Basic Information | |
---|---|
Family ID | F048161 |
Family Type | Metagenome |
Number of Sequences | 148 |
Average Sequence Length | 44 residues |
Representative Sequence | MILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 78.38 % |
% of genes near scaffold ends (potentially truncated) | 23.65 % |
% of genes from short scaffolds (< 2000 bps) | 68.92 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.541 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.730 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.162 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.243 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 84.44% β-sheet: 0.00% Coil/Unstructured: 15.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF05876 | GpA_ATPase | 18.24 |
PF02195 | ParBc | 14.86 |
PF01555 | N6_N4_Mtase | 4.73 |
PF05136 | Phage_portal_2 | 2.03 |
PF14090 | HTH_39 | 1.35 |
PF00535 | Glycos_transf_2 | 1.35 |
PF04851 | ResIII | 1.35 |
PF06725 | 3D | 1.35 |
PF01242 | PTPS | 1.35 |
PF05014 | Nuc_deoxyrib_tr | 0.68 |
PF02005 | TRM | 0.68 |
PF01436 | NHL | 0.68 |
PF01507 | PAPS_reduct | 0.68 |
PF00271 | Helicase_C | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 18.24 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 4.73 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 4.73 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 4.73 |
COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 2.03 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.35 |
COG1867 | tRNA G26 N,N-dimethylase Trm1 | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.54 % |
All Organisms | root | All Organisms | 34.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003277|JGI25908J49247_10005449 | All Organisms → Viruses → Predicted Viral | 4057 | Open in IMG/M |
3300003277|JGI25908J49247_10077869 | Not Available | 821 | Open in IMG/M |
3300003277|JGI25908J49247_10163506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Planktothrix phage PaV-LD | 516 | Open in IMG/M |
3300003490|JGI25926J51410_1001128 | All Organisms → cellular organisms → Bacteria | 5060 | Open in IMG/M |
3300003490|JGI25926J51410_1031785 | Not Available | 977 | Open in IMG/M |
3300005582|Ga0049080_10277795 | Not Available | 543 | Open in IMG/M |
3300006805|Ga0075464_10101996 | Not Available | 1650 | Open in IMG/M |
3300008450|Ga0114880_1087918 | Not Available | 1227 | Open in IMG/M |
3300008450|Ga0114880_1093565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1176 | Open in IMG/M |
3300008450|Ga0114880_1179760 | Not Available | 731 | Open in IMG/M |
3300008450|Ga0114880_1223044 | Not Available | 611 | Open in IMG/M |
3300009026|Ga0102829_1018496 | Not Available | 1977 | Open in IMG/M |
3300009056|Ga0102860_1221279 | Not Available | 545 | Open in IMG/M |
3300009068|Ga0114973_10016606 | Not Available | 4634 | Open in IMG/M |
3300009151|Ga0114962_10005831 | Not Available | 9601 | Open in IMG/M |
3300009151|Ga0114962_10019869 | All Organisms → Viruses → Predicted Viral | 4759 | Open in IMG/M |
3300009155|Ga0114968_10009317 | All Organisms → cellular organisms → Bacteria | 7116 | Open in IMG/M |
3300009155|Ga0114968_10038531 | All Organisms → cellular organisms → Bacteria | 3149 | Open in IMG/M |
3300009155|Ga0114968_10047933 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
3300009155|Ga0114968_10070361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2197 | Open in IMG/M |
3300009160|Ga0114981_10042226 | All Organisms → Viruses → Predicted Viral | 2577 | Open in IMG/M |
3300009164|Ga0114975_10307476 | Not Available | 877 | Open in IMG/M |
3300009180|Ga0114979_10147304 | Not Available | 1442 | Open in IMG/M |
