| Basic Information | |
|---|---|
| Family ID | F048297 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSHPSEYHEHDPEPGSGLTGFAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.15 % |
| % of genes near scaffold ends (potentially truncated) | 36.49 % |
| % of genes from short scaffolds (< 2000 bps) | 72.97 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.378 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.189 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.622 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.108 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 29.05 |
| PF05532 | CsbD | 8.11 |
| PF00571 | CBS | 3.38 |
| PF13581 | HATPase_c_2 | 2.70 |
| PF01740 | STAS | 2.03 |
| PF01028 | Topoisom_I | 2.03 |
| PF01814 | Hemerythrin | 1.35 |
| PF13466 | STAS_2 | 1.35 |
| PF07228 | SpoIIE | 1.35 |
| PF00584 | SecE | 0.68 |
| PF08447 | PAS_3 | 0.68 |
| PF07730 | HisKA_3 | 0.68 |
| PF02518 | HATPase_c | 0.68 |
| PF02896 | PEP-utilizers_C | 0.68 |
| PF00480 | ROK | 0.68 |
| PF01904 | DUF72 | 0.68 |
| PF00144 | Beta-lactamase | 0.68 |
| PF06724 | DUF1206 | 0.68 |
| PF03640 | Lipoprotein_15 | 0.68 |
| PF13385 | Laminin_G_3 | 0.68 |
| PF01741 | MscL | 0.68 |
| PF01418 | HTH_6 | 0.68 |
| PF00582 | Usp | 0.68 |
| PF00912 | Transgly | 0.68 |
| PF10706 | Aminoglyc_resit | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 8.11 |
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 2.03 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.35 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.68 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.68 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.68 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.68 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.68 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.68 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 0.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.68 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.68 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 0.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.68 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.73 % |
| Unclassified | root | N/A | 20.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725002|GPICC_F5MS3JC01EOIM9 | Not Available | 502 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig1200250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1004 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig148876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 2199352025|deepsgr__Contig_162131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11387374 | Not Available | 904 | Open in IMG/M |
| 3300000858|JGI10213J12805_10023956 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300000858|JGI10213J12805_10181998 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300000953|JGI11615J12901_11639651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 753 | Open in IMG/M |
| 3300000956|JGI10216J12902_100130080 | Not Available | 731 | Open in IMG/M |
| 3300000956|JGI10216J12902_100434800 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300000956|JGI10216J12902_103839676 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300003911|JGI25405J52794_10096570 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300004114|Ga0062593_100217634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1541 | Open in IMG/M |
| 3300004114|Ga0062593_101238361 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300004157|Ga0062590_102566997 | Not Available | 541 | Open in IMG/M |
| 3300004643|Ga0062591_101278001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 720 | Open in IMG/M |
| 3300005294|Ga0065705_11123536 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005338|Ga0068868_100958107 | Not Available | 781 | Open in IMG/M |
| 3300005354|Ga0070675_100122560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2210 | Open in IMG/M |
| 3300005406|Ga0070703_10008434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2898 | Open in IMG/M |
