| Basic Information | |
|---|---|
| Family ID | F048330 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 37 residues |
| Representative Sequence | NRFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.14 % |
| % of genes near scaffold ends (potentially truncated) | 92.57 % |
| % of genes from short scaffolds (< 2000 bps) | 85.81 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.649 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (18.243 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.270 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF03306 | AAL_decarboxy | 14.19 |
| PF10503 | Esterase_PHB | 9.46 |
| PF01381 | HTH_3 | 5.41 |
| PF00578 | AhpC-TSA | 4.73 |
| PF08281 | Sigma70_r4_2 | 2.70 |
| PF04264 | YceI | 2.70 |
| PF12867 | DinB_2 | 2.70 |
| PF09603 | Fib_succ_major | 2.03 |
| PF10067 | DUF2306 | 1.35 |
| PF13360 | PQQ_2 | 0.68 |
| PF09685 | DUF4870 | 0.68 |
| PF13585 | CHU_C | 0.68 |
| PF12848 | ABC_tran_Xtn | 0.68 |
| PF13517 | FG-GAP_3 | 0.68 |
| PF01926 | MMR_HSR1 | 0.68 |
| PF01638 | HxlR | 0.68 |
| PF00593 | TonB_dep_Rec | 0.68 |
| PF02321 | OEP | 0.68 |
| PF02897 | Peptidase_S9_N | 0.68 |
| PF06241 | Castor_Poll_mid | 0.68 |
| PF03382 | DUF285 | 0.68 |
| PF14255 | Cys_rich_CPXG | 0.68 |
| PF00486 | Trans_reg_C | 0.68 |
| PF00027 | cNMP_binding | 0.68 |
| PF02492 | cobW | 0.68 |
| PF14509 | GH97_C | 0.68 |
| PF00332 | Glyco_hydro_17 | 0.68 |
| PF12695 | Abhydrolase_5 | 0.68 |
| PF13412 | HTH_24 | 0.68 |
| PF09912 | DUF2141 | 0.68 |
| PF13432 | TPR_16 | 0.68 |
| PF11196 | DUF2834 | 0.68 |
| PF04851 | ResIII | 0.68 |
| PF01557 | FAA_hydrolase | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 14.19 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 2.70 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.35 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.68 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.68 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.68 |
| COG5309 | Exo-beta-1,3-glucanase, GH17 family | Carbohydrate transport and metabolism [G] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.32 % |
| Unclassified | root | N/A | 25.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10022978 | All Organisms → cellular organisms → Bacteria | 3588 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10147464 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | 870 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10268498 | Not Available | 526 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10205003 | Not Available | 547 | Open in IMG/M |
| 3300000207|SI48aug10_10mDRAFT_c1004050 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | 1530 | Open in IMG/M |
| 3300000224|SI34jun09_10mDRAFT_1040647 | All Organisms → cellular organisms → Bacteria → FCB group | 649 | Open in IMG/M |
| 3300000225|SI34jun09_120mDRAFT_1043945 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | 913 | Open in IMG/M |
| 3300000254|SI34jun09_100mDRAFT_1021572 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300000928|OpTDRAFT_10059545 | Not Available | 671 | Open in IMG/M |
| 3300000928|OpTDRAFT_10180445 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 650 | Open in IMG/M |
| 3300001351|JGI20153J14318_10003594 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 10309 | Open in IMG/M |
| 3300001351|JGI20153J14318_10173341 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300001352|JGI20157J14317_10042821 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2181 | Open in IMG/M |
| 3300002154|JGI24538J26636_10157790 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 542 | Open in IMG/M |
| 3300002186|JGI24539J26755_10032902 | Not Available | 1705 | Open in IMG/M |
| 3300005747|Ga0076924_1147756 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2303 | Open in IMG/M |
| 3300005837|Ga0078893_10266718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster | 829 | Open in IMG/M |
| 3300005837|Ga0078893_10406891 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005837|Ga0078893_11170998 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005941|Ga0070743_10076521 | Not Available | 1130 | Open in IMG/M |
| 3300005941|Ga0070743_10110986 | All Organisms → cellular organisms → Bacteria → FCB group | 919 | Open in IMG/M |
