| Basic Information | |
|---|---|
| Family ID | F048290 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TLAFLGAIAPFAVVLAVAGYAVYRGRRWLARRRPAAGPASPES |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.36 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 89.86 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.730 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.108 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.081 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.865 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF01208 | URO-D | 66.89 |
| PF09863 | DUF2090 | 22.30 |
| PF11452 | DUF3000 | 3.38 |
| PF02163 | Peptidase_M50 | 0.68 |
| PF12951 | PATR | 0.68 |
| PF01609 | DDE_Tnp_1 | 0.68 |
| PF13090 | PP_kinase_C | 0.68 |
| PF12323 | HTH_OrfB_IS605 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 66.89 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.68 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.68 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.68 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.73 % |
| Unclassified | root | N/A | 20.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01EG846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300001867|JGI12627J18819_10463613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101015657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 714 | Open in IMG/M |
| 3300003218|JGI26339J46600_10168488 | Not Available | 502 | Open in IMG/M |
| 3300004635|Ga0062388_102151003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300005093|Ga0062594_101815336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300005328|Ga0070676_10060647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2247 | Open in IMG/M |
| 3300005339|Ga0070660_100196132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1637 | Open in IMG/M |
| 3300005363|Ga0008090_15465272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300005434|Ga0070709_10692161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300005437|Ga0070710_11137813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300005438|Ga0070701_10784051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300005445|Ga0070708_100847763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300005543|Ga0070672_100721283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300005575|Ga0066702_10741094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300005591|Ga0070761_10439381 | Not Available | 800 | Open in IMG/M |
| 3300006046|Ga0066652_101897452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300006050|Ga0075028_100897240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300006052|Ga0075029_101358897 | Not Available | 500 | Open in IMG/M |
| 3300006059|Ga0075017_100308891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1170 | Open in IMG/M |
| 3300006577|Ga0074050_12067294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1350 | Open in IMG/M |
| 3300006791|Ga0066653_10156744 | Not Available | 1115 | Open in IMG/M |
| 3300006796|Ga0066665_11254133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300006804|Ga0079221_11220041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300006806|Ga0079220_11530556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300006806|Ga0079220_11646935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300006914|Ga0075436_101029289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300009038|Ga0099829_10958431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300009090|Ga0099827_10356523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1245 | Open in IMG/M |