| 3300005713|Ga0066905_100825600 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300005713|Ga0066905_100945343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300005713|Ga0066905_102258875 | Not Available | 508 | Open in IMG/M |
| 3300005844|Ga0068862_100184920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1872 | Open in IMG/M |
| 3300005937|Ga0081455_10012505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8467 | Open in IMG/M |
| 3300005937|Ga0081455_10019372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6439 | Open in IMG/M |
| 3300005937|Ga0081455_10032414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4707 | Open in IMG/M |
| 3300005937|Ga0081455_10145587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1833 | Open in IMG/M |
| 3300005937|Ga0081455_10430148 | Not Available | 908 | Open in IMG/M |
| 3300006049|Ga0075417_10029808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2252 | Open in IMG/M |
| 3300006058|Ga0075432_10072351 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006058|Ga0075432_10230713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300006572|Ga0074051_10009272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8692 | Open in IMG/M |
| 3300006581|Ga0074048_10123704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4787 | Open in IMG/M |
| 3300006581|Ga0074048_13319937 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006844|Ga0075428_100068720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3875 | Open in IMG/M |
| 3300006844|Ga0075428_100080281 | Not Available | 3560 | Open in IMG/M |
| 3300006844|Ga0075428_100360855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1559 | Open in IMG/M |
| 3300006844|Ga0075428_100659580 | Not Available | 1115 | Open in IMG/M |
| 3300006844|Ga0075428_101354799 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300006845|Ga0075421_100240936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2221 | Open in IMG/M |
| 3300006847|Ga0075431_100159331 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
| 3300006847|Ga0075431_100746453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 954 | Open in IMG/M |
| 3300006969|Ga0075419_10125585 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300007790|Ga0105679_10842692 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae | 1641 | Open in IMG/M |
| 3300009011|Ga0105251_10013022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4673 | Open in IMG/M |
| 3300009037|Ga0105093_10981420 | Not Available | 500 | Open in IMG/M |
| 3300009053|Ga0105095_10014900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4184 | Open in IMG/M |
| 3300009087|Ga0105107_10172765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1518 | Open in IMG/M |
| 3300009094|Ga0111539_10213959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2245 | Open in IMG/M |
| 3300009094|Ga0111539_12311094 | Not Available | 624 | Open in IMG/M |
| 3300009100|Ga0075418_10999392 | Not Available | 905 | Open in IMG/M |
| 3300009156|Ga0111538_10334147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1918 | Open in IMG/M |
| 3300009157|Ga0105092_10594685 | Not Available | 639 | Open in IMG/M |
| 3300009157|Ga0105092_10882252 | Not Available | 527 | Open in IMG/M |
| 3300009166|Ga0105100_10009554 | All Organisms → cellular organisms → Bacteria | 5620 | Open in IMG/M |
| 3300009166|Ga0105100_10054786 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300009174|Ga0105241_11449612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300009553|Ga0105249_11415202 | Not Available | 767 | Open in IMG/M |
| 3300009789|Ga0126307_10007332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7862 | Open in IMG/M |
| 3300009789|Ga0126307_10593704 | Not Available | 894 | Open in IMG/M |
| 3300009810|Ga0105088_1027264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300009812|Ga0105067_1006137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
| 3300009815|Ga0105070_1041483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300009819|Ga0105087_1123562 | Not Available | 505 | Open in IMG/M |
| 3300009823|Ga0105078_1048997 | Not Available | 558 | Open in IMG/M |