| 3300006402|Ga0075511_1011163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Hyellaceae → Myxosarcina → unclassified Myxosarcina → Myxosarcina sp. GI1 | 636 | Open in IMG/M |
| 3300006402|Ga0075511_1766518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 930 | Open in IMG/M |
| 3300006616|Ga0101440_111092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3737 | Open in IMG/M |
| 3300006643|Ga0101445_108840 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3940 | Open in IMG/M |
| 3300007229|Ga0075468_10210754 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300007552|Ga0102818_1013117 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1642 | Open in IMG/M |
| 3300007552|Ga0102818_1019298 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → Maribacter antarcticus | 1346 | Open in IMG/M |
| 3300007553|Ga0102819_1045401 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300007620|Ga0102871_1055074 | All Organisms → cellular organisms → Bacteria → FCB group | 1167 | Open in IMG/M |
| 3300007715|Ga0102827_1128900 | Not Available | 578 | Open in IMG/M |
| 3300007955|Ga0105740_1084452 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300007962|Ga0102907_1026558 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → unclassified Cyclobacteriaceae → Cyclobacteriaceae bacterium | 1635 | Open in IMG/M |
| 3300007962|Ga0102907_1046125 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1187 | Open in IMG/M |
| 3300008921|Ga0103486_1006226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 812 | Open in IMG/M |
| 3300008961|Ga0102887_1052498 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1340 | Open in IMG/M |
| 3300008961|Ga0102887_1116284 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300008999|Ga0102816_1020583 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300009050|Ga0102909_1067430 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 882 | Open in IMG/M |
| 3300009080|Ga0102815_10238907 | Not Available | 1001 | Open in IMG/M |
| 3300009172|Ga0114995_10021495 | Not Available | 3854 | Open in IMG/M |
| 3300009172|Ga0114995_10258933 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 960 | Open in IMG/M |
| 3300009420|Ga0114994_10391138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 921 | Open in IMG/M |
| 3300009423|Ga0115548_1008687 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 4548 | Open in IMG/M |
| 3300009423|Ga0115548_1178158 | All Organisms → cellular organisms → Bacteria → FCB group | 663 | Open in IMG/M |
| 3300009425|Ga0114997_10151126 | All Organisms → cellular organisms → Bacteria → FCB group | 1372 | Open in IMG/M |
| 3300009426|Ga0115547_1283011 | Not Available | 517 | Open in IMG/M |
| 3300009434|Ga0115562_1008023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 6298 | Open in IMG/M |
| 3300009435|Ga0115546_1169039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 765 | Open in IMG/M |
| 3300009438|Ga0115559_1038122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → unclassified Polaribacter → Polaribacter sp. Hel1_33_78 | 2163 | Open in IMG/M |
| 3300009438|Ga0115559_1081836 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1296 | Open in IMG/M |
| 3300009447|Ga0115560_1143704 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300009495|Ga0115571_1061144 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → unclassified Polaribacter → Polaribacter sp. | 1713 | Open in IMG/M |
| 3300009497|Ga0115569_10181468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 984 | Open in IMG/M |
| 3300009505|Ga0115564_10447595 | All Organisms → cellular organisms → Bacteria → FCB group | 627 | Open in IMG/M |
| 3300009507|Ga0115572_10080035 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300009512|Ga0115003_10221086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1134 | Open in IMG/M |
| 3300009592|Ga0115101_1428133 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2318 | Open in IMG/M |
| 3300012516|Ga0129325_1044443 | All Organisms → cellular organisms → Bacteria → FCB group | 548 | Open in IMG/M |
| 3300012524|Ga0129331_1124031 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300012936|Ga0163109_10313216 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1149 | Open in IMG/M |
| 3300016726|Ga0182045_1270909 | Not Available | 850 | Open in IMG/M |
| 3300016748|Ga0182043_1194675 | Not Available | 837 | Open in IMG/M |
