS_4 | 0.68 |
| PF01527 | HTH_Tnp_1 | 0.68 |
| PF00326 | Peptidase_S9 | 0.68 |
| PF13453 | zf-TFIIB | 0.68 |
| PF12244 | DUF3606 | 0.68 |
| PF13181 | TPR_8 | 0.68 |
| PF00144 | Beta-lactamase | 0.68 |
| PF09361 | Phasin_2 | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF13714 | PEP_mutase | 0.68 |
| PF03404 | Mo-co_dimer | 0.68 |
| PF00155 | Aminotran_1_2 | 0.68 |
| PF06666 | DUF1173 | 0.68 |
| PF01979 | Amidohydro_1 | 0.68 |
| PF13191 | AAA_16 | 0.68 |
| PF03401 | TctC | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.03 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.35 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.35 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.35 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.35 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.35 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.68 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.68 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.68 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.16 % |
| All Organisms | root | All Organisms | 37.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_115492488 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300004156|Ga0062589_101735877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 624 | Open in IMG/M |
| 3300004157|Ga0062590_100330658 | Not Available | 1206 | Open in IMG/M |
| 3300004479|Ga0062595_102576095 | Not Available | 509 | Open in IMG/M |
| 3300005165|Ga0066869_10132397 | Not Available | 526 | Open in IMG/M |
| 3300005290|Ga0065712_10208017 | Not Available | 1083 | Open in IMG/M |
| 3300005290|Ga0065712_10256965 | Not Available | 946 | Open in IMG/M |
| 3300005328|Ga0070676_10010539 | All Organisms → cellular organisms → Bacteria | 5013 | Open in IMG/M |
| 3300005328|Ga0070676_11513589 | Not Available | 517 | Open in IMG/M |
| 3300005330|Ga0070690_101148501 | Not Available | 618 | Open in IMG/M |
| 3300005331|Ga0070670_100002371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15528 | Open in IMG/M |
| 3300005331|Ga0070670_100217600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. Root404 | 1661 | Open in IMG/M |
| 3300005331|Ga0070670_101048444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 742 | Open in IMG/M |
| 3300005333|Ga0070677_10494886 | Not Available | 662 | Open in IMG/M |
| 3300005338|Ga0068868_100198129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Schlegelella → Schlegelella koreensis | 1673 | Open in IMG/M |
| 3300005338|Ga0068868_100811470 | Not Available | 845 | Open in IMG/M |
| 3300005338|Ga0068868_102056061 | Not Available | 543 | Open in IMG/M |
| 3300005345|Ga0070692_10673253 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005347|Ga0070668_100474216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1080 | Open in IMG/M |
| 3300005353|Ga0070669_100649369 | Not Available | 887 | Open in IMG/M |
| 3300005355|Ga0070671_100000674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24455 | Open in IMG/M |
| 3300005355|Ga0070671_100014591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6354 | Open in IMG/M |
| 3300005355|Ga0070671_101763631 | Not Available | 550 | Open in IMG/M |
| 3300005356|Ga0070674_100068753 | Not Available | 2496 | Open in IMG/M |
| 3300005356|Ga0070674_100386171 | Not Available | 1140 | Open in IMG/M |
| 3300005356|Ga0070674_100829084 | Not Available | 801 | Open in IMG/M |
| 3300005364|Ga0070673_100057117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3083 | Open in IMG/M |
| 3300005364|Ga0070673_100364157 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii | 1286 | Open in IMG/M |
| 3300005365|Ga0070688_101101892 | Not Available | 635 | Open in IMG/M |
| 3300005365|Ga0070688_101545746 | Not Available | 541 | Open in IMG/M |