| 3300009836|Ga0105068_1015261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1275 | Open in IMG/M |
| 3300009836|Ga0105068_1018538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1173 | Open in IMG/M |
| 3300009840|Ga0126313_10400388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300010036|Ga0126305_10280882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
| 3300010041|Ga0126312_10187550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1443 | Open in IMG/M |
| 3300010042|Ga0126314_10516789 | Not Available | 867 | Open in IMG/M |
| 3300010147|Ga0126319_1082243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300010362|Ga0126377_11760378 | Not Available | 695 | Open in IMG/M |
| 3300010362|Ga0126377_11967123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300010400|Ga0134122_10823526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
| 3300011412|Ga0137424_1025621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 941 | Open in IMG/M |
| 3300012022|Ga0120191_10040359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300012159|Ga0137344_1033581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300012350|Ga0137372_10773769 | Not Available | 690 | Open in IMG/M |
| 3300012353|Ga0137367_10093459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2219 | Open in IMG/M |
| 3300012353|Ga0137367_10176993 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300012532|Ga0137373_10236190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1483 | Open in IMG/M |
| 3300012904|Ga0157282_10403958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012911|Ga0157301_10047151 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300013306|Ga0163162_10762025 | Not Available | 1087 | Open in IMG/M |
| 3300015371|Ga0132258_11512323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1695 | Open in IMG/M |
| 3300017965|Ga0190266_11161476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300018053|Ga0184626_10013279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3257 | Open in IMG/M |
| 3300018054|Ga0184621_10000846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 7231 | Open in IMG/M |
| 3300018056|Ga0184623_10018730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3055 | Open in IMG/M |
| 3300018056|Ga0184623_10121942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1206 | Open in IMG/M |
| 3300018079|Ga0184627_10249641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300018083|Ga0184628_10239003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 953 | Open in IMG/M |
| 3300018465|Ga0190269_10284449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300018465|Ga0190269_11922107 | Not Available | 511 | Open in IMG/M |
| 3300018469|Ga0190270_10026293 | All Organisms → cellular organisms → Bacteria | 3706 | Open in IMG/M |
| 3300018476|Ga0190274_10003443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9411 | Open in IMG/M |
| 3300019249|Ga0184648_1331744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300019249|Ga0184648_1447360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| 3300019259|Ga0184646_1317272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300019458|Ga0187892_10024957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5303 | Open in IMG/M |
| 3300020003|Ga0193739_1007937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2822 | Open in IMG/M |
| 3300020020|Ga0193738_1009344 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300021081|Ga0210379_10043606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1768 | Open in IMG/M |
| 3300021081|Ga0210379_10101677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1196 | Open in IMG/M |
| 3300021082|Ga0210380_10326708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300022534|Ga0224452_1052237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1215 | Open in IMG/M |
| 3300025885|Ga0207653_10000686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11606 | Open in IMG/M |
| 3300025904|Ga0207647_10027683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3692 | Open in IMG/M |
| 3300025910|Ga0207684_10345377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1281 | Open in IMG/M |
