Basic Information | |
---|---|
Family ID | F048214 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 148 |
Average Sequence Length | 44 residues |
Representative Sequence | MSGAGSFFVRWRVRLGYPLAIAVLWFSRPTPRNILLGALAG |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.65 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 85.14 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.703 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.054 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.649 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF01075 | Glyco_transf_9 | 85.81 |
PF00294 | PfkB | 5.41 |
PF01467 | CTP_transf_like | 5.41 |
PF13242 | Hydrolase_like | 2.70 |
PF00092 | VWA | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 85.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100482789 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300001545|JGI12630J15595_10009933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2052 | Open in IMG/M |
3300001593|JGI12635J15846_10317082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
3300002910|JGI25615J43890_1084475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300005166|Ga0066674_10566333 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005176|Ga0066679_10229792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
3300005186|Ga0066676_10947522 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005332|Ga0066388_107872213 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005340|Ga0070689_101895832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300005529|Ga0070741_10265303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
3300005536|Ga0070697_100392136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
3300005541|Ga0070733_10136300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
3300005545|Ga0070695_100877095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
3300005557|Ga0066704_10075406 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
3300005610|Ga0070763_10805857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300005995|Ga0066790_10053057 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
3300006032|Ga0066696_10145743 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300006791|Ga0066653_10324474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300006796|Ga0066665_10375978 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300006806|Ga0079220_10888831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300006904|Ga0075424_100987784 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300007265|Ga0099794_10006209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4825 | Open in IMG/M |
3300007265|Ga0099794_10731391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300007788|Ga0099795_10141565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300009038|Ga0099829_11229815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300009088|Ga0099830_10049683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 2953 | Open in IMG/M |
3300009089|Ga0099828_11418628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300009090|Ga0099827_10133566 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300009177|Ga0105248_10289120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1846 | Open in IMG/M |
3300009524|Ga0116225_1509397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300010046|Ga0126384_12136679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300010335|Ga0134063_10718365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300010343|Ga0074044_11137473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300010358|Ga0126370_12519264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300010360|Ga0126372_10763931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