| 3300005438|Ga0070701_10307406 | Not Available | 977 | Open in IMG/M |
| 3300005455|Ga0070663_100740361 | Not Available | 838 | Open in IMG/M |
| 3300005456|Ga0070678_100274698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1422 | Open in IMG/M |
| 3300005456|Ga0070678_100683063 | Not Available | 923 | Open in IMG/M |
| 3300005457|Ga0070662_100661313 | Not Available | 882 | Open in IMG/M |
| 3300005459|Ga0068867_101290813 | Not Available | 673 | Open in IMG/M |
| 3300005539|Ga0068853_100652150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300005539|Ga0068853_100665406 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005543|Ga0070672_101315206 | Not Available | 645 | Open in IMG/M |
| 3300005548|Ga0070665_100148541 | Not Available | 2346 | Open in IMG/M |
| 3300005564|Ga0070664_102340827 | Not Available | 507 | Open in IMG/M |
| 3300005718|Ga0068866_10497523 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300005719|Ga0068861_100100467 | Not Available | 2299 | Open in IMG/M |
| 3300005719|Ga0068861_100118967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus | 2128 | Open in IMG/M |
| 3300005719|Ga0068861_102659454 | Not Available | 505 | Open in IMG/M |
| 3300005841|Ga0068863_100157312 | Not Available | 2176 | Open in IMG/M |
| 3300005841|Ga0068863_100321043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1504 | Open in IMG/M |
| 3300005842|Ga0068858_102588791 | Not Available | 501 | Open in IMG/M |
| 3300005843|Ga0068860_100504113 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300005844|Ga0068862_101911038 | Not Available | 604 | Open in IMG/M |
| 3300006237|Ga0097621_100035013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4009 | Open in IMG/M |
| 3300006881|Ga0068865_101352280 | Not Available | 635 | Open in IMG/M |
| 3300006953|Ga0074063_14225473 | Not Available | 1046 | Open in IMG/M |
| 3300009098|Ga0105245_10816434 | Not Available | 971 | Open in IMG/M |
| 3300009148|Ga0105243_10302092 | Not Available | 1451 | Open in IMG/M |
| 3300009156|Ga0111538_11146756 | Not Available | 983 | Open in IMG/M |
| 3300009174|Ga0105241_11983590 | Not Available | 572 | Open in IMG/M |
| 3300009551|Ga0105238_10269922 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300010147|Ga0126319_1060185 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010397|Ga0134124_10115099 | Not Available | 2359 | Open in IMG/M |
| 3300011119|Ga0105246_10104664 | Not Available | 2067 | Open in IMG/M |
| 3300012212|Ga0150985_100528098 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012899|Ga0157299_10094153 | Not Available | 763 | Open in IMG/M |
| 3300012903|Ga0157289_10369974 | Not Available | 529 | Open in IMG/M |
| 3300012916|Ga0157310_10482919 | Not Available | 535 | Open in IMG/M |
| 3300012951|Ga0164300_10506430 | Not Available | 691 | Open in IMG/M |
| 3300012955|Ga0164298_10431201 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300012958|Ga0164299_10713222 | Not Available | 703 | Open in IMG/M |
| 3300012960|Ga0164301_10460839 | Not Available | 906 | Open in IMG/M |
| 3300012985|Ga0164308_10211046 | Not Available | 1487 | Open in IMG/M |
| 3300013297|Ga0157378_11357664 | Not Available | 753 | Open in IMG/M |
| 3300013306|Ga0163162_12247464 | Not Available | 626 | Open in IMG/M |
| 3300013308|Ga0157375_13004569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300014325|Ga0163163_10333805 | Not Available | 1571 | Open in IMG/M |
| 3300014325|Ga0163163_12212696 | Not Available | 609 | Open in IMG/M |
| 3300014745|Ga0157377_10468159 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300014745|Ga0157377_10600213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300015200|Ga0173480_10663462 | Not Available | 649 | Open in IMG/M |
| 3300015201|Ga0173478_10864196 | Not Available | 503 | Open in IMG/M |