| 3300025937|Ga0207669_10785147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
| 3300027056|Ga0209879_1061717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300027068|Ga0209898_1040642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300027163|Ga0209878_1003125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2418 | Open in IMG/M |
| 3300027332|Ga0209861_1004764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2038 | Open in IMG/M |
| 3300027407|Ga0207520_100616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300027511|Ga0209843_1006505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2644 | Open in IMG/M |
| 3300027543|Ga0209999_1045875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
| 3300027650|Ga0256866_1008105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2593 | Open in IMG/M |
| 3300027650|Ga0256866_1176562 | Not Available | 578 | Open in IMG/M |
| 3300027695|Ga0209966_1051698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
| 3300027713|Ga0209286_1005035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4495 | Open in IMG/M |
| 3300027717|Ga0209998_10057174 | Not Available | 913 | Open in IMG/M |
| 3300027873|Ga0209814_10029455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 2257 | Open in IMG/M |
| 3300027955|Ga0209078_1060012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1114 | Open in IMG/M |
| 3300027956|Ga0209820_1080025 | Not Available | 879 | Open in IMG/M |
| 3300027957|Ga0209857_1000677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7885 | Open in IMG/M |
| 3300028722|Ga0307319_10015224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2348 | Open in IMG/M |
| 3300028803|Ga0307281_10330516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300028809|Ga0247824_10799293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300028811|Ga0307292_10117646 | Not Available | 1056 | Open in IMG/M |
| 3300028828|Ga0307312_11164766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300028878|Ga0307278_10083946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_19FT_COMBO_70_19 | 1434 | Open in IMG/M |
| 3300028878|Ga0307278_10389858 | Not Available | 612 | Open in IMG/M |
| 3300030006|Ga0299907_10781977 | Not Available | 722 | Open in IMG/M |
| 3300030619|Ga0268386_10120011 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 2023 | Open in IMG/M |
| 3300030903|Ga0308206_1017339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1172 | Open in IMG/M |
| 3300031226|Ga0307497_10118533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300031562|Ga0310886_10428650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
| 3300031847|Ga0310907_10127473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
| 3300031911|Ga0307412_10210322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1484 | Open in IMG/M |
| 3300031944|Ga0310884_10285092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 915 | Open in IMG/M |
| 3300032017|Ga0310899_10298593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300033550|Ga0247829_10109899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2089 | Open in IMG/M |
| 3300033811|Ga0364924_028393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1135 | Open in IMG/M |
| 3300034817|Ga0373948_0039847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.19% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.49% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.05% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.05% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.03% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.03% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.68% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027407 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_03144130 | 2067725002 | Soil | VETVTYPSHEYHDHEPEPSSSWTGYAAIKYTAIVVIVLAILAFLAWYIVPAFNN |
| KansclcFeb2_02447440 | 2124908045 | Soil | MTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVIIVLAILAFLAWYIVPAFN |
| KansclcFeb2_14660430 | 2124908045 | Soil | MSHPSSEFHEHDPEPGSGWTGYAAIKYTAIVIIVLAILAFLAW |