3300009180|Ga0114979_10147638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1440 | Open in IMG/M |
3300009184|Ga0114976_10495428 | Not Available | 630 | Open in IMG/M |
3300010160|Ga0114967_10082053 | Not Available | 1919 | Open in IMG/M |
3300010160|Ga0114967_10368181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 723 | Open in IMG/M |
3300010885|Ga0133913_10463325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 3343 | Open in IMG/M |
3300010885|Ga0133913_11031959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2124 | Open in IMG/M |
3300010885|Ga0133913_11654838 | Not Available | 1612 | Open in IMG/M |
3300011010|Ga0139557_1003717 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3309 | Open in IMG/M |
3300011010|Ga0139557_1012297 | Not Available | 1656 | Open in IMG/M |
3300011114|Ga0151515_10868 | Not Available | 12177 | Open in IMG/M |
3300011335|Ga0153698_1096 | All Organisms → cellular organisms → Bacteria | 36551 | Open in IMG/M |
3300011335|Ga0153698_1116 | All Organisms → cellular organisms → Bacteria | 34765 | Open in IMG/M |
3300012013|Ga0153805_1046334 | Not Available | 738 | Open in IMG/M |
3300012666|Ga0157498_1036835 | Not Available | 753 | Open in IMG/M |
3300012666|Ga0157498_1075666 | Not Available | 519 | Open in IMG/M |
3300013004|Ga0164293_10261385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. cthh925 | 1217 | Open in IMG/M |
3300013005|Ga0164292_10125385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. cthh925 | 1905 | Open in IMG/M |
3300013006|Ga0164294_10173212 | Not Available | 1545 | Open in IMG/M |
3300013006|Ga0164294_10394615 | Not Available | 949 | Open in IMG/M |
3300013372|Ga0177922_10148684 | Not Available | 1063 | Open in IMG/M |
3300013372|Ga0177922_10373477 | Not Available | 511 | Open in IMG/M |
3300013372|Ga0177922_10999080 | Not Available | 1119 | Open in IMG/M |
3300013372|Ga0177922_11131624 | Not Available | 551 | Open in IMG/M |
3300017701|Ga0181364_1003171 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
3300017701|Ga0181364_1044733 | Not Available | 701 | Open in IMG/M |
3300017716|Ga0181350_1101568 | Not Available | 707 | Open in IMG/M |
3300017722|Ga0181347_1085563 | Not Available | 914 | Open in IMG/M |
3300017722|Ga0181347_1145671 | Not Available | 649 | Open in IMG/M |
3300017722|Ga0181347_1174034 | Not Available | 577 | Open in IMG/M |
3300017723|Ga0181362_1061747 | Not Available | 768 | Open in IMG/M |
3300017723|Ga0181362_1098155 | Not Available | 583 | Open in IMG/M |
3300017736|Ga0181365_1006564 | Not Available | 2875 | Open in IMG/M |
3300017736|Ga0181365_1089574 | Not Available | 750 | Open in IMG/M |
3300017774|Ga0181358_1046429 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300017774|Ga0181358_1099397 | Not Available | 1044 | Open in IMG/M |
3300017774|Ga0181358_1129104 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300017777|Ga0181357_1151650 | Not Available | 853 | Open in IMG/M |
3300017778|Ga0181349_1028848 | Not Available | 2239 | Open in IMG/M |
3300017778|Ga0181349_1077692 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
3300017778|Ga0181349_1159827 | Not Available | 804 | Open in IMG/M |
3300017780|Ga0181346_1242539 | Not Available | 633 | Open in IMG/M |
3300017784|Ga0181348_1023410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2623 | Open in IMG/M |
3300017785|Ga0181355_1094048 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300017785|Ga0181355_1179215 | Not Available | 842 | Open in IMG/M |
3300019784|Ga0181359_1000495 | All Organisms → cellular organisms → Bacteria | 8855 | Open in IMG/M |
3300019784|Ga0181359_1004390 | All Organisms → cellular organisms → Bacteria | 4471 | Open in IMG/M |
3300019784|Ga0181359_1005388 | All Organisms → cellular organisms → Bacteria | 4165 | Open in IMG/M |