| 3300015371|Ga0132258_10441395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3242 | Open in IMG/M |
| 3300015371|Ga0132258_11775968 | Not Available | 1555 | Open in IMG/M |
| 3300015372|Ga0132256_101052347 | Not Available | 929 | Open in IMG/M |
| 3300015372|Ga0132256_101193264 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300015374|Ga0132255_100166931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3087 | Open in IMG/M |
| 3300017792|Ga0163161_10862757 | Not Available | 765 | Open in IMG/M |
| 3300017792|Ga0163161_11024288 | Not Available | 706 | Open in IMG/M |
| 3300017792|Ga0163161_12005791 | Not Available | 515 | Open in IMG/M |
| 3300018083|Ga0184628_10045193 | Not Available | 2215 | Open in IMG/M |
| 3300018083|Ga0184628_10094063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus gilardii | 1538 | Open in IMG/M |
| 3300018083|Ga0184628_10410643 | Not Available | 707 | Open in IMG/M |
| 3300018083|Ga0184628_10586759 | Not Available | 565 | Open in IMG/M |
| 3300018476|Ga0190274_10002703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 10475 | Open in IMG/M |
| 3300018476|Ga0190274_11025794 | Not Available | 901 | Open in IMG/M |
| 3300018476|Ga0190274_11788445 | Not Available | 709 | Open in IMG/M |
| 3300018481|Ga0190271_10005521 | All Organisms → cellular organisms → Bacteria | 8344 | Open in IMG/M |
| 3300019361|Ga0173482_10667243 | Not Available | 533 | Open in IMG/M |
| 3300019362|Ga0173479_10195974 | Not Available | 848 | Open in IMG/M |
| 3300021082|Ga0210380_10166264 | Not Available | 992 | Open in IMG/M |
| 3300021082|Ga0210380_10193453 | Not Available | 918 | Open in IMG/M |
| 3300022894|Ga0247778_1092371 | Not Available | 799 | Open in IMG/M |
| 3300025271|Ga0207666_1050441 | Not Available | 659 | Open in IMG/M |
| 3300025315|Ga0207697_10376370 | Not Available | 631 | Open in IMG/M |
| 3300025321|Ga0207656_10000177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 22947 | Open in IMG/M |
| 3300025893|Ga0207682_10176081 | Not Available | 975 | Open in IMG/M |
| 3300025901|Ga0207688_10476085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 780 | Open in IMG/M |
| 3300025907|Ga0207645_10101386 | Not Available | 1857 | Open in IMG/M |
| 3300025908|Ga0207643_10430478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300025909|Ga0207705_10490692 | Not Available | 954 | Open in IMG/M |
| 3300025918|Ga0207662_10036918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2858 | Open in IMG/M |
| 3300025923|Ga0207681_10126540 | Not Available | 1882 | Open in IMG/M |
| 3300025924|Ga0207694_10300880 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 1321 | Open in IMG/M |
| 3300025925|Ga0207650_10050921 | All Organisms → cellular organisms → Bacteria | 3064 | Open in IMG/M |
| 3300025925|Ga0207650_10063136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2769 | Open in IMG/M |
| 3300025925|Ga0207650_10164474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. Root404 | 1760 | Open in IMG/M |
| 3300025925|Ga0207650_11360197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 604 | Open in IMG/M |
| 3300025930|Ga0207701_10388024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1204 | Open in IMG/M |
| 3300025931|Ga0207644_10059045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2773 | Open in IMG/M |
| 3300025931|Ga0207644_10518562 | Not Available | 984 | Open in IMG/M |
| 3300025931|Ga0207644_10600199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300025934|Ga0207686_10109021 | Not Available | 1864 | Open in IMG/M |
| 3300025935|Ga0207709_10363196 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300025938|Ga0207704_11426282 | Not Available | 593 | Open in IMG/M |
| 3300025940|Ga0207691_11010688 | Not Available | 694 | Open in IMG/M |