| deepsgr_02698330 | 2199352025 | Soil | MTHPNYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| ICChiseqgaiiFebDRAFT_113873742 | 3300000363 | Soil | VTYPSHEYHDHEPEPSSSWTGYAAIKYTAIVVIVLAILAFLAWYIVPAFNN* |
| JGI10213J12805_100239563 | 3300000858 | Soil | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLSILAFLAWYIIPAFD* |
| JGI10213J12805_101819982 | 3300000858 | Soil | MSMSHQNTEYHEHEPDHGSMTGFAAIKYTAIVVIVLAILAFLAWYVIPKF* |
| JGI11615J12901_116396511 | 3300000953 | Soil | MSHPSTEYHEHPSTEYHEHDPEPGSGLAGYAAIKYTAIVVIVLAILAFLAWYVIPKLP* |
| JGI10216J12902_1001300802 | 3300000956 | Soil | MTYPSHEYHEHNPEPSSGRTGYPAIRYTAIVLIVLTILALLVWYFVPAFNNSP* |
| JGI10216J12902_1004348002 | 3300000956 | Soil | MTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVIIVLAILAFLAWYIVPAFN* |
| JGI10216J12902_1038396763 | 3300000956 | Soil | MSDHHEYVEHPMTHELEHGSWTGYAAITYTAIVIIVLAIPAFLAWYVVPKLP* |
| JGI25405J52794_100965702 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MTYPSHEYHDHDPEPTSGWTGFAAIKYTAIVIIVLAILAFLAWYVVPAFNN* |
| Ga0062593_1002176342 | 3300004114 | Soil | MSDGHIHSPEPESSSLTGFAAIKYTAIVVIVLAILAFVAWYIVPAFR* |
| Ga0062593_1012383612 | 3300004114 | Soil | MSHPSTEYHEHDPEPGSGLAGYAAIKYSAIVIIVLAILGFLAWYIVPKLP* |
| Ga0062590_1025669972 | 3300004157 | Soil | MSDDHTHSPEPESSSLAGYAAIKYTAIVIIVLAILAFLAWYIVP |
| Ga0062591_1009153331 | 3300004643 | Soil | VEIMSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAI |
| Ga0062591_1012780011 | 3300004643 | Soil | MTYPSHEYREPDPEPSSSWTGFAAIKYTAIVVIVLAILAFLAWYVVPAFNN* |
| Ga0065705_111235362 | 3300005294 | Switchgrass Rhizosphere | MTHPSYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0068868_1009581073 | 3300005338 | Miscanthus Rhizosphere | MSDDHTHSPEPESSSLAGYAAIKYTAIVIIVLAILAFLAWDIVPAFD* |
| Ga0070675_1001225602 | 3300005354 | Miscanthus Rhizosphere | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPKF* |
| Ga0070703_100084343 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHPNYEYHDNDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0066905_1008256003 | 3300005713 | Tropical Forest Soil | MRPREVATMTYPSHEYHEREPEPSSGWTGYAAIKYTAIVIIVLAILAFLAWYIVPAFNN* |
| Ga0066905_1009453432 | 3300005713 | Tropical Forest Soil | CRGRTAVLEVETMSHPSTEYHEHDPEPGSAMTGYAAIKYTAIVIIVLAILAFLAWYIVPKLP* |
| Ga0066905_1022588752 | 3300005713 | Tropical Forest Soil | MSHPSYDYHEHDPEPGSGMTGFAAIKYTAIVVIVLAILAFL |
| Ga0068862_1001849201 | 3300005844 | Switchgrass Rhizosphere | GGPIMTHPNYEYHDNDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0081455_100125052 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTYPSHEYHDHEPEPSSGWTGFAAIKYTAIVIIVLAILAFLAWYIVPAFNN* |
| Ga0081455_100193724 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSHPSTEYHEHDPEPGSGLAGYAAIKYTAIVVIVLAILAFLAWYVIPKLP* |
| Ga0081455_100324147 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVIIVLAILAFLAWYIVPAFNN* |
| Ga0081455_101455874 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSHPSYDYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYII |
| Ga0081455_104301482 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSDGHNHSPEPESSSPAGFAAIKYTAIVIIVLAILAFIAWYIIPAFN* |
| Ga0075417_100298081 | 3300006049 | Populus Rhizosphere | MRPPEVETMTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVVIVLAILAFLAWYIVPAFNN* |
| Ga0075432_100723512 | 3300006058 | Populus Rhizosphere | MRPPEVETMTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVVIVLAILAFLAWYVVPAFNN* |
| Ga0075432_102307131 | 3300006058 | Populus Rhizosphere | EVETMTYPSHDYRGPDPEPTSGWTGFAAIKYTAIVIIVLAILAFLAWYVVPAFNN* |
| Ga0074051_100092729 | 3300006572 | Soil | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVIIVLASLAFLAWYIVPAID* |
| Ga0074048_101237047 | 3300006581 | Soil | MSHPSYEYHEHDPEPSSGLTGYAAIKYTAIVIIVLASLAFLAWYIVPAID* |
| Ga0074048_133199372 | 3300006581 | Soil | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVIIVLAIPAFLAWYIVPAFD* |
| Ga0075428_1000687204 | 3300006844 | Populus Rhizosphere | MTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVVIVLAILAFLAWYIVPAFNN* |
| Ga0075428_1000802818 | 3300006844 | Populus Rhizosphere | MTDGHSHSPDRSLLVPPDAAIKYTAIVIIVLAILAFIAWYIIPAFN* |