| 3300016791|Ga0182095_1103886 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 753 | Open in IMG/M |
| 3300018418|Ga0181567_10875408 | Not Available | 566 | Open in IMG/M |
| 3300020166|Ga0206128_1123402 | Not Available | 1082 | Open in IMG/M |
| 3300020166|Ga0206128_1231486 | Not Available | 690 | Open in IMG/M |
| 3300020185|Ga0206131_10034321 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 3732 | Open in IMG/M |
| 3300020187|Ga0206130_10043304 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 3324 | Open in IMG/M |
| 3300020187|Ga0206130_10451582 | Not Available | 501 | Open in IMG/M |
| 3300020253|Ga0211685_1063978 | Not Available | 520 | Open in IMG/M |
| 3300020431|Ga0211554_10234073 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300021084|Ga0206678_10400697 | All Organisms → cellular organisms → Bacteria → FCB group | 645 | Open in IMG/M |
| 3300021957|Ga0222717_10234076 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1074 | Open in IMG/M |
| 3300021957|Ga0222717_10245995 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1041 | Open in IMG/M |
| 3300021960|Ga0222715_10560698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 596 | Open in IMG/M |
| 3300023566|Ga0228679_1004052 | All Organisms → cellular organisms → Bacteria → FCB group | 1361 | Open in IMG/M |
| 3300023567|Ga0228694_123601 | Not Available | 640 | Open in IMG/M |
| 3300023679|Ga0232113_1009904 | All Organisms → cellular organisms → Bacteria → FCB group | 973 | Open in IMG/M |
| 3300023685|Ga0228686_1008191 | All Organisms → cellular organisms → Bacteria → FCB group | 1336 | Open in IMG/M |
| 3300023698|Ga0228682_1004138 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300024223|Ga0228601_1004152 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300024228|Ga0228633_1038218 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1252 | Open in IMG/M |
| 3300024235|Ga0228665_1041726 | Not Available | 946 | Open in IMG/M |
| 3300024247|Ga0228675_1017610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1758 | Open in IMG/M |
| 3300024250|Ga0228677_1013580 | All Organisms → cellular organisms → Bacteria → FCB group | 1433 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1154368 | Not Available | 1039 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10266302 | Not Available | 754 | Open in IMG/M |
| 3300024293|Ga0228651_1059790 | Not Available | 904 | Open in IMG/M |
| (restricted) 3300024302|Ga0233449_1130825 | Not Available | 840 | Open in IMG/M |
| 3300024315|Ga0228618_1094837 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300024322|Ga0228656_1043679 | Not Available | 1007 | Open in IMG/M |
| (restricted) 3300024327|Ga0233434_1009812 | All Organisms → cellular organisms → Bacteria | 6149 | Open in IMG/M |
| 3300024334|Ga0228671_1048532 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300024334|Ga0228671_1068391 | Not Available | 899 | Open in IMG/M |
| 3300024428|Ga0233396_1106064 | Not Available | 668 | Open in IMG/M |
| 3300025626|Ga0209716_1094251 | Not Available | 864 | Open in IMG/M |
| 3300025658|Ga0209659_1040869 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1767 | Open in IMG/M |
| 3300025658|Ga0209659_1136122 | Not Available | 754 | Open in IMG/M |
| 3300025680|Ga0209306_1025223 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2076 | Open in IMG/M |
| 3300025688|Ga0209140_1114639 | All Organisms → cellular organisms → Bacteria → FCB group | 819 | Open in IMG/M |
| 3300025694|Ga0209406_1081392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1131 | Open in IMG/M |
| 3300025701|Ga0209771_1015231 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Formosa → unclassified Formosa → Formosa sp. Hel1_33_131 | 3391 | Open in IMG/M |
| 3300025719|Ga0209252_1104010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 964 | Open in IMG/M |
| 3300025719|Ga0209252_1142912 | Not Available | 777 | Open in IMG/M |
| 3300025719|Ga0209252_1146105 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 765 | Open in IMG/M |
| 3300025806|Ga0208545_1124466 | Not Available | 644 | Open in IMG/M |
| 3300025809|Ga0209199_1083431 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300025809|Ga0209199_1105983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1145 | Open in IMG/M |
| 3300025809|Ga0209199_1293033 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter | 509 | Open in IMG/M |