| 3300025941|Ga0207711_10001820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19466 | Open in IMG/M |
| 3300025942|Ga0207689_10019519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5712 | Open in IMG/M |
| 3300025942|Ga0207689_11199413 | Not Available | 639 | Open in IMG/M |
| 3300025972|Ga0207668_10148620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1811 | Open in IMG/M |
| 3300026023|Ga0207677_11160325 | Not Available | 706 | Open in IMG/M |
| 3300026089|Ga0207648_10202788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas | 1759 | Open in IMG/M |
| 3300026089|Ga0207648_10762839 | Not Available | 899 | Open in IMG/M |
| 3300026095|Ga0207676_10591206 | Not Available | 1065 | Open in IMG/M |
| 3300026095|Ga0207676_10909381 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300026118|Ga0207675_100210315 | Not Available | 1870 | Open in IMG/M |
| 3300026142|Ga0207698_10176479 | Not Available | 1887 | Open in IMG/M |
| 3300026142|Ga0207698_11398486 | Not Available | 715 | Open in IMG/M |
| 3300028381|Ga0268264_11701302 | Not Available | 641 | Open in IMG/M |
| 3300028587|Ga0247828_10697386 | Not Available | 632 | Open in IMG/M |
| 3300028587|Ga0247828_11216956 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300028802|Ga0307503_10030425 | Not Available | 1892 | Open in IMG/M |
| 3300028889|Ga0247827_10887154 | Not Available | 598 | Open in IMG/M |
| 3300031548|Ga0307408_100213094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1571 | Open in IMG/M |
| 3300031903|Ga0307407_10009876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4468 | Open in IMG/M |
| 3300032074|Ga0308173_11578883 | Not Available | 617 | Open in IMG/M |
| 3300033551|Ga0247830_10867335 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 13.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 9.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.35% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1154924882 | 3300000956 | Soil | MDLLLLVGLSSLVASGGLLLGVLLNNPYAQHNTESLADHELADLANPP* |
| Ga0062589_1017358771 | 3300004156 | Soil | LFIGLLSLVVSGVLLLAVMSNDAYAQDTTYSLADHELADLANPP* |
| Ga0062590_1003306583 | 3300004157 | Soil | MELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP* |
| Ga0062595_1025760951 | 3300004479 | Soil | MDLLLLIGLSSLLVSGGLLFGVLLNNPYAQDNTKSLADHELADLANPP* |
| Ga0066869_101323971 | 3300005165 | Soil | MNLFLFVLLLIVVSSLVVSGGLVLAVLHNDPYAQDSTYSLADHELADLANPP* |
| Ga0065712_102080174 | 3300005290 | Miscanthus Rhizosphere | LLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLANPP* |
| Ga0065712_102569652 | 3300005290 | Miscanthus Rhizosphere | MELLLFIGLLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLVNPP* |
| Ga0070676_100105392 | 3300005328 | Miscanthus Rhizosphere | MELLLFIGLLSLLVSGGLFWAAMSNDAYAGDSWSSLADHELADLANPP* |
| Ga0070676_115135891 | 3300005328 | Miscanthus Rhizosphere | LLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP* |
| Ga0070690_1011485012 | 3300005330 | Switchgrass Rhizosphere | MELFLFIVVSSLLVSGGLLLAVVLNNPYAQASTHSLADHELVDLANPP* |
| Ga0070670_10000237113 | 3300005331 | Switchgrass Rhizosphere | MELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLANPP* |
| Ga0070670_1002176002 | 3300005331 | Switchgrass Rhizosphere | MDVFLVIVVSSLVVSGALLVAVWDDGPYSPDNPNSLADHELADLAKPP* |
| Ga0070670_1010484441 | 3300005331 | Switchgrass Rhizosphere | FILSLPLVVSGGFLLAVLVNDPYAQASTYALADHELADLANPP* |
| Ga0070677_104948861 | 3300005333 | Miscanthus Rhizosphere | MNLFLFIFLFIVVSSLVVSGGLLLAVVLNDPWAQANTYSLADHELADLANPP* |
| Ga0068868_1001981291 | 3300005338 | Miscanthus Rhizosphere | MDVLLSLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLANPP* |
| Ga0068868_1008114702 | 3300005338 | Miscanthus Rhizosphere | MTLLVLLGLPSLVVSGALLLAVLLNDPYAQKNTYSLADHELFDLANPP* |