| Ga0075428_1003608554 | 3300006844 | Populus Rhizosphere | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPAFD* |
| Ga0075428_1006595803 | 3300006844 | Populus Rhizosphere | MSDEHTHSPEPESSGLAGYAAIKYSAIVIIVLAILAFIAWYVIPAFNN* |
| Ga0075428_1013547992 | 3300006844 | Populus Rhizosphere | TMSHPSYDYHEHDPEPGSGLTGFAAIKYTAIVIIVLAILAFAAWYVIPAFD* |
| Ga0075421_1002409361 | 3300006845 | Populus Rhizosphere | MSHPSYDYHEHDPEPGSGLTGFAAIKYTAIVIIVLAILAFAAWYVIPAFD* |
| Ga0075431_1001593315 | 3300006847 | Populus Rhizosphere | VMSDEHTHSPEPESSGLAGYAAIKYSAIVIIVLAILAFIAWYVIPAFNN* |
| Ga0075431_1007464531 | 3300006847 | Populus Rhizosphere | VTYPSHEYHDHEPEPSSSWTGYAAIKYTAIVVIVLAILAFLAWYV |
| Ga0075419_101255854 | 3300006969 | Populus Rhizosphere | MRPPEVETMTYPSHEYHDHEPEPSSSWTGYAAIKYTAIVVIVLAILAFLAWYVVP |
| Ga0105679_108426921 | 3300007790 | Soil | MPEEDEMTSSHTHQPATPEPESGWTGYAAVKYTAIVVIVLAILAFLAWYVIPAFDRA* |
| Ga0105251_100130225 | 3300009011 | Switchgrass Rhizosphere | MSDDHTHSPEPESSSLAGYAAIKYTAIVIIVLAILAFLAWYFVPAFD* |
| Ga0105093_109814202 | 3300009037 | Freshwater Sediment | MTHHVEEEYHSHSAPAEPGSGLAGYAAIKYTAIVVIVLAILAFLAWYVIPRF* |
| Ga0105095_100149006 | 3300009053 | Freshwater Sediment | MANENYHTHNTPTEPDSGLTGYAAIKYTAIVVIVLAILAFLAWYVIPKF* |
| Ga0105107_101727654 | 3300009087 | Freshwater Sediment | MANEEYHTHNTPTEPDSGLTGYAAIKYTAIVVIVLAILAFLAWYVIPKF* |
| Ga0111539_102139593 | 3300009094 | Populus Rhizosphere | MSVDHTHSPEPESSGLTGYAAIKYTAIVIIVLAILAFLAWYIIP |
| Ga0111539_123110942 | 3300009094 | Populus Rhizosphere | MTHPNYEYHDHDPEPGSGLAGYSAIKYTAIVIIVLAILAFLAWYIIPAFD* |
| Ga0075418_109993921 | 3300009100 | Populus Rhizosphere | HSPEPESSGLTGYAAIKYTAIVIIVLAIPAFLAWYIIPAFD* |
| Ga0111538_103341475 | 3300009156 | Populus Rhizosphere | MTHPNYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIIPAFD* |
| Ga0105092_105946851 | 3300009157 | Freshwater Sediment | MSDDHTHSPEPESSSLAGDAAIKYSAIVIIVLAILAFLAWYIVPKFN* |
| Ga0105092_108822521 | 3300009157 | Freshwater Sediment | MSDDHTHSPEPESSGLAGYAAIKYSAIVIIVLAILAFIAWYVIPAFN* |
| Ga0105100_1000955412 | 3300009166 | Freshwater Sediment | MANENYHTHNTPTEPDSGLTGYAAIKYTAIVVIVLAILAFLAWYVI |
| Ga0105100_100547865 | 3300009166 | Freshwater Sediment | MTNHVEEEYHSHGAPAEPGSGLAGYAAIKYTAIVVIVLAILAFLAWYVIP |
| Ga0105241_114496121 | 3300009174 | Corn Rhizosphere | PSYEYHDHDPEPGSGLTGFAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0105249_114152021 | 3300009553 | Switchgrass Rhizosphere | MSEDHTHNPEPESAGLAGYAAIKYTAIVIIVLAILAFLAWYVIPAFNN* |
| Ga0126307_100073324 | 3300009789 | Serpentine Soil | VEIMSHPSYEYHEHDPEPGSGTTGFAAIKYSAIMIIVLAILAFLAWYVVPKF* |
| Ga0126307_105937041 | 3300009789 | Serpentine Soil | MSDDHTHSPEPESSGLAGYAAIKYTAIVIMVLAILAFLAWYIVPKFN* |
| Ga0105088_10272642 | 3300009810 | Groundwater Sand | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0105067_10061373 | 3300009812 | Groundwater Sand | YEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILTFLAWYIVPKF* |
| Ga0105070_10414831 | 3300009815 | Groundwater Sand | MSHPSTEFHEHDPEPGSAWTGYAAIKYSAIVIIVLAILAFLAWY |
| Ga0105087_11235621 | 3300009819 | Groundwater Sand | MSHPSTEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILGFLAWYIVPKLP* |
| Ga0105078_10489972 | 3300009823 | Groundwater Sand | MSDDHTHSPEPESSSLAGYAAIKYTAIVIIVLAILAFL |
| Ga0105068_10152613 | 3300009836 | Groundwater Sand | MSHPSTEFHEHDPEPGSAWTGYAAIKYSAIVIIVLAILAFLAWYIDPKFD* |
| Ga0105068_10185383 | 3300009836 | Groundwater Sand | SHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYIVPKF* |
| Ga0126313_104003882 | 3300009840 | Serpentine Soil | VEIMSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYVVPNF* |
| Ga0126305_102808822 | 3300010036 | Serpentine Soil | VEIMSHPSYEYHEHDPEPGSGTTGFAAIKYSAIVIIVLAILAFLAWYVVPKF* |
| Ga0126312_101875502 | 3300010041 | Serpentine Soil | VEIMSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYVVPKF* |
| Ga0126314_105167891 | 3300010042 | Serpentine Soil | GVMSDDHTHSPEPESSSLAGFAAIKYTAIVIMVLAILAFLAWYIVPKFN* |
| Ga0126319_10822431 | 3300010147 | Soil | GASSGGGAIMTHPNYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIIPAFD* |
