| Basic Information | |
|---|---|
| Family ID | F048252 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKD |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 98.65 % |
| % of genes near scaffold ends (potentially truncated) | 96.62 % |
| % of genes from short scaffolds (< 2000 bps) | 91.89 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (54.730 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (19.595 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.568 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.108 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.95 % |
| Unclassified | root | N/A | 29.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02HCB3S | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300000929|NpDRAFT_10053611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2792 | Open in IMG/M |
| 3300001839|RCM40_1060075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300001850|RCM37_1027347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300002161|JGI24766J26685_10103782 | Not Available | 604 | Open in IMG/M |
| 3300002835|B570J40625_101541725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300004112|Ga0065166_10428206 | Not Available | 555 | Open in IMG/M |
| 3300004124|Ga0066178_10121622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300004124|Ga0066178_10163691 | Not Available | 630 | Open in IMG/M |
| 3300005525|Ga0068877_10381714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300005527|Ga0068876_10779396 | Not Available | 506 | Open in IMG/M |
| 3300005585|Ga0049084_10145103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300005662|Ga0078894_10187059 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300005662|Ga0078894_11577002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300005662|Ga0078894_11595930 | Not Available | 538 | Open in IMG/M |
| 3300005662|Ga0078894_11733636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300006641|Ga0075471_10329371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300006917|Ga0075472_10281754 | Not Available | 819 | Open in IMG/M |
| 3300006917|Ga0075472_10712858 | Not Available | 506 | Open in IMG/M |
| 3300007162|Ga0079300_10036321 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300007538|Ga0099851_1105025 | Not Available | 1074 | Open in IMG/M |
| 3300007546|Ga0102874_1165526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300007546|Ga0102874_1252068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300007553|Ga0102819_1072386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300007555|Ga0102817_1043301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300007560|Ga0102913_1110458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300007585|Ga0102916_1174997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300007600|Ga0102920_1024076 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
| 3300007624|Ga0102878_1152582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300007627|Ga0102869_1111943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300007630|Ga0102903_1204566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300007632|Ga0102894_1210123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300007637|Ga0102906_1128086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300007649|Ga0102912_1039842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300007651|Ga0102900_1030903 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300007665|Ga0102908_1129756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300007670|Ga0102862_1040244 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| 3300008107|Ga0114340_1024723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7373 | Open in IMG/M |
| 3300008107|Ga0114340_1045875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1935 | Open in IMG/M |
| 3300008107|Ga0114340_1157024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300008110|Ga0114343_1226013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300008113|Ga0114346_1235712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300008116|Ga0114350_1025460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3582 | Open in IMG/M |