| Ga0068868_1020560612 | 3300005338 | Miscanthus Rhizosphere | MELFLFIVVSSLLVSGGLLLAVVLNNPYAQASTHSLADHELVDL |
| Ga0070692_106732531 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLFLFIFLFIFLFIVVSSLVVSGGLLLAVWDDGPYSPDNPNSLADHELADLAN |
| Ga0070668_1004742162 | 3300005347 | Switchgrass Rhizosphere | MGLLLFIFLFIVVSSLVVSGGLFLAVVLNDPDSQGNTYSLADHELADLANPP* |
| Ga0070669_1006493691 | 3300005353 | Switchgrass Rhizosphere | FIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP* |
| Ga0070671_10000067429 | 3300005355 | Switchgrass Rhizosphere | MELLLFIGLLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLANPP* |
| Ga0070671_1000145913 | 3300005355 | Switchgrass Rhizosphere | MDFLLFMLSSPLVVSGGFVLAVLLNNPYAQASTYSPADHELADLANPP* |
| Ga0070671_1017636311 | 3300005355 | Switchgrass Rhizosphere | MDVFLALFLFVVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLANPP* |
| Ga0070674_1000687535 | 3300005356 | Miscanthus Rhizosphere | MNAFLFLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLAHPP* |
| Ga0070674_1003861712 | 3300005356 | Miscanthus Rhizosphere | MTLLLVIGQLSIFVSGALLLAVLLNDPYPQHSTYSLADHELADLANPP* |
| Ga0070674_1008290841 | 3300005356 | Miscanthus Rhizosphere | MNLVLFIFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP* |
| Ga0070673_1000571171 | 3300005364 | Switchgrass Rhizosphere | MDFLLFILSLPLVVSGGFLLAVLVNNPYAQASTYSLADHELADLANPP* |
| Ga0070673_1003641572 | 3300005364 | Switchgrass Rhizosphere | MNLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPPGGKH* |
| Ga0070688_1011018921 | 3300005365 | Switchgrass Rhizosphere | MELFLFIVVSSLLVSGGLLLAVVLNDSDSQGNTYSLADHELADLANPP* |
| Ga0070688_1015457461 | 3300005365 | Switchgrass Rhizosphere | MGLFLFIVVSSLVVSGGLLWRVVLNDPYSQDNTYSLADHELAAL |
| Ga0070701_103074063 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLFLFIVVSSLVVSGGLLLGVVLNNPYAQRNTYSLADHELADLANPP* |
| Ga0070663_1007403612 | 3300005455 | Corn Rhizosphere | MDLFLFIVVSSLVVSGGLLLAVWDDGPYSPDNPNSLADHELADLANPP* |
| Ga0070678_1002746982 | 3300005456 | Miscanthus Rhizosphere | ARVSKGGRMDFLLFILSLPLVVSGGFLLAVLVNNPYAQASTYSLADHELADLANPP* |
| Ga0070678_1006830632 | 3300005456 | Miscanthus Rhizosphere | MELLLFIGLLSLRVSGGLFWAAMSNDAYAGDSWSSLADHELADLANPP* |
| Ga0070662_1006613132 | 3300005457 | Corn Rhizosphere | MDVLLSLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLAHPP* |
| Ga0068867_1012908131 | 3300005459 | Miscanthus Rhizosphere | MDLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPPGGKH* |
| Ga0068853_1006521502 | 3300005539 | Corn Rhizosphere | MNLFLFIFLFIVVSSLVVSGGLLLGVVLNDPYAQRNTYSLADHELADLANPP* |
| Ga0068853_1006654061 | 3300005539 | Corn Rhizosphere | STGGRMELLLFIGLLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLVNPP* |
| Ga0070672_1013152062 | 3300005543 | Miscanthus Rhizosphere | MDLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP* |
| Ga0070665_1001485416 | 3300005548 | Switchgrass Rhizosphere | FLFIVVSSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLASPP* |
| Ga0070664_1023408271 | 3300005564 | Corn Rhizosphere | MDVLLSLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLANP |
| Ga0068866_104975232 | 3300005718 | Miscanthus Rhizosphere | SLLVSGGLLLAVVLNNPYAQASTHSLADHELVDLANPP* |
| Ga0068861_1001004671 | 3300005719 | Switchgrass Rhizosphere | MELLLFIGLLSLRVSGGLFWAAMSNDAYAGDSWSSLADHE |
| Ga0068861_1001189671 | 3300005719 | Switchgrass Rhizosphere | MDFFLFIVVSSLVVSGGLFWAAMSNDAYAGDSWSSLADHELADLANPP* |
| Ga0068861_1026594541 | 3300005719 | Switchgrass Rhizosphere | MNLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP* |
| Ga0068863_1001573124 | 3300005841 | Switchgrass Rhizosphere | FLLFMLSSPLVVSGGFVLAVLLNNPYAQASTYSPADHELADLANPP* |
| Ga0068863_1003210432 | 3300005841 | Switchgrass Rhizosphere | MDFLPFILSLPLVVSGGFLLAVLVNDPYAQASTYALADHELADLANPP* |