| 3300009137|Ga0066709_102011761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300009520|Ga0116214_1314329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300009698|Ga0116216_10695562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300009700|Ga0116217_10574973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300009839|Ga0116223_10106219 | Not Available | 1771 | Open in IMG/M |
| 3300010325|Ga0134064_10182591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300010358|Ga0126370_11921998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300010359|Ga0126376_11336768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300010360|Ga0126372_12559004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300010366|Ga0126379_13500013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300010366|Ga0126379_13834394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300012199|Ga0137383_10378097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300012199|Ga0137383_10688167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300012200|Ga0137382_11036968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300012285|Ga0137370_10515751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300012354|Ga0137366_10059245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2925 | Open in IMG/M |
| 3300012491|Ga0157329_1003099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
| 3300012514|Ga0157330_1068316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300012683|Ga0137398_10892921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300012951|Ga0164300_10033768 | Not Available | 1903 | Open in IMG/M |
| 3300012957|Ga0164303_10816694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300014325|Ga0163163_11261548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300014501|Ga0182024_11208489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300016294|Ga0182041_10849951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300016319|Ga0182033_10848920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300016422|Ga0182039_10581022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
| 3300017926|Ga0187807_1085357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 988 | Open in IMG/M |
| 3300017937|Ga0187809_10324713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300017947|Ga0187785_10188699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300017955|Ga0187817_11050752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300017972|Ga0187781_11288225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300017973|Ga0187780_11214923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300018433|Ga0066667_11073424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300020000|Ga0193692_1089656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300020583|Ga0210401_11138886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300021168|Ga0210406_10618380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300021181|Ga0210388_10429620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300021401|Ga0210393_11373521 | Not Available | 565 | Open in IMG/M |
| 3300021404|Ga0210389_10395227 | Not Available | 1087 | Open in IMG/M |
| 3300021407|Ga0210383_10312094 | Not Available | 1353 | Open in IMG/M |
| 3300022522|Ga0242659_1023620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300025912|Ga0207707_10460806 | Not Available | 1087 | Open in IMG/M |
| 3300025917|Ga0207660_11690352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300025917|Ga0207660_11715643 | Not Available | 505 | Open in IMG/M |