3300010361|Ga0126378_12629789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300010866|Ga0126344_1448238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300011269|Ga0137392_10221351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
3300011269|Ga0137392_10572215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
3300011269|Ga0137392_11423856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300011270|Ga0137391_10200777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1734 | Open in IMG/M |
3300012189|Ga0137388_11049697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300012203|Ga0137399_11774260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300012208|Ga0137376_10311639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
3300012209|Ga0137379_10394691 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300012211|Ga0137377_10143765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2283 | Open in IMG/M |
3300012361|Ga0137360_11162626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300012363|Ga0137390_10259025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
3300012363|Ga0137390_10369974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
3300012363|Ga0137390_10745306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300012582|Ga0137358_10037910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3184 | Open in IMG/M |
3300012582|Ga0137358_10799358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300012683|Ga0137398_10331984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
3300012683|Ga0137398_11156269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300012924|Ga0137413_10494907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300012924|Ga0137413_10722306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300012925|Ga0137419_11611934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300012929|Ga0137404_11550770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300012930|Ga0137407_12035291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300012975|Ga0134110_10456968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300013308|Ga0157375_12647490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300014658|Ga0181519_10615709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300015053|Ga0137405_1249593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
3300015053|Ga0137405_1261221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2350 | Open in IMG/M |
3300015054|Ga0137420_1064682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300015054|Ga0137420_1278733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300015242|Ga0137412_10080954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2642 | Open in IMG/M |
3300016319|Ga0182033_10146799 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300016445|Ga0182038_11539322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300016445|Ga0182038_11598078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300017654|Ga0134069_1227631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300017822|Ga0187802_10335774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300017932|Ga0187814_10043365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