| 3300025849|Ga0209603_1190088 | All Organisms → cellular organisms → Bacteria → FCB group | 795 | Open in IMG/M |
| 3300025869|Ga0209308_10251118 | Not Available | 759 | Open in IMG/M |
| 3300025874|Ga0209533_1170306 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 953 | Open in IMG/M |
| 3300025876|Ga0209223_10059287 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2281 | Open in IMG/M |
| 3300025880|Ga0209534_10152186 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1221 | Open in IMG/M |
| 3300026183|Ga0209932_1018323 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1849 | Open in IMG/M |
| 3300026426|Ga0247570_1021803 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300026460|Ga0247604_1058959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 916 | Open in IMG/M |
| 3300026460|Ga0247604_1091145 | Not Available | 699 | Open in IMG/M |
| 3300026500|Ga0247592_1026905 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300027188|Ga0208921_1036214 | All Organisms → cellular organisms → Bacteria → FCB group | 735 | Open in IMG/M |
| 3300027190|Ga0208674_1024032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 947 | Open in IMG/M |
| 3300027194|Ga0208799_1024470 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 851 | Open in IMG/M |
| 3300027196|Ga0208438_1047270 | All Organisms → cellular organisms → Bacteria → FCB group | 713 | Open in IMG/M |
| 3300027226|Ga0208309_1012426 | Not Available | 1069 | Open in IMG/M |
| 3300027228|Ga0208308_1033212 | All Organisms → cellular organisms → Bacteria → FCB group | 700 | Open in IMG/M |
| 3300027231|Ga0208172_1017140 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Nonlabens → Nonlabens spongiae | 1428 | Open in IMG/M |
| 3300027232|Ga0208803_1035632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 974 | Open in IMG/M |
| 3300027233|Ga0208678_1047131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 924 | Open in IMG/M |
| 3300027251|Ga0208809_1013486 | Not Available | 1572 | Open in IMG/M |
| 3300027253|Ga0208680_1016105 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1552 | Open in IMG/M |
| 3300027315|Ga0208949_1074395 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 596 | Open in IMG/M |
| 3300027553|Ga0208947_1063585 | Not Available | 874 | Open in IMG/M |
| 3300027553|Ga0208947_1127978 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 559 | Open in IMG/M |
| 3300027582|Ga0208971_1080550 | All Organisms → cellular organisms → Bacteria → FCB group | 799 | Open in IMG/M |
| 3300027752|Ga0209192_10011382 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 4814 | Open in IMG/M |
| 3300028131|Ga0228642_1045860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → Maribacter antarcticus | 1197 | Open in IMG/M |
| 3300028134|Ga0256411_1048718 | All Organisms → cellular organisms → Bacteria → FCB group | 1439 | Open in IMG/M |
| 3300028194|Ga0257106_1066180 | All Organisms → cellular organisms → Bacteria → FCB group | 1337 | Open in IMG/M |
| 3300028284|Ga0257120_1047440 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300028391|Ga0233394_1021003 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1773 | Open in IMG/M |
| 3300028397|Ga0228639_1098460 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300028416|Ga0228614_1049946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 897 | Open in IMG/M |
| 3300028418|Ga0228615_1184143 | Not Available | 520 | Open in IMG/M |
| 3300032088|Ga0315321_10478585 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 758 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 18.24% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.54% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 13.51% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 10.14% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.05% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 4.05% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.05% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.38% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.70% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.70% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.03% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.03% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.03% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.35% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.35% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.68% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.68% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.68% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.68% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.68% |