3300019784|Ga0181359_1022398 | Not Available | 2400 | Open in IMG/M |
3300019784|Ga0181359_1029496 | Not Available | 2113 | Open in IMG/M |
3300019784|Ga0181359_1029820 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
3300019784|Ga0181359_1032267 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300019784|Ga0181359_1033435 | Not Available | 1989 | Open in IMG/M |
3300019784|Ga0181359_1034605 | Not Available | 1955 | Open in IMG/M |
3300019784|Ga0181359_1046894 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
3300019784|Ga0181359_1181308 | Not Available | 695 | Open in IMG/M |
3300019784|Ga0181359_1211568 | Not Available | 616 | Open in IMG/M |
3300020172|Ga0211729_10359989 | Not Available | 1369 | Open in IMG/M |
3300022190|Ga0181354_1032007 | Not Available | 1722 | Open in IMG/M |
3300022190|Ga0181354_1089181 | Not Available | 1012 | Open in IMG/M |
3300022407|Ga0181351_1167801 | Not Available | 770 | Open in IMG/M |
3300022407|Ga0181351_1236996 | Not Available | 579 | Open in IMG/M |
3300022752|Ga0214917_10001920 | Not Available | 26058 | Open in IMG/M |
3300023174|Ga0214921_10001583 | All Organisms → cellular organisms → Bacteria | 38409 | Open in IMG/M |
3300024346|Ga0244775_10709184 | Not Available | 810 | Open in IMG/M |
3300024346|Ga0244775_10788877 | Not Available | 761 | Open in IMG/M |
3300027320|Ga0208923_1010918 | Not Available | 1593 | Open in IMG/M |
3300027627|Ga0208942_1061899 | Not Available | 1124 | Open in IMG/M |
3300027656|Ga0209357_1002031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 8126 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1162387 | Not Available | 946 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1197360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Planktothrix phage PaV-LD | 756 | Open in IMG/M |
3300027746|Ga0209597_1000225 | All Organisms → cellular organisms → Bacteria | 37691 | Open in IMG/M |
3300027749|Ga0209084_1015506 | All Organisms → cellular organisms → Bacteria | 4308 | Open in IMG/M |
3300027754|Ga0209596_1000655 | Not Available | 31918 | Open in IMG/M |
3300027754|Ga0209596_1007679 | Not Available | 7575 | Open in IMG/M |
3300027754|Ga0209596_1044685 | Not Available | 2362 | Open in IMG/M |
3300027754|Ga0209596_1111375 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1274 | Open in IMG/M |
3300027759|Ga0209296_1002530 | Not Available | 13079 | Open in IMG/M |
3300027763|Ga0209088_10000298 | All Organisms → cellular organisms → Bacteria | 36185 | Open in IMG/M |
3300027777|Ga0209829_10021680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3770 | Open in IMG/M |
3300027808|Ga0209354_10104521 | Not Available | 1156 | Open in IMG/M |
3300027973|Ga0209298_10110740 | Not Available | 1189 | Open in IMG/M |
3300028392|Ga0304729_1119056 | Not Available | 880 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1140170 | Not Available | 977 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10104418 | Not Available | 1851 | Open in IMG/M |
3300031707|Ga0315291_10132633 | Not Available | 2635 | Open in IMG/M |
3300031707|Ga0315291_10328727 | Not Available | 1485 | Open in IMG/M |
3300031707|Ga0315291_10504619 | Not Available | 1121 | Open in IMG/M |
3300031746|Ga0315293_10106761 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
3300031746|Ga0315293_10233768 | Not Available | 1498 | Open in IMG/M |
3300031746|Ga0315293_10233953 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300031746|Ga0315293_10408906 | Not Available | 1066 | Open in IMG/M |
3300031772|Ga0315288_10954049 | Not Available | 770 | Open in IMG/M |
3300031873|Ga0315297_10615072 | Not Available | 912 | Open in IMG/M |