3300017936|Ga0187821_10358798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300018006|Ga0187804_10219924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300018062|Ga0187784_10684679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
3300018086|Ga0187769_10198648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1483 | Open in IMG/M |
3300018468|Ga0066662_10023381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3520 | Open in IMG/M |
3300018468|Ga0066662_10438206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300018468|Ga0066662_10515182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300019788|Ga0182028_1468848 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300020150|Ga0187768_1127742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300020170|Ga0179594_10145959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
3300020580|Ga0210403_10553142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300020581|Ga0210399_10720811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300020581|Ga0210399_11161269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300020583|Ga0210401_10554720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
3300020583|Ga0210401_11605994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300021088|Ga0210404_10640526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300021170|Ga0210400_10054152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3125 | Open in IMG/M |
3300021406|Ga0210386_10125520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2127 | Open in IMG/M |
3300021406|Ga0210386_10432050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
3300021420|Ga0210394_10369321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
3300021432|Ga0210384_11170024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300021559|Ga0210409_10252348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
3300021559|Ga0210409_10423661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300024330|Ga0137417_1075469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300025906|Ga0207699_10145280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
3300025939|Ga0207665_10361480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
3300026285|Ga0209438_1027904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1880 | Open in IMG/M |
3300026309|Ga0209055_1245058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300026328|Ga0209802_1052012 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
3300026356|Ga0257150_1031723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
3300026359|Ga0257163_1017526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
3300026377|Ga0257171_1003300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2425 | Open in IMG/M |
3300026499|Ga0257181_1042705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300026538|Ga0209056_10108208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2244 | Open in IMG/M |
3300026551|Ga0209648_10101492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2356 | Open in IMG/M |
3300027070|Ga0208365_1043440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300027512|Ga0209179_1043600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300027591|Ga0209733_1136048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300027651|Ga0209217_1149367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300027663|Ga0208990_1186375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300027671|Ga0209588_1008290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3077 | Open in IMG/M |