| 3300025929|Ga0207664_11592464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300025939|Ga0207665_10463596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300026374|Ga0257146_1016408 | Not Available | 1207 | Open in IMG/M |
| 3300027096|Ga0208099_1008851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1306 | Open in IMG/M |
| 3300027173|Ga0208097_1021136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300027288|Ga0208525_1023886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
| 3300027750|Ga0209461_10089288 | Not Available | 684 | Open in IMG/M |
| 3300027817|Ga0209112_10011570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2470 | Open in IMG/M |
| 3300027824|Ga0209040_10002974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13069 | Open in IMG/M |
| 3300027855|Ga0209693_10157463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1121 | Open in IMG/M |
| 3300027895|Ga0209624_10674678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
| 3300027915|Ga0209069_10321776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 827 | Open in IMG/M |
| 3300028379|Ga0268266_10154294 | Not Available | 2072 | Open in IMG/M |
| 3300028782|Ga0307306_10032746 | Not Available | 1240 | Open in IMG/M |
| 3300028885|Ga0307304_10060522 | Not Available | 1428 | Open in IMG/M |
| 3300030743|Ga0265461_11314958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300031525|Ga0302326_10070564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6468 | Open in IMG/M |
| 3300031543|Ga0318516_10105244 | Not Available | 1597 | Open in IMG/M |
| 3300031544|Ga0318534_10848052 | Not Available | 512 | Open in IMG/M |
| 3300031564|Ga0318573_10271866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300031572|Ga0318515_10070283 | Not Available | 1797 | Open in IMG/M |
| 3300031572|Ga0318515_10197075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300031680|Ga0318574_10398162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300031681|Ga0318572_10045690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2342 | Open in IMG/M |
| 3300031682|Ga0318560_10757501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300031708|Ga0310686_117990128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300031713|Ga0318496_10106145 | Not Available | 1511 | Open in IMG/M |
| 3300031723|Ga0318493_10740654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300031748|Ga0318492_10267889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 885 | Open in IMG/M |
| 3300031763|Ga0318537_10127018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 948 | Open in IMG/M |
| 3300031765|Ga0318554_10373538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
| 3300031768|Ga0318509_10341359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 838 | Open in IMG/M |
| 3300031768|Ga0318509_10471525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300031769|Ga0318526_10103440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
| 3300031771|Ga0318546_10987622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300031779|Ga0318566_10264991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300031779|Ga0318566_10406011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300031781|Ga0318547_10560453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300031793|Ga0318548_10502499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300031796|Ga0318576_10020414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2624 | Open in IMG/M |