| Ga0068858_1025887911 | 3300005842 | Switchgrass Rhizosphere | MDLLLFILSLPLVVSGGFLLAVLVNDPYAQASTYALADHELADLANPP* |
| Ga0068860_1005041131 | 3300005843 | Switchgrass Rhizosphere | VSRGGRMELFLFIVVSSLLVSGGLLLAVVLNNPYAQASTHSLADHELVDLANPP* |
| Ga0068862_1019110382 | 3300005844 | Switchgrass Rhizosphere | VSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPPGGKH* |
| Ga0097621_1000350132 | 3300006237 | Miscanthus Rhizosphere | MDFLLFILSLPLVVSGGFLLAVLVNDPYAQASTYALADHELADLANPP* |
| Ga0068865_1013522802 | 3300006881 | Miscanthus Rhizosphere | FIVVSSLVVSGGLLLGVVLNNPDAQRNTYSPADHELADLANPP* |
| Ga0074063_142254731 | 3300006953 | Soil | MELLLFIGLLSLVVSGGLLLAVMSNDPYAQDSTYSLADHELADLANPP* |
| Ga0105245_108164343 | 3300009098 | Miscanthus Rhizosphere | VSGALLLAVLLNDPYPEHSTYSLADHELADLANPP* |
| Ga0105243_103020921 | 3300009148 | Miscanthus Rhizosphere | MDLFLFIVVSSLVVSGGLLLAVWDDGPYSPDNPNSLADHELADLESPP* |
| Ga0111538_111467561 | 3300009156 | Populus Rhizosphere | MDVLLSLFLFIVVSSLVVSGGLLLAVWDGGPGFQGNPISLADHELADLAHPP* |
| Ga0105241_119835901 | 3300009174 | Corn Rhizosphere | MELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELAD |
| Ga0105238_102699222 | 3300009551 | Corn Rhizosphere | MNAFLFLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLANPP* |
| Ga0126319_10601852 | 3300010147 | Soil | RMDFFLFIVVSSLVVSGGLLLAVVLNDPDSQDSTYSLADHELADLANPP* |
| Ga0134124_101150994 | 3300010397 | Terrestrial Soil | MELLLFIGLLSLRVSGGLFWAAMSNDAYAGDSWSSLADHELGDLANPP* |
| Ga0105246_101046644 | 3300011119 | Miscanthus Rhizosphere | MDLFLFIVVSSLVVSGGLLWAVWDDGPGFQGNPNSLADHELADLANPP* |
| Ga0150985_1005280982 | 3300012212 | Avena Fatua Rhizosphere | RMGLLLFILSLSLVVSGGLVLAVWLNDPHAQTSTYSLADHELADLTNPP* |
| Ga0150984_1225526661 | 3300012469 | Avena Fatua Rhizosphere | RPRIGAIWERVSKGGRMGLLLFILSLSLVVSGGLVLAVWLNHPPAQTSTYSLADHELADLANPP* |
| Ga0157299_100941531 | 3300012899 | Soil | MELLLFIGLLSLVVSGVLLLAVMSNDAYAQDTTYSLADHELADLANPP* |
| Ga0157289_103699742 | 3300012903 | Soil | MGIVLFTFLFIVGSSLVVSGGLLLAVVLNDPDSQGNTYSLADHE |
| Ga0157310_104829191 | 3300012916 | Soil | RGGRMELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLANPP* |
| Ga0164300_105064301 | 3300012951 | Soil | MDFLLFILSLPLVVSGGFLLAVLLNNPYAQASTYSLADHELADLANPP* |
| Ga0164298_104312012 | 3300012955 | Soil | MDFFLFIVVSSLVVSGGLLLAVWDDGPYSPDNQNSLADHELADLANPP* |
| Ga0164299_107132222 | 3300012958 | Soil | MELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLA |
| Ga0164301_104608392 | 3300012960 | Soil | MDVFLFILVFIVVPSLVVSGGLLLAVWDDGPYSPANPNSLADHELADLANPP* |
| Ga0164308_102110463 | 3300012985 | Soil | MELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADIAKPP* |
| Ga0157378_103745881 | 3300013297 | Miscanthus Rhizosphere | QKQLSLSARPRIGAIYARVSKGGRMAFLLFILSLPLVVSGGFLLAVLVNNPYAQASTYSLADHELADLANPP* |
| Ga0157378_113576641 | 3300013297 | Miscanthus Rhizosphere | LSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP* |
| Ga0163162_122474641 | 3300013306 | Switchgrass Rhizosphere | MNAFLFLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLA |
| Ga0157375_130045691 | 3300013308 | Miscanthus Rhizosphere | MDVFLSILLFIVVSSLVVSGGLYWAAMYGNAYAEANTGGLADHELADLANPP* |
| Ga0163163_103338051 | 3300014325 | Switchgrass Rhizosphere | PLVVSGGFVLAVLLNNPYAQASTYSPADHELADLANPP* |
| Ga0163163_122126962 | 3300014325 | Switchgrass Rhizosphere | LLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLVNPP* |
| Ga0157377_104681591 | 3300014745 | Miscanthus Rhizosphere | IVVSSLLVSGGLLLAVVLNNPYAQASTHSLADHELVDLANPP* |
| Ga0157377_106002132 | 3300014745 | Miscanthus Rhizosphere | GGRMNAILFLFLFIVLSSLVVSGGLLWAVWDDGPGFQGNPNSLADHELADLANPP* |
| Ga0173480_106634622 | 3300015200 | Soil | MELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLAD |
| Ga0173478_108641961 | 3300015201 | Soil | MDFLLFMLSLPLVVSGGFLLAVLLNDPYAQASTYSLADHELADLANPP* |