3300027738|Ga0208989_10143417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300027765|Ga0209073_10175178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300027795|Ga0209139_10191691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300027846|Ga0209180_10417238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300027855|Ga0209693_10233287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300027862|Ga0209701_10101981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1793 | Open in IMG/M |
3300027867|Ga0209167_10025282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2834 | Open in IMG/M |
3300027903|Ga0209488_10732278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300027911|Ga0209698_10018268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6735 | Open in IMG/M |
3300028047|Ga0209526_10089066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2172 | Open in IMG/M |
3300028746|Ga0302233_10411674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300028906|Ga0308309_10907925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300031682|Ga0318560_10263258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300031718|Ga0307474_10776931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300031723|Ga0318493_10383861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300031769|Ga0318526_10322122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300031820|Ga0307473_10000818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7652 | Open in IMG/M |
3300031820|Ga0307473_11311095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300031820|Ga0307473_11517160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300031897|Ga0318520_10974421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300031946|Ga0310910_10350649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
3300031954|Ga0306926_12357247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300031962|Ga0307479_10865045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300031962|Ga0307479_11852783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300031962|Ga0307479_11926127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300032063|Ga0318504_10127680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
3300032205|Ga0307472_100359351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
3300032205|Ga0307472_101216061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300032421|Ga0310812_10397773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300032783|Ga0335079_10685953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300032783|Ga0335079_10990153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
3300032805|Ga0335078_10016076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11105 | Open in IMG/M |
3300033289|Ga0310914_10886433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300034091|Ga0326724_0243880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.05% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.03% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.03% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.35% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.68% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.68% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.68% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1004827893 | 3300000364 | Soil | VTAADFFARWRVRLGYLLAIVVLFLARPTFHSILLGAAVGFVG |
JGI12630J15595_100099331 | 3300001545 | Forest Soil | VRAAAFFARWRVRLGYPLAAVVLWLGRPSPKSILAGAVIG |
JGI12635J15846_103170822 | 3300001593 | Forest Soil | MTAPAFFARWRVRLGYPVALVVLFLARPTPGSILAGA |