| 3300031820|Ga0307473_11543214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300031831|Ga0318564_10079181 | Not Available | 1451 | Open in IMG/M |
| 3300031846|Ga0318512_10120794 | Not Available | 1246 | Open in IMG/M |
| 3300031860|Ga0318495_10021818 | Not Available | 2750 | Open in IMG/M |
| 3300031880|Ga0318544_10347200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300031890|Ga0306925_11356854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300031938|Ga0308175_102982255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300031939|Ga0308174_11400520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300031945|Ga0310913_10077861 | Not Available | 2209 | Open in IMG/M |
| 3300031945|Ga0310913_10594582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300031954|Ga0306926_10241039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2241 | Open in IMG/M |
| 3300032010|Ga0318569_10054432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1738 | Open in IMG/M |
| 3300032041|Ga0318549_10202572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300032044|Ga0318558_10062828 | Not Available | 1672 | Open in IMG/M |
| 3300032052|Ga0318506_10462298 | Not Available | 563 | Open in IMG/M |
| 3300032052|Ga0318506_10488707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300032064|Ga0318510_10257647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300032067|Ga0318524_10643754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300032068|Ga0318553_10067914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1780 | Open in IMG/M |
| 3300032068|Ga0318553_10074919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1700 | Open in IMG/M |
| 3300032074|Ga0308173_10922509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
| 3300032076|Ga0306924_10092694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3404 | Open in IMG/M |
| 3300032089|Ga0318525_10067023 | Not Available | 1800 | Open in IMG/M |
| 3300032089|Ga0318525_10461073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300032091|Ga0318577_10088519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300032828|Ga0335080_11789050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300032829|Ga0335070_11821658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300032896|Ga0335075_10200287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2389 | Open in IMG/M |
| 3300032897|Ga0335071_11811877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300032954|Ga0335083_10119038 | Not Available | 2557 | Open in IMG/M |
| 3300033134|Ga0335073_11071030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300033158|Ga0335077_10559595 | Not Available | 1200 | Open in IMG/M |
| 3300034124|Ga0370483_0181968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300034820|Ga0373959_0118162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.68% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_03887590 | 2170459012 | Grass Soil | RITVSWTLAFLGAIAPFAIVVAIVGYVVYRGRRRLIRRRPAAGPASPES |
| JGI12627J18819_104636131 | 3300001867 | Forest Soil | LRIAVSWTLALLGAVAPFAVVLAVAGFGFYRGRRWLARRRAAGSGGSAG* |
| JGIcombinedJ26739_1010156573 | 3300002245 | Forest Soil | LGAIAPFAAIAAIAGYAIYRARRWMIRRRPGPGPAAPEN* |
| JGI26339J46600_101684881 | 3300003218 | Bog Forest Soil | ALRITLSWTLAFLGVIAPFAAIAAIAGYVIYGSRRRLIRRRPAHPATPEN* |
| Ga0062388_1021510031 | 3300004635 | Bog Forest Soil | TLAFLGAIAPFAVIAAIAGFAIYRARRWIIRRRPEPRPAAPEN* |
| Ga0062594_1018153362 | 3300005093 | Soil | SWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0070676_100606474 | 3300005328 | Miscanthus Rhizosphere | AVSWTLAFLGAIAPFAVVLAVAGYVVYRGRRWLNRRRPTAGPASPGS* |