| Bay Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000207 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 10m | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000225 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120m | Environmental | Open in IMG/M |
| 3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300002154 | Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Metagenome | Environmental | Open in IMG/M |
| 3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006616 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ06 time point | Environmental | Open in IMG/M |
| 3300006622 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point | Environmental | Open in IMG/M |
| 3300006643 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ11 time point | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
| 3300007955 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0um | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300008921 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB1 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016748 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300023566 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023679 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023698 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024223 | Seawater microbial communities from Monterey Bay, California, United States - 1D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024291 | Seawater microbial communities from Monterey Bay, California, United States - 74D | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024302 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MG | Environmental | Open in IMG/M |
| 3300024315 | Seawater microbial communities from Monterey Bay, California, United States - 20D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024327 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MG | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025688 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025719 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026426 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027190 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes) | Environmental | Open in IMG/M |
| 3300027194 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 (SPAdes) | Environmental | Open in IMG/M |
| 3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
| 3300027226 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027228 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027232 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027233 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027251 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027253 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027315 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028284 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10 | Environmental | Open in IMG/M |
| 3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
| 3300028397 | Seawater microbial communities from Monterey Bay, California, United States - 50D | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100229782 | 3300000101 | Marine | MTLVVDNSFEISNISLTPKVLIDTHYIMTLIMKE* |
| DelMOSum2010_101474643 | 3300000101 | Marine | KKYNRFIVLVAFSIEISNVNFTPKDLIDSHHIITIIMKS* |
| DelMOSum2010_102684982 | 3300000101 | Marine | KKYNRFIVLVAFSIEISNVNFTPKDLIDSHHIITLIMKS* |
| DelMOSum2011_102050032 | 3300000115 | Marine | LKGLVVDNSIEISNISLTPRELIDTHHIMTLIMKGSGV* |
| SI48aug10_10mDRAFT_10040503 | 3300000207 | Marine | VLVDNSIEISNISITARDLIDTYHLMTLILQYSDS* |
| SI34jun09_10mDRAFT_10406473 | 3300000224 | Marine | VLVDNSFEISNISFIPRDLIDTHHIMTLITKSST* |
| SI34jun09_120mDRAFT_10439453 | 3300000225 | Marine | NSISFIVLVDNSIEISNISFIPRDLIDTHHIMTLIMKSST* |
| SI34jun09_100mDRAFT_10215723 | 3300000254 | Marine | FIVLVDNSIEISNISITARDLIDTYHLMTLILQYSDS* |
| OpTDRAFT_100595451 | 3300000928 | Freshwater And Marine | RFIVLVDNSIEISNISITARDLIDTYHLMTLILQYSDS* |