JGI25615J43890_10844751 | 3300002910 | Grasslands Soil | VNAASIFFVRWRVRLGYPLAIAVLWFARPNPLSILVGAVL |
Ga0066674_105663331 | 3300005166 | Soil | MSGVGNFFVRWRVRLGYPLAIAVLGFSRPTPGSILLGALAGAVGLSVRAYAAGYLHKQEV |
Ga0066679_102297922 | 3300005176 | Soil | MNAAGNFFVRWRVRLGYPLAIAVLYLSRPTPRSIFLGAMVGVI |
Ga0066676_109475221 | 3300005186 | Soil | MSATGSFFVRWRVRLGYPLAIAVLYFSRPTPRSIVLGALVGVIGLWVRAYAAG |
Ga0066388_1078722131 | 3300005332 | Tropical Forest Soil | MSIPGEFFIRWRVRLGYPLAAVVLWFSWPSPRSVLLGGLVGAFGLGLRAYAAGYLHKHEA |
Ga0070689_1018958321 | 3300005340 | Switchgrass Rhizosphere | MSDAAAWFARWRVRLGYLLAIFVLWFARPTARSVVCGALVGLLG |
Ga0070741_102653031 | 3300005529 | Surface Soil | MSGFAGIIARWRVRAGYVLAVAVLWFARPTLRSIALGAGIGL |
Ga0070697_1003921362 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VNAAATFFARWRVRLSYPCAILVLWFARPTPRSILWGAPI |
Ga0070733_101363001 | 3300005541 | Surface Soil | VTWLDFFARWRVRIGYILAILVLWLARPTPLWVLGGAVI |
Ga0070695_1008770951 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQAAARFARWRVRLGYVLAVFVLWFAKPTPRSIAIGALVGIVGLSIRA |
Ga0066704_100754061 | 3300005557 | Soil | MNAAGNFFVRWRVRLGYPLAIAVLYLSRPTPRSIFLGAMVGVIGLWLRAY |
Ga0070763_108058571 | 3300005610 | Soil | LSAGGAFFARWRVRLSYPLAILVLWFARPTPLSILWGALL |
Ga0066790_100530574 | 3300005995 | Soil | MNSAGAFFVRWRVRLGYPLAIAVLFFGRPNPRSILYGA |
Ga0066696_101457433 | 3300006032 | Soil | MSAAGNFFVRWRVRLGYPLAIAVLYLSRPTPRSIFLGAIVGVIGLWLRAYA |
Ga0066653_103244741 | 3300006791 | Soil | MTSSGSFFVRWRVRSGYPLAAAVLWLARPAPRTII |
Ga0066665_103759781 | 3300006796 | Soil | MSAAGNFFVRWRVRLGYPLAIAVLYLSRPTPRSIFLGAMVGVIGLWLRAY |
Ga0079220_108888312 | 3300006806 | Agricultural Soil | VNAAAFFARWRVRLGYPLAALVLWLARPSPKSILAGAIIGA |
Ga0075424_1009877841 | 3300006904 | Populus Rhizosphere | MSDAAALFARWRVRLGYLLAIFVLWFARPTPGSVVYGALVGLLGLWI |
Ga0099794_100062097 | 3300007265 | Vadose Zone Soil | VSTASNFFVRWRVRLGYPLAIGVLYFSRPTPRWILVGALVGFAGLL |
Ga0099794_107313911 | 3300007265 | Vadose Zone Soil | MSGAGNFFVRWRVRLGYPLAIAVLYFSWPTPRSILLGALTGV |
Ga0099795_101415652 | 3300007788 | Vadose Zone Soil | MSAAGNFLVRWRVRLGYPLALAVLYFAEPTPRSIL |
Ga0099829_112298152 | 3300009038 | Vadose Zone Soil | MSASGSFFVRWRVRLGYPLAIAVLLFARPTLSSILLGALVGLI |
Ga0099830_100496831 | 3300009088 | Vadose Zone Soil | MNAAAFFARWRVRFGYPLAIVVLWLARPTLQGILAGALVGAIGLW |
Ga0099828_114186281 | 3300009089 | Vadose Zone Soil | MSPAGNFFVRWRVRLGYPLAVAVLYFSWPTPRSILLGALTGVIGL |
Ga0099827_101335664 | 3300009090 | Vadose Zone Soil | MSSAGNFFVRWRVSLGYPLAIAVLWFSQPRPGWILL |
Ga0105248_102891201 | 3300009177 | Switchgrass Rhizosphere | VSAAAFFARWRVRLGYPLAIVVLIFARPNPKSIFIGALVGGVGLL |
Ga0116225_15093971 | 3300009524 | Peatlands Soil | MTAIDFFSRWRVRIGYPLAAVALFLARPTPRSILLGAALGF |
Ga0126384_121366791 | 3300010046 | Tropical Forest Soil | MSRAAALFARWRVRVGYFLALVVLWFARPRPASVLLGALVGAVGL |
Ga0134063_107183651 | 3300010335 | Grasslands Soil | MSVPGAFFMRWRVRFGYPLALAVLWFARPAPRSILLGALA |
Ga0074044_111374732 | 3300010343 | Bog Forest Soil | MSPAGNFFVRWRVRLGYPLAIAVLYFSRPTPLNILLGALVGLLGLWLRADAAGYLHKQ |
Ga0126370_125192641 | 3300010358 | Tropical Forest Soil | MSPAAIFARWRVRLGYVLAIFVLWFARPTPLSVLLGALIGFIG |
Ga0126372_107639312 | 3300010360 | Tropical Forest Soil | VTAADFFARWRVRLGYLLGIVVLFLARPTFHSILLGAAVGFVGLII |
Ga0126378_126297892 | 3300010361 | Tropical Forest Soil | MSAAAVFARWRVRLGYVLAVFVLWLSRPTPLSVLLGALVGAVG |
Ga0126344_14482382 | 3300010866 | Boreal Forest Soil | VSAAFFARWRVRLGYPLAIFVLAFAHPTPQSILYGA |
Ga0137392_102213513 | 3300011269 | Vadose Zone Soil | MSAAAFFARWRVRLSYPLAVVVLWLARPSPKGILTGAVVGAIGLW |
Ga0137392_105722152 | 3300011269 | Vadose Zone Soil | MSASGSFFVRWRVRLGYPLAIAVLLFARPTLSSILLGALVGLIGL |