| Ga0070660_1001961323 | 3300005339 | Corn Rhizosphere | AVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPTSPES* |
| Ga0008090_154652722 | 3300005363 | Tropical Rainforest Soil | LGAIAPFAAVLAIAGYVVYRGRRWLIRRRPAAGPASPDS* |
| Ga0070709_106921611 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TVSWTLAFLGAIAPFAAILAVAGYAAYRGRRWLARRKPATQGASPEI* |
| Ga0070710_111378132 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | SWTLAFLGAIAPFAAVAAVAGYVVYRGRRRLARRKPAARAASPES* |
| Ga0070701_107840512 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0070708_1008477632 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFLGAIAPFAVVLAVAGYVVYRGRRWLTRRRPAAGAASPES* |
| Ga0070730_109836382 | 3300005537 | Surface Soil | AIAPFAAVAALAGFGFYRARRWALRRRPASRPAAPEN* |
| Ga0070672_1007212832 | 3300005543 | Miscanthus Rhizosphere | ALRVAVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0066702_107410941 | 3300005575 | Soil | ALRVAVSWTLAFLGAIAPFAVVLAVAGYVVYRGRRWLHRRRPTAGPASPGS* |
| Ga0070761_104393812 | 3300005591 | Soil | FLGALAPFAAIVAIAGFAIYRGRRWMIRRRPAAQPASPEN* |
| Ga0066652_1018974522 | 3300006046 | Soil | AVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLARRRPAAGPASPES* |
| Ga0075028_1008972401 | 3300006050 | Watersheds | SWTLAFLGAIAPFAAILAIAGYVIYRSRRRLIRRRPTAQPASPES* |
| Ga0075029_1013588972 | 3300006052 | Watersheds | ALRVTVSWTLAFLGAIAPFAAIVAIAGFVIYRGRRRLIRRKPAAQPASPES* |
| Ga0075017_1003088911 | 3300006059 | Watersheds | ALRVTVSWTLAFLGAIAPFAAIAAIAGYVIYRGRRRLIRRRPTAQSASGES* |
| Ga0074050_120672942 | 3300006577 | Soil | FLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0066653_101567442 | 3300006791 | Soil | IAPFAVVLAVAGYAVYRGRRWLNRRRPTAGPASPGS* |
| Ga0066665_112541331 | 3300006796 | Soil | WHALRVAVSWTLAFLGAIAPFAVVLAIAGYVVYRGRRWLNRRRPATGPASPES* |
| Ga0079221_112200411 | 3300006804 | Agricultural Soil | TAVSWTLAFLGAIAPFAVVLAVAGYLIYRGRRWLSRRRPATGPASPES* |
| Ga0079220_115305562 | 3300006806 | Agricultural Soil | LRVTVSWTLAFLGAIAPFAVVLAVAGYAAYRGRRWLARRKPAARAASPES* |
| Ga0079220_116469351 | 3300006806 | Agricultural Soil | ALRVTVSWTLAFLGAIAPFAAILAAAGYAAYRGRRWLARRKPAAQAASPES* |
| Ga0075436_1010292892 | 3300006914 | Populus Rhizosphere | IAPFAVVLAVAGYLVYRGRRWLGRRRPATGPTSPES* |
| Ga0099829_109584312 | 3300009038 | Vadose Zone Soil | RITVSWTLAFLGAIAPFAAIVAIAGYAVYRGRRWLTRRRPAAQPAAPES* |
| Ga0099827_103565231 | 3300009090 | Vadose Zone Soil | IAPFAAILAIAGYVIYRGRRWLMRRRPAAQPASPES* |
| Ga0066709_1020117612 | 3300009137 | Grasslands Soil | VSWTLAFLGAIAPFAVVLAVAGYAVYRGRRWLNRRRPTAGPASPGS* |
| Ga0116214_13143291 | 3300009520 | Peatlands Soil | WTLAFLGAIAPFAAIAAIAGYVIYRGRRRLIRRRPTARSAAGES* |
| Ga0116216_106955622 | 3300009698 | Peatlands Soil | RVTVSWTLAFLGAIAPFAAIAAIAGYVIYRGRRRLIRRRPTAQSAAGES* |
| Ga0116217_105749731 | 3300009700 | Peatlands Soil | AIAAIAGYVIYRGRRWLIRRRPTAQSASGESLRAGR* |
| Ga0116223_101062191 | 3300009839 | Peatlands Soil | VAPFAAIAVIAGYAIYRARRWMLRRRPGPRPAAPEN* |
| Ga0134064_101825912 | 3300010325 | Grasslands Soil | VSWTLAFLGAIAPFAVVLAVAGYVVYRGRRWLHRRRPTAGPASPES* |
| Ga0126370_119219981 | 3300010358 | Tropical Forest Soil | SWTLAFLGAIAPFAVVLAVAGYLVYRGRRWRTGRSPAGGPASPES* |
| Ga0126376_113367682 | 3300010359 | Tropical Forest Soil | GAIAPFAAVLAVAGFAIYRGRRWLARRRPAARPAAPET* |
| Ga0126372_125590042 | 3300010360 | Tropical Forest Soil | VSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWRTGRRPAAGPASPES* |
| Ga0126379_135000131 | 3300010366 | Tropical Forest Soil | LAFLGAIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPTSPES* |