3300031885|Ga0315285_10058199 | All Organisms → cellular organisms → Bacteria | 3565 | Open in IMG/M |
3300031885|Ga0315285_10072792 | Not Available | 3104 | Open in IMG/M |
3300031885|Ga0315285_10117632 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300031885|Ga0315285_10157996 | Not Available | 1872 | Open in IMG/M |
3300031885|Ga0315285_10526115 | Not Available | 804 | Open in IMG/M |
3300031885|Ga0315285_10832040 | Not Available | 574 | Open in IMG/M |
3300031885|Ga0315285_10980502 | Not Available | 508 | Open in IMG/M |
3300031952|Ga0315294_10075411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3538 | Open in IMG/M |
3300031952|Ga0315294_10451719 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300031952|Ga0315294_10608839 | Not Available | 976 | Open in IMG/M |
3300031952|Ga0315294_10733671 | Not Available | 861 | Open in IMG/M |
3300031952|Ga0315294_10837496 | Not Available | 787 | Open in IMG/M |
3300031952|Ga0315294_11469347 | Not Available | 535 | Open in IMG/M |
3300031952|Ga0315294_11586511 | Not Available | 507 | Open in IMG/M |
3300031997|Ga0315278_10873670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Planktothrix phage PaV-LD | 904 | Open in IMG/M |
3300031997|Ga0315278_11866322 | Not Available | 566 | Open in IMG/M |
3300031999|Ga0315274_10337361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1779 | Open in IMG/M |
3300031999|Ga0315274_10880682 | Not Available | 935 | Open in IMG/M |
3300031999|Ga0315274_11776726 | Not Available | 567 | Open in IMG/M |
3300031999|Ga0315274_11852088 | Not Available | 550 | Open in IMG/M |
3300032046|Ga0315289_11034706 | Not Available | 684 | Open in IMG/M |
3300032092|Ga0315905_10383321 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1325 | Open in IMG/M |
3300032143|Ga0315292_10816662 | Not Available | 781 | Open in IMG/M |
3300032143|Ga0315292_11034417 | Not Available | 681 | Open in IMG/M |
3300032177|Ga0315276_10837913 | Not Available | 983 | Open in IMG/M |
3300032256|Ga0315271_11732081 | Not Available | 537 | Open in IMG/M |
3300032342|Ga0315286_11239271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 728 | Open in IMG/M |
3300033233|Ga0334722_10442451 | Not Available | 936 | Open in IMG/M |
3300033233|Ga0334722_10452947 | Not Available | 924 | Open in IMG/M |
3300033980|Ga0334981_0001511 | All Organisms → cellular organisms → Bacteria | 16126 | Open in IMG/M |
3300033980|Ga0334981_0274770 | Not Available | 755 | Open in IMG/M |
3300034120|Ga0335056_0078687 | All Organisms → Viruses → Predicted Viral | 2071 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.73% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 25.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.05% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.70% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.03% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.35% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 1.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.35% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.35% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.35% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.68% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.68% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25908J49247_100054495 | 3300003277 | Freshwater Lake | VILGLKIGVGIVLGIVIINVAFWACIILAYLLATLFECIGKWIKK* |
JGI25908J49247_100778692 | 3300003277 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWLNK* |
JGI25908J49247_101635062 | 3300003277 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWINK* |
JGI25926J51410_10011285 | 3300003490 | Freshwater Lake | MLGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK* |