| Ga0132258_104413953 | 3300015371 | Arabidopsis Rhizosphere | MDLLLLIGLSSLVVSGGLLFGVLLNNPYAQDNTRSLADHELADLANPP* |
| Ga0132258_117759683 | 3300015371 | Arabidopsis Rhizosphere | MDFLLFMLSSPLVVSGGFVLAVLLNNPYAQASTYSPADDELADLANPP* |
| Ga0132256_1010523472 | 3300015372 | Arabidopsis Rhizosphere | MELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANLP* |
| Ga0132256_1011932641 | 3300015372 | Arabidopsis Rhizosphere | MDVFLFIVVSSLVVSGGLLLAVWDDGPYSPDNPNSLADHELADLANPP* |
| Ga0132255_1001669311 | 3300015374 | Arabidopsis Rhizosphere | MDLLLLIGLSSLVVSGGLLFGVLLNNPYAQDNTKSLADHELADLANPP* |
| Ga0163161_108627572 | 3300017792 | Switchgrass Rhizosphere | MDLFLFIVVSSLVVSGGLLLGVVLNNPYAQRNTYSLADHELADLANPP |
| Ga0163161_110242881 | 3300017792 | Switchgrass Rhizosphere | MELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP |
| Ga0163161_120057911 | 3300017792 | Switchgrass Rhizosphere | MNLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPPGGKH |
| Ga0184628_100451934 | 3300018083 | Groundwater Sediment | MDFLLFILSLQLIVSGGAHLAVWLNDPHAQASTYSLADHELADLANPP |
| Ga0184628_100940633 | 3300018083 | Groundwater Sediment | MALLLFIGYLIVLSPLVVSAGLLLAVLLNDPYAQASTHSLADHELADLAN |
| Ga0184628_104106432 | 3300018083 | Groundwater Sediment | MDFLLFVLSLQLIVCGGALLAVWLNDPYAQASTYSLTDHELADLANPP |
| Ga0184628_105867591 | 3300018083 | Groundwater Sediment | LVVSGGFLLARLLNNPYAQTSTYSLADHELADLANPP |
| Ga0190274_100027034 | 3300018476 | Soil | MDLFLSIFLFIVVSSLVVSGGLLLAVMLNDPYAQDSTYSLADHELADLANPP |
| Ga0190274_110257943 | 3300018476 | Soil | SKGGRMDFLLFVLSLQLIVCGGALLAVWLNDPYAQASTYSLTDHELADLANPP |
| Ga0190274_117884452 | 3300018476 | Soil | MDLFLFIVVSSLVVSGGLLLGVVLNNPYAQRNTYSLADHELADL |
| Ga0190271_100055212 | 3300018481 | Soil | MDVFLFIFLFIVVSSLVVSGGLFLAMLHNGPYSQDSTYSLADHELADLANPP |
| Ga0173482_106672432 | 3300019361 | Soil | MELLLFIGLLSLLVSGGLFWAAMSNDAYAGDSWSSLADHELADLANP |
| Ga0173479_101959743 | 3300019362 | Soil | GLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLANPP |
| Ga0210380_101662642 | 3300021082 | Groundwater Sediment | MALLLFIGYLIVLSPLVVSGGLLLAVLLNDPYAQASTHSLADHELADLANPP |
| Ga0210380_101934532 | 3300021082 | Groundwater Sediment | MDFLLFILSLQLIVSGGALLAVWLNDPHAQASTYSLADHELADLANPP |
| Ga0247778_10923711 | 3300022894 | Plant Litter | MELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADHELADLANPP |
| Ga0207666_10504412 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSL |
| Ga0207697_103763701 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GRMNLFLFIFLFIFLFIVVSSLVVSGGLLLGVVLNNPDAQRNTYSPADHELADLANPP |
| Ga0207656_1000017714 | 3300025321 | Corn Rhizosphere | MELLLFIGLLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLVNPP |
| Ga0207682_101760811 | 3300025893 | Miscanthus Rhizosphere | MELLLFIGLLSLLVSGGLFWAAMSNDAYAGDSWSSLADHELADLANPP |
| Ga0207688_104760851 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MELLLFIGLLSLRVSGGLFWAAMSNDAYAGDSWSSLADHEL |
| Ga0207645_101013861 | 3300025907 | Miscanthus Rhizosphere | MDVFLVIVVSSLVVSGALLVAVWDDGPYSPDNPNSLADHELADLANPP |
| Ga0207643_104304781 | 3300025908 | Miscanthus Rhizosphere | MELLLFIGLLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLANPP |
| Ga0207705_104906922 | 3300025909 | Corn Rhizosphere | MDVFLVIVVSSLVVSGALLVAVWDDGPYSPDDPNSLADHELADLAKPP |
| Ga0207662_100369184 | 3300025918 | Switchgrass Rhizosphere | MELLLFIGLLSLRVSGGLFWAAMSNDAYAGDSWSSLADHELADLANPP |
| Ga0207681_101265401 | 3300025923 | Switchgrass Rhizosphere | MELFLFIVVSSLLVSGGLLLAVVLNNPYAQASTHSLADHELVDLANPP |
| Ga0207694_103008803 | 3300025924 | Corn Rhizosphere | MTLLLVIGQLSIFVSGALLLAVLLNDPYPQHSTYSLADHELADLANPP |
| Ga0207650_100509217 | 3300025925 | Switchgrass Rhizosphere | MDFLLFILSLPLVVSGGFLLAVLVNDPYAQASTYALADHELADL |