| Ga0126377_117603781 | 3300010362 | Tropical Forest Soil | MSEQHTHSPEPESESSSLTGYAAIKYTAIVIIVLAILAFLAWYVVPAFH* |
| Ga0126377_119671231 | 3300010362 | Tropical Forest Soil | STEYHEHDPEPGSAMTGYAAIKYTAIVIIVLAILAFLAWYIVPKLP* |
| Ga0134122_108235261 | 3300010400 | Terrestrial Soil | MTHPSYEYHEHDPEPGSGLTGYAAIKYTAIVIIVLAILAFLAW |
| Ga0137424_10256211 | 3300011412 | Soil | MSHPSEYHEHDPEPGSGLTGFAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0120191_100403592 | 3300012022 | Terrestrial | VEIMSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILA |
| Ga0137344_10335812 | 3300012159 | Soil | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLSILAFLAWYIIPAFE* |
| Ga0137372_107737691 | 3300012350 | Vadose Zone Soil | MSDDHTHSPEPESSSLVGYAAIKYTAIVIIVLSILAFLAWYIVPRLP* |
| Ga0137367_100934592 | 3300012353 | Vadose Zone Soil | MSRPSTEYHEHDPEPGSGWTGYAAIKYTAIVIIVLSILAFLAWYIVPKFD* |
| Ga0137367_101769934 | 3300012353 | Vadose Zone Soil | MSDDDTHSPEPESSSLVGYAAIKYTAIVIIVLSILAFLAWYIVPRLP* |
| Ga0137373_102361904 | 3300012532 | Vadose Zone Soil | ITSTARDDESFGLAGYGAIRYTAIVIIVLAILAILAILAFLAWYIVPAVD* |
| Ga0157282_104039581 | 3300012904 | Soil | MVRPREVENMSHPSYEYHEPDPEPGSGLTGYAAIKYTAIVIIVLAILAFL |
| Ga0157301_100471512 | 3300012911 | Soil | MSDGHIHSPEPESSSLTGFAAIKYTAIVVIVMAILAFVAWYIVPAFR* |
| Ga0163162_107620253 | 3300013306 | Switchgrass Rhizosphere | GAIMTHPSYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD* |
| Ga0132258_115123232 | 3300015371 | Arabidopsis Rhizosphere | VEIMSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPKF* |
| Ga0190266_111614761 | 3300017965 | Soil | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVIIVLAILAFLAWYVIP |
| Ga0184626_100132792 | 3300018053 | Groundwater Sediment | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPAFD |
| Ga0184621_100008468 | 3300018054 | Groundwater Sediment | MNEDHTHSPEPESSGLAGYSAIKYTAIVIIVLAILAFLAWYVVPAFNN |
| Ga0184623_100187307 | 3300018056 | Groundwater Sediment | MTHQNMEYREHEPDQGSLTGFAAIKYTAIVVIVLAILAFLAWYVIPQFNN |
| Ga0184623_101219422 | 3300018056 | Groundwater Sediment | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLSILAFLAWYIIPAFD |
| Ga0184627_102496411 | 3300018079 | Groundwater Sediment | QMSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLSILAFLAWYIIPAFD |
| Ga0184628_102390031 | 3300018083 | Groundwater Sediment | MTHPNYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIIPAFD |
| Ga0190269_102844492 | 3300018465 | Soil | MSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYIVPKF |
| Ga0190269_119221072 | 3300018465 | Soil | MTDDHTHSPEPELSSLAGYAAIKYTAIVIIVLAILAFLAWYIVPKFN |
| Ga0190270_100262937 | 3300018469 | Soil | MSDEHTHSPEPESSGLAGYAAIKYSAIVIIVLAILAFIAWYVIPAFNN |
| Ga0190274_100034434 | 3300018476 | Soil | MSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYVIPKF |
| Ga0184648_13317443 | 3300019249 | Groundwater Sediment | MTHPSYEYHEHDPEPGAGLTGYAAIKYTAIVIIVLAILAFLAWYIIPAFD |
| Ga0184648_14473601 | 3300019249 | Groundwater Sediment | SDLGRWDQMSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLSILAFLAWYIIPAFD |
| Ga0184646_13172723 | 3300019259 | Groundwater Sediment | GAVWEVDTMTHQNMEYHEHEHEPDQGSLTGFAAIKYTAIVVIVLAILAFLAWYVIPQFNN |
| Ga0187892_100249577 | 3300019458 | Bio-Ooze | MTHTDTEYRQHEPDQGSLTGFAAIKYTAIVVIVLAILAFLAWYVIPQFKN |
| Ga0193739_10079371 | 3300020003 | Soil | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLA |
| Ga0193738_10093443 | 3300020020 | Soil | MENHPHEPEEKGSLTGYAAIKYTAIVVIVIAILVFLAAYVLPLVRE |
| Ga0210379_100436063 | 3300021081 | Groundwater Sediment | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVMIVLAILAFLAWYIIPAFD |
| Ga0210379_101016772 | 3300021081 | Groundwater Sediment | MSHPSYQYHEHDPEPGSGMTAFAAIKYTAIVIIVLSILAFLAWYIIPAFD |
| Ga0210380_103267081 | 3300021082 | Groundwater Sediment | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVMIVLAILAFLAWYIVPAFD |
| Ga0224452_10522372 | 3300022534 | Groundwater Sediment | MSEDHTHSPEPESSGLAGYSAIKYTAIVIIVLAILAFLAWYVVPAFNN |
| Ga0207653_1000068615 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHPNYEYHDNDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0207647_100276833 | 3300025904 | Corn Rhizosphere | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPKF |
| Ga0207684_103453774 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHPSYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0207669_107851472 | 3300025937 | Miscanthus Rhizosphere | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVVIVLAILAFIAWVILPRLTG |
| Ga0209879_10617171 | 3300027056 | Groundwater Sand | MSHPSTEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYIVPKF |
| Ga0209898_10406421 | 3300027068 | Groundwater Sand | YEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILTFLAWYIVPKF |
| Ga0209878_10031254 | 3300027163 | Groundwater Sand | MSHPSTEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPKF |
| Ga0209861_10047642 | 3300027332 | Groundwater Sand | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYIVPKF |
| Ga0207520_1006162 | 3300027407 | Soil | MSHPSYEYHEHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYVVPAFD |
| Ga0209843_10065051 | 3300027511 | Groundwater Sand | ATSWRWDHMSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYVVPAFD |
| Ga0209999_10458751 | 3300027543 | Arabidopsis Thaliana Rhizosphere | WEVEIMSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVIIVLAILGFLAWYIVPKLP |
| Ga0256866_10081053 | 3300027650 | Soil | MSDEHTHSPEPESPSLAGYAAIKYSAIVIIVLAILAFIAWYVIPRFD |
| Ga0256866_11765621 | 3300027650 | Soil | THSPEPESSGLAGYAAIKYTAIVIIVLAILAFIAWYVIPAFNN |
| Ga0209966_10516982 | 3300027695 | Arabidopsis Thaliana Rhizosphere | VENMSHPSTEYHEHDPEPGSGLAGYAAIKYSAIVIIVLAILGFLAWYIVPKLP |
| Ga0209286_10050355 | 3300027713 | Freshwater Sediment | MANENYHTHNTPTEPDSGLTGYAAIKYTAIVVIVLAILAFLAWYVIPKF |
| Ga0209998_100571742 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MSHPSTEYHEHDPEPGSGLAGYAAIKYSAIVIIVLAILGFLAWYIVPKLP |
| Ga0209814_100294554 | 3300027873 | Populus Rhizosphere | MRPPEVETMTYPSHEYHEHEPEPSSGWTGYAAIKYTAIVVIVLAILAFLAWYIVPAFNN |
| Ga0209078_10600122 | 3300027955 | Freshwater Sediment | MTHHVEEEYHSHGAPAEPGSGLAGYAAIKYTAIVVIVLAILAFLAWYVIPKF |
| Ga0209820_10800252 | 3300027956 | Freshwater Sediment | MSDDHTHSPEPESSGLAGYAAIKYTAIVIIVLAILAFIAWYVIPAFNN |
| Ga0209857_10006772 | 3300027957 | Groundwater Sand | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0307319_100152241 | 3300028722 | Soil | HRAVREVEIMSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYIVPKF |
| Ga0307281_103305162 | 3300028803 | Soil | MSHPSYQYHEHDPEPGSGMTGFAAIKYTAIVIIVLSILAFLAWYIIPA |
| Ga0247824_107992931 | 3300028809 | Soil | MSHPSYEYHEHDPEPGSGMTGFAAIKYTAIVIIVLAILAF |
| Ga0307292_101176463 | 3300028811 | Soil | TINTHSPEPESSGLAGYAAIKYTAIVVIVLAILAFLAWYIVPAFD |
| Ga0307312_111647662 | 3300028828 | Soil | MSHPSYEYHEHDPEPGSGLTGYAAIKYTAIVIIVLAILAFLAWYVVP |
| Ga0307278_100839463 | 3300028878 | Soil | MSDDQTHSPEPESSGLTGYAAIKYTAIVIIVLAILAWYIVPAFD |
| Ga0307278_103898581 | 3300028878 | Soil | MNEDHTHSPEPESSGLAGYAAIKYTAIVVIVLAILAFLAWYIVPAF |
| Ga0299907_107819771 | 3300030006 | Soil | MSEEHTHSPEPESSGLAGYAAIKYTAIVIIVLAILAFIAWYVIPAFN |
| Ga0268386_101200114 | 3300030619 | Soil | MNEEHTHSPEPESSGLAGYAAIKYTAIVIIVLAILAF |
| Ga0308206_10173391 | 3300030903 | Soil | VEIMSHPSYEYHEHDPEPGSGMTGFAAIKYSAIVIIVLAILAFLAWYIVPKF |
| Ga0307497_101185331 | 3300031226 | Soil | MTHPNYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLA |
| Ga0310886_104286501 | 3300031562 | Soil | MTHPSYEYHDHDPEPGAGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0310907_101274731 | 3300031847 | Soil | GPIMTHPNYEYHDNDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0307412_102103222 | 3300031911 | Rhizosphere | MSHPSYEYHEHDPEPGSGTTGFAAIKYSAIVIIVLAILAFLAWYVVPKF |
| Ga0310884_102850923 | 3300031944 | Soil | THPNYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0310899_102985931 | 3300032017 | Soil | GGAIMTHPSYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVPAFD |
| Ga0247829_101098992 | 3300033550 | Soil | MSHPSYEYHEHDPEPGSGMAGFAAIKYTAIVIIVLAILAFLAWYIVPKF |
| Ga0364924_028393_201_353 | 3300033811 | Sediment | MTHPETQNREHEPDQGSLTGFAAIKYTAIVVIVLAILAFLAWYVIPQFNN |
| Ga0373948_0039847_1_141 | 3300034817 | Rhizosphere Soil | MTHPSYEYHDHDPEPGSGLAGYAAIKYTAIVIIVLAILAFLAWYIVP |
| ⦗Top⦘ |