Ga0137392_114238561 | 3300011269 | Vadose Zone Soil | MSAAVFFARWRVRLSYPLAVVVLWLARPSPKGILTGAVVGAIGLWIRAL |
Ga0137391_102007771 | 3300011270 | Vadose Zone Soil | MSAAGSFFVRWRVRLGYPLAIVVVYLSHPTPRAILLGALVGVGGLCLRAYAAGYLHKQEV |
Ga0137388_110496972 | 3300012189 | Vadose Zone Soil | MSVAGSFFVRWRVRLGYPLAIAVLYFSRPTPPSILLGALMGVVGLW |
Ga0137399_117742601 | 3300012203 | Vadose Zone Soil | MSAAVNFFVRWRVRLGYPLAIAVLAFSRPTPRSILLGALVGVLGLLLRAYAAG |
Ga0137376_103116391 | 3300012208 | Vadose Zone Soil | MSVAGNFFVRWRVRLGYPLAIALLYFSRPTPPSILVGALTGIIGLGVRAYAAGYLHKQEVLTIAG |
Ga0137379_103946913 | 3300012209 | Vadose Zone Soil | MSTAGNFFVRWRVRLGYPLAIVVLWFSQPTPGWILLGTLIGIA |
Ga0137377_101437654 | 3300012211 | Vadose Zone Soil | MSGVGNFFVRWRVRLGYPLAIAVLGFSRPTPGSILLGALAGAVGLSVRAYAAGYLHKQE |
Ga0137360_111626261 | 3300012361 | Vadose Zone Soil | MSGAGSFFVRWRVRLGYPLAIAVLWFSQPTPRSMVLGA |
Ga0137390_102590253 | 3300012363 | Vadose Zone Soil | MSAAGSFFVRWRVRLGYPLAIVVVYLSHPTPRAILLGALVGVGGLCLRAYAAGYLHKQ |
Ga0137390_103699743 | 3300012363 | Vadose Zone Soil | MSGTGSFFVRWRVRLGYPLAIAVLWFSRPTPRSMVLGA |
Ga0137390_107453062 | 3300012363 | Vadose Zone Soil | VSTAGNFFVRWRVRLGYPLAIAVLWFSQPTPGWILL |
Ga0137358_100379101 | 3300012582 | Vadose Zone Soil | MNAAFFVRWRVRLGYPLAIVVLWLARPTPQSILAGALVGTVGLW |
Ga0137358_107993582 | 3300012582 | Vadose Zone Soil | MNGAGNFFVRWRVRLGYPLAIAVLYFSLPTPRSILVGALA |
Ga0137398_103319842 | 3300012683 | Vadose Zone Soil | VSTAGNFFVRWRVRLGYPLAIAVLWFSQPTPGWILLGALIGIAGLLVRAYAAGYLHKQEI |
Ga0137398_111562692 | 3300012683 | Vadose Zone Soil | MSGAGIFFVRWRVRLGYPLAMAVLYFSRPTPPSILLGALTG |
Ga0137413_104949071 | 3300012924 | Vadose Zone Soil | VSAPSFFARWRVRLGYPLAIIVLILARPTPQSIFYGALAGMVGLLVRA |
Ga0137413_107223061 | 3300012924 | Vadose Zone Soil | MSAAAFFARWRVRLGYPLAIVVLLLARPALQSILAGAVIGGAGLWVRATAA |
Ga0137419_116119341 | 3300012925 | Vadose Zone Soil | LNAAAFFARWRVRLGYPLAIAVLWFARPIPRSILYGAAIGLIGLWIR |
Ga0137404_115507702 | 3300012929 | Vadose Zone Soil | MITAGNFFVRWRVRLGYPLAIAVLFFSRPTPRSILLGALAGLIGLWVRAYAAGY |
Ga0137407_120352911 | 3300012930 | Vadose Zone Soil | VSTAGNFFVHWRVRLGYPLAIAVLWFSQPTPGWILLGALIGIAGLLVRA |
Ga0134110_104569681 | 3300012975 | Grasslands Soil | MSGVGNFFVRWRVRLGYPLAIAVLGFSRPTPGSILLGALAGAVGL |
Ga0157375_126474902 | 3300013308 | Miscanthus Rhizosphere | MSDAAAWFARWRVRLGYLLAIFVLWFARPTARSVVCGALVGLLGLW |
Ga0181519_106157091 | 3300014658 | Bog | VTAMDFFARWRVRLGYGLAVLVLWLARPTPQSILMGA |
Ga0137405_12495933 | 3300015053 | Vadose Zone Soil | MITAGNFFVRWRVRLGYPLAIAVLFFSRPTPRSLLLGALAGLIGLWVRAYGAG |
Ga0137405_12612211 | 3300015053 | Vadose Zone Soil | MSAITAFFARWRVRLGYPLVIVVLFFADPTPRSIL |
Ga0137420_10646821 | 3300015054 | Vadose Zone Soil | MNRAGNFFVRWRVRLGYPLAIAVLYFSLPTPRSILVGALARSILVGA |
Ga0137420_12787331 | 3300015054 | Vadose Zone Soil | VSTAGNFFVRWRVRLGYPLAIAVLWFSQPTPGWILLGALIGIAGLLVRAYALTLP |
Ga0137412_100809541 | 3300015242 | Vadose Zone Soil | MSTVATFFARWRVRLGYPLVIIVLVLAHPTPPSILYGALVG |
Ga0182033_101467991 | 3300016319 | Soil | MTAMDFFARWRVRLGYLLAAVVLLLARPTPHSILLGAVV |
Ga0182038_115393222 | 3300016445 | Soil | MSNVAALFARWRVRLGYALAVVVLWLARPTPRSVLLGAIVGA |
Ga0182038_115980781 | 3300016445 | Soil | VKVLDFFARWRVRLGYLLAIAAFWLARPSLRSICLGAMVGAVGLAIRAYA |
Ga0134069_12276311 | 3300017654 | Grasslands Soil | MSASGSFFVRWRVRLGYPLAIAVLLFARPTLSSILLGALVGLIGLGLR |
Ga0187802_103357741 | 3300017822 | Freshwater Sediment | VISAETFFFRWRVRLGYPLAIVVLGFARPSAQSVFIGALVGA |
Ga0187814_100433654 | 3300017932 | Freshwater Sediment | VSSAETFFFRWRVRLGYPLAIVVLGFARPSAQSVFIGALVGA |