| OpTDRAFT_101804451 | 3300000928 | Freshwater And Marine | YNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS* |
| JGI20153J14318_100035941 | 3300001351 | Pelagic Marine | YNRFIVLVDNSFEISNISLTPRDLIETHNLMTLIMKE* |
| JGI20153J14318_101733411 | 3300001351 | Pelagic Marine | FLVDNSIEISNLSFTPRELIDTHHIMTLIVKSST* |
| JGI20157J14317_100428212 | 3300001352 | Pelagic Marine | MKYNRFIVLVDNSIEISNISFTPKDLIDTHHIMSLIMKGSGI* |
| JGI24538J26636_101577902 | 3300002154 | Marine | RFIVLVEFSIEISNISFTPKYLIDTHHIMTLIMKS* |
| JGI24539J26755_100329021 | 3300002186 | Marine | MKTLVVDNSIEVSNISLTPKNLIDTHHIMTLIMKSST* |
| Ga0076924_11477561 | 3300005747 | Marine | YKSISFIVLVDNSFEISNIGFTPKDLIDTHHIMTLIMKS* |
| Ga0078893_102667181 | 3300005837 | Marine Surface Water | PSCVVDNSIEISNLSFTPRELIDTHHIMTLIMKSST* |
| Ga0078893_104068912 | 3300005837 | Marine Surface Water | PSCVVDNSFEISNISFTPKDLIDTHHIMSLVMKGST* |
| Ga0078893_111709981 | 3300005837 | Marine Surface Water | VVDNSLEISNISLNPRDLIDTHNIMTLILKYSDS* |
| Ga0070743_100765212 | 3300005941 | Estuarine | YNRFIVLVDNSIEISNISITARDLIDTYHLMTLILQYSDS* |
| Ga0070743_101109862 | 3300005941 | Estuarine | KYNRFIVLVDNLLEISNKLLTARDFLDTHDLITIILKEQP* |
| Ga0075511_10111631 | 3300006402 | Aqueous | PSSFVDNSIEISNISFTPKDLFDTHHIMSLIMNE* |
| Ga0075511_17665182 | 3300006402 | Aqueous | FIVLVDNSLEISNISLTPRDIIDTHHIMTLIMMC* |
| Ga0101440_1110921 | 3300006616 | Marine Surface Water | TSPSCVVDNSIEISNLSFTPRELIDTHHIMTLIMKSST* |
| Ga0101442_1030171 | 3300006622 | Marine Surface Water | FTSPSCEVDNFIEISNISLTTKNIIYTHYIITFIMKS* |
| Ga0101445_1088402 | 3300006643 | Marine Surface Water | KLLDFSRCFFVDNSFEISNIRLTPKDLIDTHHTMILILKE* |
| Ga0075468_102107541 | 3300007229 | Aqueous | MITLVVDNSIEISNISITARDLIDTYHLMTLILQYSDS* |
| Ga0102818_10131171 | 3300007552 | Estuarine | YNRFIVLVDNSIEISNISITARDLIDTHNLMTLILKYSDS* |
| Ga0102818_10192983 | 3300007552 | Estuarine | MKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIMN |
| Ga0102819_10454013 | 3300007553 | Estuarine | FIVLVDNSIEISNISLTPKDLIDTHHIMTLIMNE* |
| Ga0102871_10550742 | 3300007620 | Estuarine | VLVDNSLEISNISFTPKDLIDAHHIMTLILKGST* |
| Ga0102827_11289002 | 3300007715 | Estuarine | LVDNYIEISNISITARDLIDTHHLMTLILKYLDS* |
| Ga0105740_10844521 | 3300007955 | Estuary Water | PFLVACVVDNSLEISNISFTPKDLIDAHHIMTLILKGST* |
| Ga0102907_10265581 | 3300007962 | Estuarine | NRFIVLVDNSIEISNISFTPRDLIDTHNLMILIMKS* |
| Ga0102907_10461251 | 3300007962 | Estuarine | NRFIVLVDNSIEISNISLTPKDIIDTHHMTLIMKS* |
| Ga0103486_10062263 | 3300008921 | Bay Water | YNRFIVLVDNSIEISNINLTPRDLIDTHHIITLIMKSKKIR* |
| Ga0102887_10524981 | 3300008961 | Estuarine | GYTFMKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS* |
| Ga0102887_11162843 | 3300008961 | Estuarine | MKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLI |
| Ga0102816_10205835 | 3300008999 | Estuarine | NRFIVLVDNSVEISNISLTPRDLIDTHHIMTLIMKS* |
| Ga0102909_10674301 | 3300009050 | Estuarine | NRFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS* |
| Ga0102815_102389071 | 3300009080 | Estuarine | RFIVLVDNSIEISNISFTPRELIDTHHIMTLIMKN* |
| Ga0114995_100214955 | 3300009172 | Marine | LVVDNSFEISNISLTPRELIDTHNLMTLVMKGLGV* |
| Ga0114995_102589331 | 3300009172 | Marine | RFIVLVDNSIEISNISFTPKDLIDTHHIMTLIMKS* |
| Ga0114994_103911382 | 3300009420 | Marine | YNRFIVLVDNSIEISNIRLTPRDLIDTHHIMTLIMNE* |
| Ga0115548_10086876 | 3300009423 | Pelagic Marine | SDYSLVGFSIEISNISLTPKDLIDTHHIMTLIMKS* |
| Ga0115548_11781581 | 3300009423 | Pelagic Marine | NRFIVLVDNSIEISNISFTPKDLIDTHHIMSLIMKS* |
| Ga0114997_101511261 | 3300009425 | Marine | RFIVLVDNSIEISNISLTPKDLIETHHIMTLIMKS* |
| Ga0115547_12830112 | 3300009426 | Pelagic Marine | FIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS* |
| Ga0115562_10080231 | 3300009434 | Pelagic Marine | FIVLVDNSIEISNISLTPKDLIETHHIMILIMKN* |
| Ga0115546_11690392 | 3300009435 | Pelagic Marine | FIVLVDNSIEISNISLTPRDIIDTHHIMTLIMKE* |
| Ga0115559_10381221 | 3300009438 | Pelagic Marine | YNRFIVLVDNSIEISNISLTPKDLIDTHYIMTLIMKS* |
| Ga0115559_10818361 | 3300009438 | Pelagic Marine | MTLIVDNSMEISNISPTPRDIIDTNHLMTLIMKSKKIR |
| Ga0115560_11437041 | 3300009447 | Pelagic Marine | NRFIVLVDNSIEISNISLTPKDLIDTHYIMTLIMKS* |
| Ga0115571_10611441 | 3300009495 | Pelagic Marine | YNRFIVLVDNSIKISNISLTPKDLIDTHYIMTLIIKS* |