| 3300008116|Ga0114350_1143479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300008116|Ga0114350_1159540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300008117|Ga0114351_1318863 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300008120|Ga0114355_1220968 | Not Available | 586 | Open in IMG/M |
| 3300008261|Ga0114336_1189111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300008262|Ga0114337_1031862 | All Organisms → Viruses → Predicted Viral | 3001 | Open in IMG/M |
| 3300008262|Ga0114337_1226125 | Not Available | 738 | Open in IMG/M |
| 3300008962|Ga0104242_1058751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300009049|Ga0102911_1147278 | Not Available | 668 | Open in IMG/M |
| 3300009059|Ga0102830_1175707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300009079|Ga0102814_10174735 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300009080|Ga0102815_10656166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300009152|Ga0114980_10048830 | Not Available | 2570 | Open in IMG/M |
| 3300009158|Ga0114977_10584741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300009183|Ga0114974_10564872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300009419|Ga0114982_1038419 | All Organisms → Viruses → Predicted Viral | 1535 | Open in IMG/M |
| 3300010354|Ga0129333_10118151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2444 | Open in IMG/M |
| 3300010354|Ga0129333_10755392 | Not Available | 832 | Open in IMG/M |
| 3300010354|Ga0129333_11412140 | Not Available | 572 | Open in IMG/M |
| 3300010885|Ga0133913_11921320 | All Organisms → Viruses → Predicted Viral | 1474 | Open in IMG/M |
| 3300010885|Ga0133913_11962768 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300011011|Ga0139556_1032525 | Not Available | 765 | Open in IMG/M |
| 3300011011|Ga0139556_1038592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300012006|Ga0119955_1059792 | Not Available | 1158 | Open in IMG/M |
| 3300012779|Ga0138284_1060432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300013005|Ga0164292_10656666 | Not Available | 673 | Open in IMG/M |
| 3300013092|Ga0163199_1127929 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10150480 | Not Available | 1538 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10588419 | Not Available | 599 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10476141 | Not Available | 764 | Open in IMG/M |
| 3300013372|Ga0177922_10838235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300013372|Ga0177922_10991146 | Not Available | 641 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10678005 | Not Available | 559 | Open in IMG/M |
| 3300014819|Ga0119954_1018333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1439 | Open in IMG/M |
| 3300017774|Ga0181358_1104725 | Not Available | 1010 | Open in IMG/M |
| 3300017785|Ga0181355_1208299 | Not Available | 765 | Open in IMG/M |
| 3300019784|Ga0181359_1260262 | Not Available | 521 | Open in IMG/M |
| 3300020161|Ga0211726_10545114 | Not Available | 745 | Open in IMG/M |
| 3300020161|Ga0211726_11021858 | Not Available | 719 | Open in IMG/M |
| 3300020190|Ga0194118_10560063 | Not Available | 532 | Open in IMG/M |
| 3300020205|Ga0211731_11482374 | Not Available | 605 | Open in IMG/M |
| 3300020549|Ga0207942_1022694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300020553|Ga0208855_1031656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300020554|Ga0208599_1020552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300020569|Ga0208229_1053732 | Not Available | 570 | Open in IMG/M |
| 3300021961|Ga0222714_10478607 | Not Available | 643 | Open in IMG/M |
| 3300021962|Ga0222713_10032004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Gaiavirus → Mycobacterium virus Gaia | 4227 | Open in IMG/M |
| 3300021962|Ga0222713_10037868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3801 | Open in IMG/M |
| 3300021962|Ga0222713_10074056 | All Organisms → Viruses → Predicted Viral | 2506 | Open in IMG/M |
| 3300021962|Ga0222713_10390348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300022198|Ga0196905_1026857 | All Organisms → Viruses → Predicted Viral | 1757 | Open in IMG/M |