| Ga0126379_138343942 | 3300010366 | Tropical Forest Soil | RIAVSWTLAFLGAIAPFAAVLAIAGYVVYRGRRWLIRRRPATRPASPES* |
| Ga0137383_103780971 | 3300012199 | Vadose Zone Soil | LRVAVSWTLAFLGAIAPFAVVLAVAGYVIYRGRRWLSRRGPTAGPASPES* |
| Ga0137383_106881671 | 3300012199 | Vadose Zone Soil | TLAFLGAIAPFAVVLAVAGYVVYRGRRWLNRRRPAAGPASPES* |
| Ga0137382_110369681 | 3300012200 | Vadose Zone Soil | IAPFAVVLAVAGYVVYRGRRWLARRRPATGSASPES* |
| Ga0137370_105157512 | 3300012285 | Vadose Zone Soil | APFAVVLAVAGYVVYRGRRWLNRRRPAAGPASPGS* |
| Ga0137366_100592451 | 3300012354 | Vadose Zone Soil | AFLGAIAPFAVVLAVAGYVVYRGRRWLARRRPAGPASPES* |
| Ga0157329_10030992 | 3300012491 | Arabidopsis Rhizosphere | LAFLGAIAPFAVVLAIAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0157330_10683162 | 3300012514 | Soil | WHALRIAVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0137398_108929212 | 3300012683 | Vadose Zone Soil | FLGAIAPFAVVLAVAGYVVYRGRRWLNRRRPTAGPASPGS* |
| Ga0164300_100337681 | 3300012951 | Soil | TLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES* |
| Ga0164303_108166941 | 3300012957 | Soil | SWMLAFLGAIAPFAVVLAVAGYLVYRGRRWLSRRRPATGPASPEG* |
| Ga0163163_112615482 | 3300014325 | Switchgrass Rhizosphere | AIAPFAAILAAAGYAAYRGRRWLARRKPAAQAASPES* |
| Ga0182024_112084892 | 3300014501 | Permafrost | HALMVALTWTLAALGAIAPFAAILAVAGFLIYRGRRWALRRPPTA* |
| Ga0182041_108499512 | 3300016294 | Soil | FLGAIAPFAAVLAIAGYVVYRGRRWLIRRRPAAEPAAPER |
| Ga0182033_108489201 | 3300016319 | Soil | ITVSWTLAFLGAIAPFAVVLAVAGYLVYRVRRRLTRRRPAAGPASPES |
| Ga0182039_105810222 | 3300016422 | Soil | VSWTLAFLGAIAPFAVVLAVAGYLVYRGRRRLTRRRPAAGPASPES |
| Ga0187807_10853572 | 3300017926 | Freshwater Sediment | AFLGAIAPFAAIAVIAGYALYRTRRWMICRRPAPRPAAPEN |
| Ga0187809_103247132 | 3300017937 | Freshwater Sediment | VAPFAAVAALAGFVIYRGWRWLTRRRPAAGPASPES |
| Ga0187785_101886991 | 3300017947 | Tropical Peatland | IAPFAVVLAVAGYLVYRGRRWRTGRRPAAGPASPES |
| Ga0187817_110507521 | 3300017955 | Freshwater Sediment | HALRVTVSWVLAFVGTVLPFAAVAALAGFVVYRGRRWLIRRKPTARPASPEN |
| Ga0187781_112882251 | 3300017972 | Tropical Peatland | VSWILAFLGAVAPFAAVAALAGFVVYRGRRRLIRRRPAARPASPES |
| Ga0187780_112149231 | 3300017973 | Tropical Peatland | LAFLGAIAPFAAIAAIVGYAIYRARRWVLGRRPGPRPAAPEN |
| Ga0066667_110734242 | 3300018433 | Grasslands Soil | SWTLAFLGAIAPFAVVLAVAGYGVYRGRRWLNRRRPTAGPASPGS |
| Ga0193692_10896562 | 3300020000 | Soil | SWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES |
| Ga0210401_111388861 | 3300020583 | Soil | APFAAFAVIAGYVIYRGRRWLIRRKPAAPSASPES |
| Ga0210406_106183802 | 3300021168 | Soil | VAVSWTLAFLGAIAPFAVVLAIAGYVIYRGRRWLTRRRPTAQPASPES |
| Ga0210388_104296202 | 3300021181 | Soil | VAPFAAIAAIGGYVIYRSRRWLVRRRPGAQSASPES |
| Ga0210393_113735211 | 3300021401 | Soil | LAVSWTLAFLGAIAPCAAVAALAGFGIYRARRWALRRKPAAGPAAPEN |
| Ga0210389_103952272 | 3300021404 | Soil | AIAPFAAIVAIAGYVIYRGRRWLIRRRPTARPAAPES |
| Ga0210383_103120942 | 3300021407 | Soil | WTLAFLGAIAPFAAIVAIAGYVIYRGRRWLIRRRPTARPAAPES |
| Ga0242659_10236201 | 3300022522 | Soil | APFAAIAAIAGYAIYRARRWMLRRRPAPRPAAPEN |
| Ga0207707_104608062 | 3300025912 | Corn Rhizosphere | WHALRVTVSWTLAFLGAIAPFAAILAVAGSAAYRGRRWLARRKPAAQGASPES |
| Ga0207660_116903521 | 3300025917 | Corn Rhizosphere | WHALRVAVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPTSPES |
| Ga0207660_117156432 | 3300025917 | Corn Rhizosphere | LGAIAPFAAILAVAGYAAYRGRRWLARRKPAAQGASPES |
| Ga0207664_115924642 | 3300025929 | Agricultural Soil | TVSWTLAFLGAIAPFAAILALAGYAAYRGRRWLARRKPAAPGAAPES |