| Ga0207650_100631363 | 3300025925 | Switchgrass Rhizosphere | MDFLLFMLSSPLVVSGGFVLAVLLNNPYAQASTYSPADHELADLANPP |
| Ga0207650_101644744 | 3300025925 | Switchgrass Rhizosphere | MDVFLVIVVSSLVVSGALLVAVWDDGPYSPDNPNSLADHELADLAKPP |
| Ga0207650_113601972 | 3300025925 | Switchgrass Rhizosphere | VVSGGFLLAVLVNDPYAQASTYALADHELADLANPP |
| Ga0207701_103880241 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | FIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP |
| Ga0207644_100590452 | 3300025931 | Switchgrass Rhizosphere | MDLLLFILSLPLVVSGGFLLAVLVNDPYAQASTYALADHELADLANPP |
| Ga0207644_105185621 | 3300025931 | Switchgrass Rhizosphere | ELLLFIGLLSLLVSGGLFWAAMSNDAYAGDSWSSLADHELADLANPP |
| Ga0207644_106001991 | 3300025931 | Switchgrass Rhizosphere | MDFLLFILSLPLVVSGGFLLAVLVNNPYAQASTYSLADHELADLANPP |
| Ga0207686_101090212 | 3300025934 | Miscanthus Rhizosphere | MDVLLSLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLAHPP |
| Ga0207709_103631961 | 3300025935 | Miscanthus Rhizosphere | MNLFLFIFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP |
| Ga0207670_114652011 | 3300025936 | Switchgrass Rhizosphere | FCALCCARVSRGGRMELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP |
| Ga0207704_104330523 | 3300025938 | Miscanthus Rhizosphere | REQFCALCCARVSRGGRMELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP |
| Ga0207704_114262822 | 3300025938 | Miscanthus Rhizosphere | MNLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELA |
| Ga0207691_110106882 | 3300025940 | Miscanthus Rhizosphere | MDLFLFIVVSSLVVSGGLLLAVWDDGPYSPDNPNSLADHELADLASPP |
| Ga0207711_100018207 | 3300025941 | Switchgrass Rhizosphere | MDVLLFMLSSPLVVSGGFVLAVLLNNPYAQASTYSPADHELADLANPP |
| Ga0207689_100195191 | 3300025942 | Miscanthus Rhizosphere | MELLLFIGLLSLRVSGGLFWAAMSNDAYAGDSWSSLADHELADLA |
| Ga0207689_111994131 | 3300025942 | Miscanthus Rhizosphere | MDFFLFIVVSSLVVSGGLFWAAMSNDAYAGDSWSSLADHELADLA |
| Ga0207668_101486202 | 3300025972 | Switchgrass Rhizosphere | MGLLLFIFLFIVVSSLVVSGGLFLAVVLNDPDSQGNTYSLADHELADLANPP |
| Ga0207677_111603252 | 3300026023 | Miscanthus Rhizosphere | MTLLVLLGLPSLVVSGALLLAVLLNDPYAQKNTYSLADHELFDLANPP |
| Ga0207648_102027881 | 3300026089 | Miscanthus Rhizosphere | MDVLLSLFLFIVVSSLVVSGGLLLAVWDDGPGFQGNPNSLADHELADLANPP |
| Ga0207648_107628392 | 3300026089 | Miscanthus Rhizosphere | MDLFLFIFLFIVVSSLVVSGGLFWALMHNDAYAHQDNPYSLADHELADLANPP |
| Ga0207676_105912063 | 3300026095 | Switchgrass Rhizosphere | ALCCARVSRGGRMELLLFIGLLSLVVSGGLLLAVMSNDPYSQDNTYSLADHELADLANPP |
| Ga0207676_109093811 | 3300026095 | Switchgrass Rhizosphere | VSTGGRMELLLFIGLLSLVVSGGLLVAVMSNDPYAQDNTYSLADHELADLVNPP |
| Ga0207675_1002103153 | 3300026118 | Switchgrass Rhizosphere | MELLLFIGLLSLLVSGGLFWAAMSNDAYAGDSWSSLADHELADLA |
| Ga0207698_101764793 | 3300026142 | Corn Rhizosphere | MDFLLLMLSSPLVVSGGFVLAVLLNNPYAQASTYSPADHELADLANPP |
| Ga0207698_113984861 | 3300026142 | Corn Rhizosphere | MDFLLFMLSLPLVVSGGFLLAVLLNDPYAQASTYSLADHELADLANPP |
| Ga0268264_117013022 | 3300028381 | Switchgrass Rhizosphere | MDLFLFIVVSSLVFIVVSSLVVSGGLLLGVVLNNPYAQRNTYSLADHELADLANPP |
| Ga0247828_106973861 | 3300028587 | Soil | MELLLFIGLLSLVVSGGLLLAVVLNDPDSQGNTYSLADH |
| Ga0247828_112169562 | 3300028587 | Soil | RMELLLFIGLLSLLVSGGLFWAAMSNDAYAGDNWSSLADHELADLANPP |
| Ga0307503_100304252 | 3300028802 | Soil | MELLLFIGLLSLVVSGGLLLAVMSNDPYSQNNTYSLADHELADLANPP |
| Ga0247827_108871541 | 3300028889 | Soil | SLVVSGGLFLAVVLNDPDSQGNTYSLADHELADLANPP |
| Ga0307408_1002130941 | 3300031548 | Rhizosphere | MGLFLFILVSSLLVSGGLLLAVVVNDPYAQANTYSLADHELA |
| Ga0307407_100098767 | 3300031903 | Rhizosphere | MGLFLFILVSSLLVSGGLLLAVVVNDPYAQANTYSLADHELADLANPP |
| Ga0308173_115788831 | 3300032074 | Soil | MDFLLFLLSLPLIVSGGFLLAVLLNDPYAQASTYSLADHELADLANPP |
| Ga0247830_108673351 | 3300033551 | Soil | VVSSLVVSGGLLLAVVLNDPYAQDNTYSLADHELADLANPP |
| ⦗Top⦘ |