| 3300023179|Ga0214923_10581682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300024289|Ga0255147_1086852 | Not Available | 581 | Open in IMG/M |
| 3300024346|Ga0244775_11540096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300024348|Ga0244776_10647859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300024348|Ga0244776_10706515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300024352|Ga0255142_1003773 | All Organisms → Viruses → Predicted Viral | 2631 | Open in IMG/M |
| 3300024352|Ga0255142_1040689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300024480|Ga0255223_1016973 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300024570|Ga0255276_1193690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300024571|Ga0256302_1122036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300024865|Ga0256340_1029718 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
| 3300025585|Ga0208546_1102736 | Not Available | 639 | Open in IMG/M |
| 3300026478|Ga0255156_1088169 | Not Available | 547 | Open in IMG/M |
| 3300027121|Ga0255074_1027452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300027142|Ga0255065_1059757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300027212|Ga0208554_1067595 | Not Available | 554 | Open in IMG/M |
| 3300027223|Ga0208169_1010630 | All Organisms → Viruses → Predicted Viral | 1809 | Open in IMG/M |
| 3300027231|Ga0208172_1017768 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300027244|Ga0208173_1018822 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300027247|Ga0208679_1017008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1521 | Open in IMG/M |
| 3300027258|Ga0208558_1051218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300027418|Ga0208022_1011727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2113 | Open in IMG/M |
| 3300027621|Ga0208951_1046548 | Not Available | 1275 | Open in IMG/M |
| 3300027621|Ga0208951_1082844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300027627|Ga0208942_1115959 | Not Available | 748 | Open in IMG/M |
| 3300027644|Ga0209356_1199947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300027649|Ga0208960_1176326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300027759|Ga0209296_1166919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300027769|Ga0209770_10040913 | All Organisms → Viruses → Predicted Viral | 1992 | Open in IMG/M |
| 3300027772|Ga0209768_10358316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300027793|Ga0209972_10388952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300027804|Ga0209358_10406062 | Not Available | 641 | Open in IMG/M |
| 3300027804|Ga0209358_10453257 | Not Available | 593 | Open in IMG/M |
| 3300027805|Ga0209229_10289189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300027805|Ga0209229_10343495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300027816|Ga0209990_10186780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
| 3300028073|Ga0255180_1079562 | Not Available | 599 | Open in IMG/M |
| 3300028103|Ga0255172_1046437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300028265|Ga0255197_1053313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300031784|Ga0315899_10302351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1582 | Open in IMG/M |
| 3300031857|Ga0315909_10566419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300031857|Ga0315909_10613159 | Not Available | 724 | Open in IMG/M |
| 3300031857|Ga0315909_10892379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300031963|Ga0315901_10791994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300033978|Ga0334977_0356452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300033992|Ga0334992_0304409 | Not Available | 746 | Open in IMG/M |
| 3300033992|Ga0334992_0413255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300034051|Ga0335024_0544964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300034061|Ga0334987_0619774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300034066|Ga0335019_0292585 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300034073|Ga0310130_0033855 | Not Available | 1565 | Open in IMG/M |