Ga0187821_103587981 | 3300017936 | Freshwater Sediment | LKAAGAFFARWRVRLSYPLAILVLWFARPTPHSILWGTPIG |
Ga0187804_102199241 | 3300018006 | Freshwater Sediment | VTASEFLARWRVRLGYLIAIAVLLLARPTPISIVIGSALGIVGLC |
Ga0187784_106846791 | 3300018062 | Tropical Peatland | VTTLDFFARWRVRLGYLVALIVLLLARPTPRSILLGAAIGVIG |
Ga0187769_101986483 | 3300018086 | Tropical Peatland | VTALDFFARWRVRLGYVLAVVVLWLAQPTPWSLLLGAAVGTMGLGIRAY |
Ga0066662_100233811 | 3300018468 | Grasslands Soil | MNAAGNFFVRWRVRLGYPLAIAVLYLSRPTPRSIFLGAM |
Ga0066662_104382061 | 3300018468 | Grasslands Soil | MSATGSFFVRWRVRLGYPLAVAVLYFSRPTPRSIVL |
Ga0066662_105151821 | 3300018468 | Grasslands Soil | MSGAGSFFVRWRVRLGYPLAIAVLWFSRPTPRNILLGALAG |
Ga0182028_14688482 | 3300019788 | Fen | MTALDFFSRWRVRIGYFLAVVVLLLARPTPRSIFLGAAVGVI |
Ga0187768_11277422 | 3300020150 | Tropical Peatland | MNSSNSFFVRWRVRLGYPLAVAVLWFARPMPRSILIG |
Ga0179594_101459591 | 3300020170 | Vadose Zone Soil | MSGAGNFFVRWRVRLGYPLAVAVLYFSRPTPPSILQGAL |
Ga0210403_105531421 | 3300020580 | Soil | MSAAGNFFARWRVRLGYPLAIAVLSFSRPTPPSILLGALAGMIGLWVRAY |
Ga0210399_107208112 | 3300020581 | Soil | MSAAAFLARYRVRLGYPLAIAVLWLARPTPRSIVYGAIAGLA |
Ga0210399_111612692 | 3300020581 | Soil | VSAASFFVRWRVRLGYPLAVVVLALARPSPHSILYG |
Ga0210401_105547202 | 3300020583 | Soil | MSAAAFFARWRVRLSYPLAAIVLWFARPSPESIVAG |
Ga0210401_116059942 | 3300020583 | Soil | VTAMDFFARWRVRIGYLLALVVLWFARPNPQSILIGG |
Ga0210404_106405262 | 3300021088 | Soil | MSAAAFFARWRVRLGYPLALVVLFLARPTPKSILAGALIGAI |
Ga0210400_100541521 | 3300021170 | Soil | MSGAGNFFVRWRVRLGYPLAIAVLYFSRPTPLSIL |
Ga0210386_101255204 | 3300021406 | Soil | VTAADFFARWRVRLGYLLAIVVLFLARPTFHSILLGAAVG |
Ga0210386_104320501 | 3300021406 | Soil | VSAPAFFARWRVRLGYPLAIIVLVLAHPTPQSILYGALVGSVGLLIRALAAGHL |
Ga0210394_103693211 | 3300021420 | Soil | VRAPAFFARWRVRLGYPLAIIVLVLAHPTPQSILYGALVGSIGLLIRALAAGHLH |
Ga0210384_111700242 | 3300021432 | Soil | MSAAGNFFVRWRVRLGYPLAFAVLFFSRPTPRGILLGALAGV |
Ga0210409_102523483 | 3300021559 | Soil | MSVGSAFFVRWRVRLGYPLAVAVLWFARPTSRSIAIGA |
Ga0210409_104236612 | 3300021559 | Soil | MKSASTFFARWRVRFSYPLAILVLWFARPTPHSIFWGVHL |
Ga0137417_10754692 | 3300024330 | Vadose Zone Soil | MIGAGNFFVRWRVRLGYPLAIAVLYFSRPTPRSILLGALTGVIGLWVRAYAAGYL |
Ga0207699_101452803 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADFFARWRVRLGYLLAIVVLFLARPTFHSILLGAAVGFVGLII |
Ga0207665_103614804 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAAAFFARWRVRLGYPLAIVVLIFARPNPKSIFIGALVGGVG |
Ga0209438_10279044 | 3300026285 | Grasslands Soil | VSAAAFFARWRVRLGYPLAAIVLWLARPTPQSILGGAIIGAIGLWI |
Ga0209055_12450582 | 3300026309 | Soil | MSGVGNFFVRWRVRLGYPLAIAVLGFSRPTPGSILLGALA |
Ga0209802_10520121 | 3300026328 | Soil | MSTASNFFVRWRVRLGYPLSIAVLYFSQPTPRSILLGALTGVIGLVVRAYAAGYLHKQEV |
Ga0257150_10317231 | 3300026356 | Soil | MSTAGNFFVRWRVRLGYPFAIVVLFFSRPTPRSILFGALAGLIGLWVRAY |
Ga0257163_10175262 | 3300026359 | Soil | MSGAGNFFVRWRVRLGYPLAIAVLYFSRPTPPSILLGALTGVIGLW |
Ga0257171_10033004 | 3300026377 | Soil | MSSIAAFFAHWRVRLGYPLVIVVLFFARPTPRSILAGALTG |
Ga0257181_10427051 | 3300026499 | Soil | MIGAGNFFVRWRVRLGYPLAIAVLYFSRPTPRSILLGALTGVIGLWVRAYAA |
Ga0209056_101082084 | 3300026538 | Soil | MSAITAFFARWRVRLGYPLVIVVLFFARPTPRSILAGALV |
Ga0209648_101014921 | 3300026551 | Grasslands Soil | MIGAGNFFVRWRVRLGYPLAIAVLYFSRPTPRSILLGALTGVIGL |
Ga0208365_10434401 | 3300027070 | Forest Soil | MSAAAFFARWRVRLSYPLAAVVLWFALPSPKGIVA |
Ga0209179_10436002 | 3300027512 | Vadose Zone Soil | MSAAAFFARWRVRLGYPLAIVVLLLARPTLQSILAG |
Ga0209733_11360482 | 3300027591 | Forest Soil | MNSAGAFFVRWRVRLGYPLAIAVLFFARPQPRSILYGVL |