| Ga0115569_101814681 | 3300009497 | Pelagic Marine | VDNSMEISNISPTPRDIIDTNHLMTLIMKSKKIR* |
| Ga0115564_104475951 | 3300009505 | Pelagic Marine | YNRFIVLVDNSVEISNISLTPRDLIDTHHIMTLIMKS* |
| Ga0115572_100800354 | 3300009507 | Pelagic Marine | YNRFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS* |
| Ga0115003_102210861 | 3300009512 | Marine | YNRFIVLVDNSIEISNISLTPRDLIDTHHIITLIMKS* |
| Ga0115101_14281333 | 3300009592 | Marine | KNGYTFMKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIMKS* |
| Ga0129325_10444432 | 3300012516 | Aqueous | RFIVTVDNSIEISNISFIPRDLIDTHHIMTLIMKSST* |
| Ga0129331_11240314 | 3300012524 | Aqueous | RFIVLVDNSIEISNISFTPKDLIDTHHIMTLIMNE* |
| Ga0163109_103132163 | 3300012936 | Surface Seawater | NRFIVLVDNSLEISNISLTPRDIIDTHHIMTLIMMC* |
| Ga0182045_12709092 | 3300016726 | Salt Marsh | NRFIVLVDNSLEISNISLTPRDFLNTYSLITLVSQKIK |
| Ga0182043_11946752 | 3300016748 | Salt Marsh | FIVLVDNSLEISNISLTPRDFLNTYSLITLVSQKIK |
| Ga0182095_11038861 | 3300016791 | Salt Marsh | YNRFIVLVDNSFEISNISLTPRDIIDTHRIMTLIMMC |
| Ga0181567_108754082 | 3300018418 | Salt Marsh | FFVDNSFEISNLSFTPRELIDTHHIMTLVMKGSGV |
| Ga0206128_11234021 | 3300020166 | Seawater | IVLVDNSIEISNISITARDLIDTYHLMTLILQYSDS |
| Ga0206128_12314862 | 3300020166 | Seawater | LSFLKGLLVDNSIEISNLSFTPRELIDTHHIMTLIMKGSGV |
| Ga0206131_100343215 | 3300020185 | Seawater | MTLVVDNSIEISNISLTPRELIYTHHIMTLIMKGSGV |
| Ga0206130_100433041 | 3300020187 | Seawater | KYNRFIVLVDNSIEISNISFTPRDLIDTHHIMSLVMKS |
| Ga0206130_104515822 | 3300020187 | Seawater | NRFIVLVDNSLEISNISITPRDLIDTHHIMTLIMKE |
| Ga0211685_10639782 | 3300020253 | Marine | YNRFIVLVDNSFEISNISLTPRDLINTHQLMTLIMKS |
| Ga0211554_102340732 | 3300020431 | Marine | IKVNRFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKN |
| Ga0206678_104006971 | 3300021084 | Seawater | SRSFFVDNSVEISNISLTPRDLIDTHHIMTLIMKS |
| Ga0222717_102340763 | 3300021957 | Estuarine Water | IINGLNFVDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| Ga0222717_102459952 | 3300021957 | Estuarine Water | FIVLVDNSIEISNIRITPRDLIDTHHIMTLILKEKL |
| Ga0222715_105606982 | 3300021960 | Estuarine Water | ENFKGLLVDKSMEISNISITPRDLIDTHHIMTLIMN |
| Ga0228679_10040522 | 3300023566 | Seawater | FIVLVDNSFEISNISFTPKDLIDAHHIMTLILKGST |
| Ga0228694_1236011 | 3300023567 | Seawater | RFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS |
| Ga0232113_10099042 | 3300023679 | Seawater | FIVLVDNSLEISNISFTPKDLIDAHHIMTLILKGST |
| Ga0228686_10081912 | 3300023685 | Seawater | YNRFIVLVDNSLEISNISFTPKDLIDAHHIMTLILKGST |
| Ga0228682_10041381 | 3300023698 | Seawater | RFIVLVDNSLEISNISFTPKDLIDAHHIMTLILKGST |
| Ga0228601_10041521 | 3300024223 | Seawater | RFIVLVDNSFEISNISLTPKDLIDTHHIMSLIMKE |
| Ga0228633_10382181 | 3300024228 | Seawater | KYNRFIVLVDNSVEISNISLTPRDLIDTHHIMTLIMKS |
| Ga0228665_10417261 | 3300024235 | Seawater | YNRFIVLVENSIEISNISITARDLIDTHHLMTLILKYSDS |
| Ga0228675_10176101 | 3300024247 | Seawater | NRFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| Ga0228677_10135801 | 3300024250 | Seawater | LVIKIVLVDNSLEISNISFTPKDLIDAHHIMTLILKGST |
| (restricted) Ga0233437_11543681 | 3300024259 | Seawater | NPGPYCLVDNSFEISNISITARDLIDTYHLMTLILQYSDS |
| (restricted) Ga0233444_102663021 | 3300024264 | Seawater | RSFLVDNSIEISNISLTPRELIDTHHIMTLIMKGSGV |
| Ga0228660_10390342 | 3300024291 | Seawater | SSNTDPSCVVDNSIEISNISLTPRDIIDTHHIMTLIMMC |
| Ga0228651_10597901 | 3300024293 | Seawater | NRFIVLVDNSLEISNISITPRDFLNTYSLITLVSQKIK |
| (restricted) Ga0233449_11308252 | 3300024302 | Seawater | GPYCLVDNSFEISNISITARDLIDTYHLMTLILQYSDS |
| Ga0228618_10948371 | 3300024315 | Seawater | RFIVLVDNPIEISNISFTPKDLFDTHHIMSLIINE |
| Ga0228656_10436794 | 3300024322 | Seawater | TKYKKKIVLDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| (restricted) Ga0233434_10098129 | 3300024327 | Seawater | DYSLVDNSFEISNIRFTPKDLIDTHHIMTLIMKSST |
| Ga0228671_10485322 | 3300024334 | Seawater | NTGTSCVVDNSIEISNISFNLRDLIDTHNLMTLIMKS |
| Ga0228671_10683911 | 3300024334 | Seawater | YNRFIVLVDNYFEISNISITPRDFLNTYSLITLVSQKIK |
| Ga0233396_11060641 | 3300024428 | Seawater | GYTFMKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS |
| Ga0209716_10942512 | 3300025626 | Pelagic Marine | RFIVLVDNSIEISNISITARDLIDTYHLMTLILQYSDS |
| Ga0209659_10408691 | 3300025658 | Marine | YNRFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| Ga0209659_11361221 | 3300025658 | Marine | RLFFVDNSIEISNISLTPRELIDTHHIMTLIMKGSGV |