| Ga0207665_104635961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GWHALRIAVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPTSPES |
| Ga0257146_10164081 | 3300026374 | Soil | LRVAVSWTLAFLGAIAPFAVVLAVAGYVVYRGRRWLARRRPASPES |
| Ga0208099_10088511 | 3300027096 | Forest Soil | AFLGAVAPFAAIAAIAGYTIYRARRWMLRRRPAPRPAAPEN |
| Ga0208097_10211362 | 3300027173 | Forest Soil | VSWTLAFLGAIAPFIAVAAIAGYVIYRGRRRLTRRRPAAPSASPEG |
| Ga0208525_10238862 | 3300027288 | Soil | LRVAVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPAAGPASPES |
| Ga0209461_100892882 | 3300027750 | Agave | LGLALVLKLAVAPFAVVLAVAGYLVYRGRRWLARRRPATGPASPEN |
| Ga0209112_100115705 | 3300027817 | Forest Soil | TLALLGAVAPFAVVLAVAGFGFYRGRRWLARRRAAGSGGSAG |
| Ga0209040_1000297410 | 3300027824 | Bog Forest Soil | VIAPFAAIAAIAGYVIYGSRRRLIRRRPAHPATPEN |
| Ga0209693_101574632 | 3300027855 | Soil | KVSLSWTLAFLGAIAPFAAIAAIAAYAIYRARRWMLRRRPAPRSAAPEN |
| Ga0209624_106746781 | 3300027895 | Forest Soil | KVSLSWTLAFLGAIAPFAAIAAIAGYAIYRARRWMIRRRPGPGPAAPEN |
| Ga0209069_103217762 | 3300027915 | Watersheds | SWTLAFLGAIAPFAAILAIAGYVIYRSRRRLIRRRPTAQPASPES |
| Ga0268266_101542944 | 3300028379 | Switchgrass Rhizosphere | AFLGAIAPFAVVLAVAGYLVYRGRRWLGRRRPATGPASPES |
| Ga0307306_100327461 | 3300028782 | Soil | TLAFLGAIAPFAVVLAVAGYAVYRGRRWLARRRPAAGPASPES |
| Ga0307304_100605221 | 3300028885 | Soil | FLGAIAPFAVVLAVAGYAVYRGRRWLARRRPAAGPASPES |
| Ga0265461_113149581 | 3300030743 | Soil | VAPFAAIVALAGFGFYRARRWALGRKPAARPAAPEN |
| Ga0302326_100705641 | 3300031525 | Palsa | AFRVAVSWTLALLGALAPFAAVAALAGYVIYRGRRWVIRRRPAARPASPES |
| Ga0318516_101052443 | 3300031543 | Soil | SWTLAVLGAIAPFAAILAIAGYVVYRGRRWLIRRRPGPQPVSPES |
| Ga0318534_108480521 | 3300031544 | Soil | VSLSWTLAFIGAIAPFAAIAAIAAFAVYRARRWMIRRRPTPRPAAPEN |
| Ga0318573_102718661 | 3300031564 | Soil | VSLSWTLAFLGAIAPFAAIAAIAAYAIYRARRWMSRRRPAPRPAAPEN |
| Ga0318515_100702834 | 3300031572 | Soil | VTPFVAVAALAGLVVYRGRRWLIHRRPAAGPASPEN |
| Ga0318515_101970751 | 3300031572 | Soil | AIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDR |
| Ga0318574_103981622 | 3300031680 | Soil | AIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDS |
| Ga0318572_100456901 | 3300031681 | Soil | RALRIAVSWTLAFLGAIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDS |
| Ga0318560_107575012 | 3300031682 | Soil | SWILALLGAVAPFAAVAALAGFVVYRGRRWLIRRRPAAGPASPEN |
| Ga0310686_1179901282 | 3300031708 | Soil | ITVSWTLAFLGAVAPFAAVLAVAAFVIYRGRRWVLRRRLAAQPAAPES |
| Ga0318496_101061451 | 3300031713 | Soil | LAFLGAIAPFAAVLAIAGYVVYRGRRWLIRRRPAAEPAAPER |
| Ga0318493_107406542 | 3300031723 | Soil | LRVTVSWTLAFLGAIAPFAVIAAISAYAIYRARRWMIRRRPGSRPAAPQS |
| Ga0318492_102678892 | 3300031748 | Soil | LKVSLSWTLAFLGAIAPFVAIGGIAAYAIYRARRWMIRRRPAPRPAAPEN |
| Ga0318537_101270182 | 3300031763 | Soil | SWTLAFIGAIAPFAAIAAIAAFAVYRARRWMIRRRPTPRPAAPEN |
| Ga0318554_103735381 | 3300031765 | Soil | SWTLAFLGAIAPFAAIGAIAAYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0318509_103413591 | 3300031768 | Soil | SLSWTLAFLGAIAPFAAIGAIAAYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0318509_104715251 | 3300031768 | Soil | LGAIAPFAAIVAIAGYAIYRGRRWILRRRPASRPAAPEN |
| Ga0318526_101034401 | 3300031769 | Soil | SWTLAFLGAIAPFAAIVAIAGYAIYRGRRWILRRRPASRPAAPEN |
| Ga0318546_109876221 | 3300031771 | Soil | IAVSWTLAFLGAIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDR |
| Ga0318566_102649911 | 3300031779 | Soil | AFLGAIAPFAAIAAIAAYAIYRARRWMSRRRPAPRPAAPEN |