Ga0209217_11493671 | 3300027651 | Forest Soil | MSGAGNFFARWRVRLGYPLAIAVLYFSWPTPRSILLGAL |
Ga0208990_11863752 | 3300027663 | Forest Soil | MSTAGNFFVRWRVRLGYPLAVAVLAFSRPTPRSILVGALAGAVGLWVRAYAA |
Ga0209588_10082901 | 3300027671 | Vadose Zone Soil | MSGAGNFFVRWRVRLGYPLAIAVLYFSWPTPRSILL |
Ga0208989_101434172 | 3300027738 | Forest Soil | MNSAGTFFVRYRVRLGYPLTLAVLLFARPQPRSILYGALVGLIGLTLRAWAA |
Ga0209073_101751781 | 3300027765 | Agricultural Soil | MSLPSSFFMRWRVRLGYPLAAIVLWFSRPVPGSILLGG |
Ga0209139_101916911 | 3300027795 | Bog Forest Soil | MSELAAVFVRWRVRLGYPLALLVLWVARPTPRSIAIGALVGIFG |
Ga0209180_104172382 | 3300027846 | Vadose Zone Soil | MSPAGNFFVRWRVRLGYPLAVAVLYFSWPTPRSILLGALTG |
Ga0209693_102332872 | 3300027855 | Soil | LSAGGAFFARWRVRLSYPLAILVLWFARPTPLSILWGALLG |
Ga0209701_101019814 | 3300027862 | Vadose Zone Soil | MTTPGNFFVRWRVRLGYPLAIAVLWFSQPTPGWISLGALVGAAGLLVRAYAA |
Ga0209167_100252821 | 3300027867 | Surface Soil | VTWLDFFARWRVRIGYILAILVLWLARPTPLWVLGGAVIGLFGLL |
Ga0209488_107322782 | 3300027903 | Vadose Zone Soil | MSAAAFFARWRVRLGYPLAIVVLLLARPTLQSILAGAVIGAAGL |
Ga0209698_100182688 | 3300027911 | Watersheds | MSAASNFFVRWRVRLGYPLAIAVLYFSHPTPHSIL |
Ga0209526_100890664 | 3300028047 | Forest Soil | VRAAAFFARWRVRLGYPLAIVVLALARPRPSSILGGALVGAIGLLVRGLAAGHLHK |
Ga0302233_104116742 | 3300028746 | Palsa | MSATRFFVRWRVRAGYPLAVIVLLLARPTPGSIFAG |
Ga0308309_109079252 | 3300028906 | Soil | VTAMDFFARWRVRIGYLLALVVLWFARPNPGSILIGG |
Ga0318560_102632581 | 3300031682 | Soil | VTALDFFARWRVRLGYLVAVVVLLLARPTPLSMLLGAVVG |
Ga0307474_107769312 | 3300031718 | Hardwood Forest Soil | MGPTFFARWRVRLGYPLAIVVLLLARPTPESIAIGGVVGLI |
Ga0318493_103838611 | 3300031723 | Soil | MKSVAALFARWRVRLGYALAVVVLWLARPTPGSVLLGAIVGAVGLW |
Ga0318526_103221221 | 3300031769 | Soil | VKVLDFFARWRVRLGYLLAIAAFWLARPSLRSICLGAMVGAVGLAI |
Ga0307473_100008189 | 3300031820 | Hardwood Forest Soil | MSAAGSFFVRWRVRVGYPLAIAVVYFSRPTPRSILVGALVGVAGLCLRAYAA |
Ga0307473_113110952 | 3300031820 | Hardwood Forest Soil | MSAIAAFFARWRVRLGYPLAIAVLFFAQPTPRSILSGAL |
Ga0307473_115171601 | 3300031820 | Hardwood Forest Soil | MTAAAFFARWRVRLGYPLAAVVLCLARPSPKSILAGMVVGAIGLWVRARAAGHLHKQ |
Ga0318520_109744212 | 3300031897 | Soil | MKSVAALFARWRVRLGYALAVVVLWLARPTPGSVLLGAIVGAVG |
Ga0310910_103506491 | 3300031946 | Soil | VTLLDFFARWRVRLGYALALVVLWLARPTPGSIAIGAVIGFAGLCV |
Ga0306926_123572471 | 3300031954 | Soil | MSDAARVFARWRVRLGYLLAVFVLMFARPTPLSVLAGAIVGAV |
Ga0307479_108650452 | 3300031962 | Hardwood Forest Soil | MSAAAFFARWRVRLGYPLAAVVLLLARPSPKSILTGAVVGAIGLW |
Ga0307479_118527831 | 3300031962 | Hardwood Forest Soil | MSAAGSFFVRWRVRLGYPLAIAVLYFSRPTLRSILLG |
Ga0307479_119261271 | 3300031962 | Hardwood Forest Soil | MNAAAFFARWRVRLGYPLAIVVLWLARPTPQSILAGALVG |
Ga0318504_101276801 | 3300032063 | Soil | MSLPGTFFMRWRVRLGYPMAVVVLWFSRPAPRSILLG |
Ga0307472_1003593511 | 3300032205 | Hardwood Forest Soil | VTPAAFFARWRVRLSYPLAIIVLIFARPNPRSILIGALVGGV |
Ga0307472_1012160611 | 3300032205 | Hardwood Forest Soil | MSVAPAFFVRWRVRLGYPLAIVVLLFSRPSPSSILLGALV |
Ga0310812_103977732 | 3300032421 | Soil | VSVAAFFSRWRVRLGYPLAIAVLAVARPIPKSVVI |
Ga0335079_106859531 | 3300032783 | Soil | VTAAEFFARWRVRLGYFLAVVVLFLARPTFHSILLGA |
Ga0335079_109901532 | 3300032783 | Soil | MTAADFFARWRVKFGYFLAVVVLFVARPTFHSILLGAV |
Ga0335078_1001607611 | 3300032805 | Soil | MSKIAVIIARWRVRLGYPLALVVLWLAQPTPRSIGI |
Ga0310914_108864332 | 3300033289 | Soil | VTLLDFFARWRVRLGYALALVVLWLARPTPGSIAIGAVI |
Ga0326724_0243880_2_115 | 3300034091 | Peat Soil | MTARDFFSRWRVRIGYLLAVVVLLLARPTPHSILLGAA |
⦗Top⦘ |