| Ga0209306_10252231 | 3300025680 | Pelagic Marine | YNRFIVLVDNSLEISNISITPKDLIDTHNLMTLVMKGSGV |
| Ga0209140_11146392 | 3300025688 | Marine | FIVLVDNSIEISNLSFTPRELIDTHHIMTLIVKSST |
| Ga0209406_10813921 | 3300025694 | Pelagic Marine | ISDCFFLVDNSMEISNISPTPRDIIDTNHLMTLIMKSKKIR |
| Ga0209771_10152316 | 3300025701 | Marine | KKGLQMKTLVVDNSIEISNISLTPRDLIDTHHIMTLIMNE |
| Ga0209252_11040101 | 3300025719 | Marine | FIVLVDNSVEISNISLTPKNLIDTHHIMTLIMKSST |
| Ga0209252_11429122 | 3300025719 | Marine | FIVIVEFSIEISNISFTPKDLIDTHHIMTLIMKGSGV |
| Ga0209252_11461051 | 3300025719 | Marine | RFIVIVEFSIEISNISFTPKDLIDTHHIMTLIMMC |
| Ga0208545_11244662 | 3300025806 | Aqueous | MITLVVDNSIEISNISITARDLIDTYHLMTLILQYSDS |
| Ga0209199_10834311 | 3300025809 | Pelagic Marine | YNRFIVLVDNSIEISNISFTPRDLIDTHHIMSLVMKS |
| Ga0209199_11059831 | 3300025809 | Pelagic Marine | NRFTVLVDNSMEISNISPTPRDIIDTNHLMTLIMKSKKIR |
| Ga0209199_12930332 | 3300025809 | Pelagic Marine | REWFIVPLEAVDNSIEISNISLTPKDLIDTHHIMTLIMKE |
| Ga0209603_11900881 | 3300025849 | Pelagic Marine | YNRFIVLVDNSVEISNISLTPRDLIDTHHIMTLIMKS |
| Ga0209308_102511181 | 3300025869 | Pelagic Marine | KYNRFNVIVDNSFKISNISFTPKDLIDTHHIMSLIMKS |
| Ga0209533_11703061 | 3300025874 | Pelagic Marine | RFIVLVDNSIEISNISLTPKDIIDTHHIMTLIMKS |
| Ga0209223_100592873 | 3300025876 | Pelagic Marine | YNRFIVLVDNSIEISNISLTPRDIIDTHHIMTLIMKE |
| Ga0209534_101521861 | 3300025880 | Pelagic Marine | MTLVVDNSIEISNLSFTPRELIDTHHIMTLIMKGS |
| Ga0209932_10183231 | 3300026183 | Pond Water | NRFIVIVDNSLEISNISITPKDLIDTHNLMTLVMKGSGV |
| Ga0247570_10218031 | 3300026426 | Seawater | NRFIVLVDNSFEISNISLTPKDLIDTHHIMSLIMKE |
| Ga0247604_10589591 | 3300026460 | Seawater | RFIVLVDNSLEISNISITPKDLIDTHHIMTLIMKS |
| Ga0247604_10911451 | 3300026460 | Seawater | RFIVLVDNSMEISNISLTPRDLIDTHHIMTLILNE |
| Ga0247592_10269053 | 3300026500 | Seawater | FKKYNRFIVLVDNSFEISNISLTLRDLIDTHHIMTLIMKE |
| Ga0208921_10362141 | 3300027188 | Estuarine | IVLVDNSLEISNISFTPKDLIDAHHIMTLILKGST |
| Ga0208674_10240321 | 3300027190 | Estuarine | IVLVDNSFEISNIRFTPKDLIDTHHIMTLIMKSST |
| Ga0208799_10244703 | 3300027194 | Estuarine | NRFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS |
| Ga0208438_10472701 | 3300027196 | Estuarine | NRFIVLVDNSVEISNISLTPRDLIDTHHIMTLIMKS |
| Ga0208309_10124261 | 3300027226 | Estuarine | NRFIVLVDNSIEISNISFTPKDLIDTHHIMSLIMKGSGI |
| Ga0208308_10332122 | 3300027228 | Estuarine | ISDDLLVDNSIEISNISFTPRELIDTHHIMTLIVKSST |
| Ga0208172_10171401 | 3300027231 | Estuarine | KYNRFIVLVDNSFEISNISLTPRDLIDTHHIMTLIMNKLIIFIFLKMN |
| Ga0208803_10356323 | 3300027232 | Estuarine | NHFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| Ga0208678_10471311 | 3300027233 | Estuarine | FMKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIIKS |
| Ga0208809_10134861 | 3300027251 | Estuarine | MKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIMNKLIIFIFLKMN |
| Ga0208680_10161051 | 3300027253 | Estuarine | RFIVLVDNSFEISNISITARDLIDTYHLMTLILQYSDS |
| Ga0208949_10743951 | 3300027315 | Marine | KYNRFIVLVDNSIEISNISLTPKDLIDTHHIMTLIMKS |
| Ga0208947_10635852 | 3300027553 | Marine | KYNRFIAVVDKSIEISNICLTPRDFIDTHYIMTLIMKG |
| Ga0208947_11279782 | 3300027553 | Marine | YNRFIVLVDNSLEISNISITPRDIIDTHHIMTLIMKS |
| Ga0208897_10939641 | 3300027571 | Estuarine | SLDIEKKLRLKGLLVDNSIEISNISFTPRELIDTHHIMTLIVKSST |
| Ga0208971_10805502 | 3300027582 | Marine | KYNRFIVLVDNLLEISNKLLTARDFLDTHDLITIILKEQP |
| Ga0209192_100113823 | 3300027752 | Marine | MKTLVVDNSIEISNISLTPKNLIDTHHIMTLIMKSST |
| Ga0228642_10458601 | 3300028131 | Seawater | MKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIMNKLII |
| Ga0256411_10487181 | 3300028134 | Seawater | KLLDFSRSFFVDNSLEISNISFTPKDLIDAHHIMTLILKGST |
| Ga0257106_10661802 | 3300028194 | Marine | NRFIVLVDNSIEISNLSFTPRELIDTHHIMTLIVKSST |
| Ga0257120_10474404 | 3300028284 | Marine | YNRFIVLVDNSFEISNISITPKDLIDTHHIMTLIMKS |
| Ga0233394_10210031 | 3300028391 | Seawater | MKYNRFIVLVDNSLEISNISSTPRDLINTHHIMTLIMNK |
| Ga0228639_10984602 | 3300028397 | Seawater | NRFIVLVDNSLEISNISLTPKDLFDTHHIMTLIMKSST |
| Ga0228614_10499462 | 3300028416 | Seawater | KYNRFIVLVDNSFEISNIGFTPRDLIHTHNLMTRIMKS |
| Ga0228615_11841431 | 3300028418 | Seawater | YNRFIVLVDNSLEISNISLTPKDLIDTHHIMTLIMKS |
| Ga0315321_104785851 | 3300032088 | Seawater | KYNRFIVLVDNSFEISNISLTPRDLIDTHHIMTLIMNE |
| ⦗Top⦘ |