| Ga0318566_104060111 | 3300031779 | Soil | LKVSLSWTLAFLGAIAPFAAIGAIAAYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0318547_105604532 | 3300031781 | Soil | SLSWTLAFLGAIAPFAAIAAIAVYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0318548_105024992 | 3300031793 | Soil | LGAIAPFAIVLAVAGYLVYRGRRRLTRRRPAAGPASPDS |
| Ga0318576_100204141 | 3300031796 | Soil | AVAPFAAVAALAGFVVYRGRRWLIRRRPAAGPASPEN |
| Ga0307473_115432142 | 3300031820 | Hardwood Forest Soil | RAFLGAIAPFAVVLAVAGYLVYRGRRWRTGRRPAAGPASPES |
| Ga0318564_100791813 | 3300031831 | Soil | RITVSWTLAFLGAIAPFAVVLAVAGYLVYRGRRRLTRRRPAAGPASPES |
| Ga0318512_101207942 | 3300031846 | Soil | SWTLAFLGAIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDS |
| Ga0318495_100218181 | 3300031860 | Soil | LKVSLSWTLAFLGAIAPFAAIAAIAVYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0318544_103472001 | 3300031880 | Soil | AWTLAFLGAVAPFVAVAALAGLVVYRGRRWLIHRRPAAGPASPEN |
| Ga0306925_113568542 | 3300031890 | Soil | APFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDS |
| Ga0308175_1029822551 | 3300031938 | Soil | VTVSWTLAFLGAIAPFAAILAVARYAAYRGRRWLARRKPAAQGASPES |
| Ga0308174_114005201 | 3300031939 | Soil | VAPFAVVLAIAGYLVYRGRRWLGRRRPATGPASPES |
| Ga0310913_100778613 | 3300031945 | Soil | ITTSWTLAFLGAIAPFAAVLAIAGYVVYRGRRWLIRRRPAAEPAAPER |
| Ga0310913_105945821 | 3300031945 | Soil | TLAFLGAIAPFAVVLAVAGYLVYRGRRRLTRRRPAAGPASPDS |
| Ga0306926_102410393 | 3300031954 | Soil | FLGAIAPFAAIAAIVAYAIYRARRRMIRRRPAPRPAAPES |
| Ga0318569_100544323 | 3300032010 | Soil | TLAFLGAIAPFAIVLAVGGYLVYRGRRWLTRRRPAAGPASPDR |
| Ga0318549_102025722 | 3300032041 | Soil | SWTLAFLGAIAPFAIVLAVAGYLVYRGRRRLTRRRPAAGPASPDS |
| Ga0318558_100628282 | 3300032044 | Soil | VSWILALLGAVAPFAAVAALAGFVVYRGRRWLIRRRPAAGPASPEN |
| Ga0318506_104622982 | 3300032052 | Soil | LKVSLSWTLAFLGAIAPFAAIAAIVAYAIYRARRWMSRRRPAPRPAAPEN |
| Ga0318506_104887072 | 3300032052 | Soil | SWTLAFLGAIAPFAVIAAISAYAIYRARRWMIRRRPGSRPAAPQS |
| Ga0318510_102576471 | 3300032064 | Soil | KVSLSWTLAFLGAIAPFAAIGAIAAYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0318524_106437542 | 3300032067 | Soil | VAPFAAVAALAGFVVYRGRRWLIRRRPAAGPASPEN |
| Ga0318553_100679143 | 3300032068 | Soil | TVAWTLAFLGAVAPFVAVAALAGLVVYRGRRWLIHRRPAAGPASPEN |
| Ga0318553_100749191 | 3300032068 | Soil | WTLAFLGAIAPFAAIAAIVAYAIYRARRRMIRRRPAPRPAAPES |
| Ga0308173_109225091 | 3300032074 | Soil | VTVSWTLAFLGAIAPFAAVLAVAGYAAYRGRRWLARRKPAAQGASPES |
| Ga0306924_100926941 | 3300032076 | Soil | WTLAFIGAIAPFAAIAAIAAFAVYRARRWMIRRRPTPRPAAPEN |
| Ga0318525_100670231 | 3300032089 | Soil | VTVAWILAFVGAIAPFAVILAIAGYVVYRGRRWLIRRRPAAEPAAPER |
| Ga0318525_104610731 | 3300032089 | Soil | SLSWTLAFLGAIAPFAAIAAIVAYAIYRARRRMIRRRPAPRPAAPES |
| Ga0318577_100885191 | 3300032091 | Soil | KVSLSWTLAFLGAIAPFAAIAAIAVYAVYRARRWMIRRRPAPRPAAPEN |
| Ga0335080_117890502 | 3300032828 | Soil | RALRITVSWTLAFLGAIAPFAAIAAIAGYAAYRARRWLSRRKPAAQAASPES |
| Ga0335070_118216582 | 3300032829 | Soil | ITVSWTLAFLGAIAPFAIVLAVAGYLVYRGRRRLTRRRPAAGPASPDS |
| Ga0335075_102002871 | 3300032896 | Soil | KVTVSWALAFLGAIAPFAAIAAIAGYGIYRTRRWMIRRRRAPGPAAPEN |
| Ga0335071_118118771 | 3300032897 | Soil | VSWTLAFLGAIAPFAIVLAVAGYLVYRGRRRLTRRRPAAGPASPDS |
| Ga0335083_101190381 | 3300032954 | Soil | FLGAIAPFAAILAVAGYLVYRGRRWLIRRRPARQTTAPES |
| Ga0335073_110710302 | 3300033134 | Soil | LRVTMSWTLAVLGAIAPFAAILAVAGYLVYRGRRRLIRRKPAALPEAPES |
| Ga0335077_105595951 | 3300033158 | Soil | VSWTLAFLGAIAPFAAVLAVAGFVIYHGRRWLARRRPAAGPAAPER |
| Ga0370483_0181968_592_711 | 3300034124 | Untreated Peat Soil | LGAVAPFVAIAVIAGYAIYRARRWMLRRKPASRPAAPEN |
| Ga0373959_0118162_539_646 | 3300034820 | Rhizosphere Soil | APFAVVLAVAGYVVYRGRRWLNRRRPAAGPATPES |
| ⦗Top⦘ |