| 3300034092|Ga0335010_0046912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 3138 | Open in IMG/M |
| 3300034103|Ga0335030_0423496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300034107|Ga0335037_0096792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1602 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 19.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.81% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.78% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.73% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.05% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.70% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.03% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.35% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.35% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.68% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.68% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027223 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027258 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028265 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_14121250 | 2035265000 | Freshwater | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAENVCER |
| NpDRAFT_100536115 | 3300000929 | Freshwater And Marine | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEM |
| RCM40_10600751 | 3300001839 | Marine Plankton | MMTRKDYIATAEILKYASTKTHPAVFSKMVVDFAVMFA |
| RCM37_10273471 | 3300001850 | Marine Plankton | MMTRKDYIATAEILKYASDKTHPALFSKMVLDFAVMFAKDNP |
| JGI24766J26685_101037821 | 3300002161 | Freshwater And Sediment | MMTRKDYIATAEILKYVSDKTHPAVFSKMVVDFAEMFAKDN |
| B570J40625_1015417253 | 3300002835 | Freshwater | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVDN |
| Ga0065166_104282063 | 3300004112 | Freshwater Lake | MMTRKDYVAVAEILKYASNKTHPAVFSKMVNDFAEMFAKDNERFD |
| Ga0066178_101216224 | 3300004124 | Freshwater Lake | MMTRKDYVATAEILKYASNKTHPALFSKIVNDFAEMFAKDN |
| Ga0066178_101636911 | 3300004124 | Freshwater Lake | MMTRKDYIATAEIMKYISDKIHPAVFSKTVHDFAEMFAKDNE |
| Ga0068877_103817144 | 3300005525 | Freshwater Lake | MMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEMFAKDN |
| Ga0068876_107793961 | 3300005527 | Freshwater Lake | MMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAKD |
| Ga0049084_101451031 | 3300005585 | Freshwater Lentic | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMF |
| Ga0078894_101870599 | 3300005662 | Freshwater Lake | MMTRKDYIATAEILKYVSNKTHPAVFSKMVNDFAEMFAKDNE |
| Ga0078894_115770021 | 3300005662 | Freshwater Lake | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNDRF |
| Ga0078894_115959304 | 3300005662 | Freshwater Lake | MMTRKDYIATAEILKYASNKTHPALFSKMVNDFAQMFAV |
| Ga0078894_117336361 | 3300005662 | Freshwater Lake | MMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAK |
| Ga0075471_103293711 | 3300006641 | Aqueous | MMTRKDYIATAEILKYVSDKTHPAVFSKMVVDFAEMF |
| Ga0075472_102817541 | 3300006917 | Aqueous | MMTRKDYVATAEILRYVSDKTHPAIFSKMVVDFALMFAKDNPKFDAN |
| Ga0075472_107128584 | 3300006917 | Aqueous | MTRKDYVATAEILRYASDKTHPALFSKMVVDFALM |
| Ga0079300_100363211 | 3300007162 | Deep Subsurface | MMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFAKDNE |
| Ga0099851_11050254 | 3300007538 | Aqueous | MMTRKDYIKTAEILKYVSDKTHPAVFSKMVNDFAE |
| Ga0102874_11655261 | 3300007546 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMF |
| Ga0102874_12520683 | 3300007546 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAVDN |
| Ga0102819_10723863 | 3300007553 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAE |
| Ga0102817_10433013 | 3300007555 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAVDNERFDVK |
| Ga0102913_11104584 | 3300007560 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAE |
| Ga0102916_11749974 | 3300007585 | Estuarine | MMTRKDYVATAEILKFASDKTHPALFSKIVNDFAEMFAKDNER |
| Ga0102920_10240767 | 3300007600 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVD |
| Ga0102878_11525821 | 3300007624 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNERFD |
| Ga0102869_11119433 | 3300007627 | Estuarine | MMTRKDYVATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERF |
| Ga0102903_12045661 | 3300007630 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAVDNERFDVKR |
| Ga0102894_12101231 | 3300007632 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVDNPR |
| Ga0102906_11280864 | 3300007637 | Estuarine | MTMTRKHFEAIAEILNYNSNKTHPAVFSKMVLDFAE |
| Ga0102912_10398421 | 3300007649 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAKDNERFDVN |
| Ga0102900_10309037 | 3300007651 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKD |
| Ga0102908_11297561 | 3300007665 | Estuarine | MMTRKDYVATAEILKYASDKTHPVLFSKIVNDFAQMFAVDN |
| Ga0102862_10402441 | 3300007670 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAKDN |
| Ga0114340_10247231 | 3300008107 | Freshwater, Plankton | MMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMF |
| Ga0114340_10458758 | 3300008107 | Freshwater, Plankton | MMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFA |
| Ga0114340_11570246 | 3300008107 | Freshwater, Plankton | MMTRKDYVATAEILNYLSNKVHPAVFSKTVHDFAEMFAKDN |
| Ga0114343_12260131 | 3300008110 | Freshwater, Plankton | MMTRKDYISTAEILKYASNKTHPALFSKMVNDFAEM |
| Ga0114346_12357125 | 3300008113 | Freshwater, Plankton | MMTRKDYVATAEILNYMSTKTHPAVFSKVVTDFAE |
| Ga0114350_10254601 | 3300008116 | Freshwater, Plankton | MMTRKDYIATAEILRYVSDKTHPAVFSKMVNDFAEMFAKDN |
| Ga0114350_11434791 | 3300008116 | Freshwater, Plankton | MMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFA |
| Ga0114350_11595404 | 3300008116 | Freshwater, Plankton | MMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFAK |
| Ga0114351_13188633 | 3300008117 | Freshwater, Plankton | MMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAWL* |
| Ga0114355_12209684 | 3300008120 | Freshwater, Plankton | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNPRFDV |
| Ga0114336_11891111 | 3300008261 | Freshwater, Plankton | MMTRKDYVATAEILKYVSDKTHPAVFSKMVNDFAEMFAKDNE |
| Ga0114337_103186212 | 3300008262 | Freshwater, Plankton | MMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEMFAKDNP |
| Ga0114337_12261255 | 3300008262 | Freshwater, Plankton | MMTRKDYVATAEILNYVSDKTHPAVFSKMVHDFAEMFAKD |
| Ga0104242_10587514 | 3300008962 | Freshwater | MTMTRKHFEAIAEILNYNANKTHPAVFSKMVLDFSELCAKE |
| Ga0102911_11472785 | 3300009049 | Estuarine | MMTRKHFEATAEILKFASDKTHPAVFSKMVNDFALIFAKENPN |
| Ga0102830_11757072 | 3300009059 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNP |
| Ga0102814_101747356 | 3300009079 | Estuarine | MMTRKDYVATAEILKYVSNKTHPAVFSKMVNDFAEMFAV |
| Ga0102815_106561664 | 3300009080 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAK |
| Ga0114980_100488301 | 3300009152 | Freshwater Lake | MTRKDYEATAEILKFMSDKVHPAVFSKVVNDFALIY |
| Ga0114977_105847411 | 3300009158 | Freshwater Lake | MMTRKDYVATAEILKYASNKTHPAVFSKIVNDFAEMFAVDNERF |
| Ga0114974_105648723 | 3300009183 | Freshwater Lake | MMTRKDYVATAEILNYVSNKTHPAVFSKMVNDFAEMFALDN |
| Ga0114982_10384191 | 3300009419 | Deep Subsurface | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAQMFAVD |
| Ga0129333_101181511 | 3300010354 | Freshwater To Marine Saline Gradient | MMTRKDYVATAEILRYASDKTHPALFSKMVVDFALM |
| Ga0129333_107553925 | 3300010354 | Freshwater To Marine Saline Gradient | MMTRKDYVATAEILRYASDKTHPALFSKMVVDFALMFAKDN |
| Ga0129333_114121401 | 3300010354 | Freshwater To Marine Saline Gradient | MMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAKDN |
| Ga0133913_119213201 | 3300010885 | Freshwater Lake | MMTRKDYIATAEILKYISNKTHPAVFSKTVHDFAEMFAKDNERF |
| Ga0133913_119627681 | 3300010885 | Freshwater Lake | MMTRKDYVATAEILNYASNKTHPALFSKMVNDFAEMFAKDN |
| Ga0139556_10325254 | 3300011011 | Freshwater | MMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAKD |
| Ga0139556_10385925 | 3300011011 | Freshwater | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFA |
| Ga0119955_10597926 | 3300012006 | Freshwater | MMTRKDYVATAEILKYLSNKTHPAVFSKTVHDFAE |
| Ga0138284_10604325 | 3300012779 | Freshwater Lake | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFAVDNE |
| Ga0164292_106566664 | 3300013005 | Freshwater | MMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFAKDNERFDVK |
| Ga0163199_11279291 | 3300013092 | Freshwater | MMTRKDYIAVAEILNYASDKTHPALFSKIVNDFAEMFAKDNERFDITRFHK |
| (restricted) Ga0172367_101504808 | 3300013126 | Freshwater | MKTKKDYIATAKILKYVSDKTHPAVFSKMVNDFAEMFAK |
| (restricted) Ga0172367_105884194 | 3300013126 | Freshwater | MMTRKDYVATAEILRYVSDKTHPAVFSKMVNDFAEMFAKD |
| (restricted) Ga0172373_104761414 | 3300013131 | Freshwater | MRKNNYWTNTAEILRYVSDKTHPAVFSKMVNDFAEMFAKDNP |
| Ga0177922_108382351 | 3300013372 | Freshwater | MMTRKDYVAVAEILKYASDKTHPALFSKMVNDFAEMFAKDNERF |
| Ga0177922_109911464 | 3300013372 | Freshwater | MMTRKDYIATAEILKYISNKTHPAVFSKTVHDFAEMFAKDN |
| (restricted) Ga0172376_106780053 | 3300014720 | Freshwater | MMTRKDYVETARILAYVSDKTHPAVFSKMVNDFAEMFAKD |
| Ga0119954_10183334 | 3300014819 | Freshwater | MMTRKDYIATAEIMKYVSDKTHPALFSKVIVDFALMFAKDNPXXXXIL* |
| Ga0181358_11047253 | 3300017774 | Freshwater Lake | MMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAKDNERFD |
| Ga0181355_12082995 | 3300017785 | Freshwater Lake | MMTRKDYIATAEILKYVSNKTHPAVFSKMVHDFAEMFA |
| Ga0181359_12602623 | 3300019784 | Freshwater Lake | MTRKDYISTAEILKYQSNKIHPAVFSKVVNDFAEMFAKDNPR |
| Ga0211726_105451141 | 3300020161 | Freshwater | MMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMF |
| Ga0211726_110218585 | 3300020161 | Freshwater | MMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFA |
| Ga0194118_105600631 | 3300020190 | Freshwater Lake | MMTKKHYIETAKILKYVSDKTHPAVFSKMVNDFAEMFAKDNPRFD |
| Ga0211731_114823743 | 3300020205 | Freshwater | MMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERFD |
| Ga0207942_10226944 | 3300020549 | Freshwater | MMTRKDYVAVAEILNFASDKAHPALFSKIVNDFAVMFAKDNERFDVNRF |
| Ga0208855_10316561 | 3300020553 | Freshwater | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFAI |
| Ga0208599_10205521 | 3300020554 | Freshwater | MMTRKDYVATAEILKYASNKTHPAVFSKMVNDFAEMFAKDNERFD |
| Ga0208229_10537323 | 3300020569 | Freshwater | MMTRKDYVAVAEILKYASTKTHPALFSKMVNDFAEMFAKDN |
| Ga0222714_104786074 | 3300021961 | Estuarine Water | MMTRKDYVATAEILKYASDKTHPAVFSKMVNDFAEMFAKDNERFDVNR |
| Ga0222713_1003200416 | 3300021962 | Estuarine Water | MMTRKDYVATAEILKYASNKTHPALFSKIVNDFAEMFAKDNP |
| Ga0222713_100378681 | 3300021962 | Estuarine Water | MMTRKDYVATAEILRYASDKTHPALFSKIVNDFAEMFAKDN |
| Ga0222713_1007405612 | 3300021962 | Estuarine Water | MMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAK |
| Ga0222713_103903485 | 3300021962 | Estuarine Water | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFAIDNER |
| Ga0196905_10268576 | 3300022198 | Aqueous | MMTRKDYIKTAEILKYVSDKTHPAVFSKMVNDFAEMFAKDNDRFD |
| Ga0214923_105816823 | 3300023179 | Freshwater | MMTRKDYVATAEILKYLSNKTHPAVFSKTVHDFAEMFAKDNE |
| Ga0255147_10868521 | 3300024289 | Freshwater | MMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFAKDNPN |
| Ga0244775_115400963 | 3300024346 | Estuarine | MMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEMFAKDNERFDV |
| Ga0244776_106478593 | 3300024348 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEM |
| Ga0244776_107065154 | 3300024348 | Estuarine | MMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAV |
| Ga0255142_100377310 | 3300024352 | Freshwater | MMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFARD |
| Ga0255142_10406894 | 3300024352 | Freshwater | MMTRKDYIATAEILNYVSDKTHPAVFSKMVIDFAEMF |
| Ga0255223_10169731 | 3300024480 | Freshwater | MMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAIDN |
| Ga0255276_11936903 | 3300024570 | Freshwater | MMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEM |
| Ga0256302_11220364 | 3300024571 | Freshwater | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNPRF |
| Ga0256340_10297186 | 3300024865 | Freshwater | MMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFARDNERFDAT |
| Ga0208546_11027361 | 3300025585 | Aqueous | MMTRKDYVATAEILRYVSDKTHPAIFSKMVVDFAL |
| Ga0255156_10881691 | 3300026478 | Freshwater | MMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFA |
| Ga0255074_10274524 | 3300027121 | Freshwater | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNPR |
| Ga0255065_10597574 | 3300027142 | Freshwater | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEM |
| Ga0208554_10675952 | 3300027212 | Estuarine | MMTRKDYIATAEILKYVSDKIHPAVFSKTVHDFAEMFAKDNERFAV |
| Ga0208169_10106301 | 3300027223 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNER |
| Ga0208172_10177681 | 3300027231 | Estuarine | MMTRKDYVATAEILKFASDKTHPALFSKIVNDFAE |
| Ga0208173_10188221 | 3300027244 | Estuarine | MMTRKDYVATAEILKFASDKTHPAVFSKIVNDFAEMFAKDNERFDVIRFHE |
| Ga0208679_10170081 | 3300027247 | Estuarine | MMTRKDYVATAEILKFASDKTHPAVFSKIVNDFAEMFAKDNE |
| Ga0208558_10512184 | 3300027258 | Estuarine | MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNERFDV |
| Ga0208022_101172711 | 3300027418 | Estuarine | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEML |
| Ga0208951_10465481 | 3300027621 | Freshwater Lentic | MMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAKDNE |
| Ga0208951_10828447 | 3300027621 | Freshwater Lentic | MMTRKDYIATAEILKYASDKTHPALFSKIVNDFAE |
| Ga0208942_11159594 | 3300027627 | Freshwater Lentic | MMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAK |
| Ga0209356_11999471 | 3300027644 | Freshwater Lake | MMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFA |
| Ga0208960_11763262 | 3300027649 | Freshwater Lentic | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVDNPRF |
| Ga0209296_11669191 | 3300027759 | Freshwater Lake | MMTRKDYIATAEIMKYISDKSHPALFSKVIVDFALMFAKDNPKFDA |
| Ga0209770_100409131 | 3300027769 | Freshwater Lake | MMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAKDNPR |
| Ga0209768_103583164 | 3300027772 | Freshwater Lake | MMTRKDYVAVAEILNFASDKTHPAIFSKMVNDFAVMFAKDNDRF |
| Ga0209972_103889524 | 3300027793 | Freshwater Lake | MMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAKDNPRF |
| Ga0209358_104060624 | 3300027804 | Freshwater Lake | MTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMF |
| Ga0209358_104532574 | 3300027804 | Freshwater Lake | MTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFA |
| Ga0209229_102891891 | 3300027805 | Freshwater And Sediment | MMTRKDYVSTAEILKYASDKTHPALFSKIVNDFAEMF |
| Ga0209229_103434951 | 3300027805 | Freshwater And Sediment | MMTRKDYVSTAEILKYASNKTHPALFSKMVNDFAE |
| Ga0209990_101867801 | 3300027816 | Freshwater Lake | MMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERFDVK |
| Ga0255180_10795623 | 3300028073 | Freshwater | MMTRKDYVSTAEILRYTSDKIHPAVFSKIVVDFENT |
| Ga0255172_10464371 | 3300028103 | Freshwater | MTRKDYVETAKILAYVSDKTHPAVFSKMVVDFAEMFAK |
| Ga0255197_10533132 | 3300028265 | Freshwater | MMTRKDYVATAEILKFASDKTHPALFSKMVNDFAEMFAKDNDR |
| Ga0315899_103023511 | 3300031784 | Freshwater | MMTRKDYISTAEILKYASNKTHPALFSKMVNDFAEMFAKDNE |
| Ga0315909_105664191 | 3300031857 | Freshwater | MMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERFDV |
| Ga0315909_106131595 | 3300031857 | Freshwater | MTRKDYIATAEILKYASNKTHPALFSKMVNDFAEM |
| Ga0315909_108923791 | 3300031857 | Freshwater | MMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAKDNP |
| Ga0315901_107919943 | 3300031963 | Freshwater | MMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMF |
| Ga0334977_0356452_568_690 | 3300033978 | Freshwater | MMTRKDYVAVAEILKFASDKAHPALFSKMVNDFAEMFAKDN |
| Ga0334992_0304409_626_745 | 3300033992 | Freshwater | MTRKDYQATAEILKFMSDKVHPAVFSKVVNDFALIYAKDN |
| Ga0334992_0413255_469_603 | 3300033992 | Freshwater | MMTRKDYVATAEILKFASDKTHPALFSKIVNDFAEMFAKDNERFD |
| Ga0335024_0544964_1_114 | 3300034051 | Freshwater | MMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFA |
| Ga0334987_0619774_1_123 | 3300034061 | Freshwater | MMTRKDYIATAEILKYASTKTHPALFSKMVNDFAEMFAKDN |
| Ga0335019_0292585_896_1024 | 3300034066 | Freshwater | MMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFAKDNER |
| Ga0310130_0033855_1453_1563 | 3300034073 | Fracking Water | MMTRKDYVETARILAYVSDKTHPAVFSKMVNDFAEMF |
| Ga0335010_0046912_2_109 | 3300034092 | Freshwater | MMTRKDYIATAEILKYQSNKIHPAVFSKVVNDFAEM |
| Ga0335030_0423496_3_122 | 3300034103 | Freshwater | MMTRKDYIATAEILKYASTKTHPALFSKMVNDFAEMFAKD |
| Ga0335037_0096792_1_114 | 3300034107 | Freshwater | MMTRKDYVAVAEILKYASDKTHPALFSKIVNDFAEMFA |
| ⦗Top⦘ |