JGI25926J51410_10317851 | 3300003490 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWIKK* |
Ga0049080_102777951 | 3300005582 | Freshwater Lentic | VILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWIKK* |
Ga0075464_101019961 | 3300006805 | Aqueous | MLALKIAVGIVLAVVILNVAFWACIILAYLLATLFECIGKWIKK* |
Ga0114880_10879182 | 3300008450 | Freshwater Lake | MILALKIALGIVLGVVILNVAFWGFIILAYLIVTFFECIGKWINK* |
Ga0114880_10935651 | 3300008450 | Freshwater Lake | MILALKIALGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0114880_11797602 | 3300008450 | Freshwater Lake | GLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK* |
Ga0114880_12230442 | 3300008450 | Freshwater Lake | VILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK* |
Ga0102829_10184962 | 3300009026 | Estuarine | MLALKIAVGIVLAVVILNVAFWACIILAYLLATLFECIGKWINK* |
Ga0102860_12212791 | 3300009056 | Estuarine | MILGLKIGVGIVLGIVLINVAFWGFIILAYLIVTFFECIGKWINK* |
Ga0114973_100166064 | 3300009068 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVAFWTCIILAYLLATLFECIGKWINK* |
Ga0114962_1000583113 | 3300009151 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0114962_100198695 | 3300009151 | Freshwater Lake | MILVLKIALGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0114968_100093173 | 3300009155 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTFFECIGKWINK* |
Ga0114968_100385312 | 3300009155 | Freshwater Lake | MILGLKIGMGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0114968_100479335 | 3300009155 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGRWIKK* |
Ga0114968_100703612 | 3300009155 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWACIILAYLITTLFECIGKWINK* |
Ga0114981_100422263 | 3300009160 | Freshwater Lake | VILGLKIGVGIVLGIVLLNVAFWTCIILAYLLATLFECIGKWIKK* |
Ga0114975_103074763 | 3300009164 | Freshwater Lake | MILALKIAVGIVLAIVILNVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0114979_101473043 | 3300009180 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWGCIILAYLLATLFECIGKWINK* |
Ga0114979_101476382 | 3300009180 | Freshwater Lake | MILALKIAVGIVLAVVFINVGFWACILLVYLVVTLFEAI |
Ga0114976_104954282 | 3300009184 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK* |
Ga0114967_100820533 | 3300010160 | Freshwater Lake | YHPKSRGGVQMIIALKIALGIVLGVVLLNVAFWGFIILAYLITTLFECIGKWLNK* |
Ga0114967_103681812 | 3300010160 | Freshwater Lake | MILALKIAMGIVLGVVILNVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0133913_104633253 | 3300010885 | Freshwater Lake | MILALKIAVGIVLAVVFINVGFWACILLVYLVVTLFEAIGKWLR* |
Ga0133913_110319594 | 3300010885 | Freshwater Lake | MILALKIAMGIVLGVVILNVAFWGFIILAYLITTLFECIGKWINK* |
Ga0133913_116548383 | 3300010885 | Freshwater Lake | MIIALKIALGIVLGVVLLNVAFWGFIILAYLITTLFECIGKWLNK* |
Ga0139557_10037175 | 3300011010 | Freshwater | MILALKIALGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0139557_10122972 | 3300011010 | Freshwater | VILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0151515_1086815 | 3300011114 | Freshwater | MILALKIAVGIVLAVVILNVAFWGFIILIYLLTTLLECIGKWINK* |
Ga0153698_109658 | 3300011335 | Freshwater | MILALKIAVGIVLAVVILNVAFWGFIILTYLIVTLFECIGKWINK* |
Ga0153698_11163 | 3300011335 | Freshwater | MILGLKIGVGIVLGIVLLNIAFWACVILAYLLATLFECIGKWINK* |
Ga0153805_10463341 | 3300012013 | Surface Ice | MILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWINK* |
Ga0157498_10368351 | 3300012666 | Freshwater, Surface Ice | MILGLKIGVGIVLGIVLINVAFWACIILAYLVATLFECIGKWIKK* |
Ga0157498_10756663 | 3300012666 | Freshwater, Surface Ice | IVLGIVLINVAFWACIILAYLLATLFECIGKWIKK* |
Ga0164293_102613851 | 3300013004 | Freshwater | VILGLKIGVGIVLGIVLINVAFWACIILAYLLTTLFECIGKW |
Ga0164292_101253853 | 3300013005 | Freshwater | MILGLKIGVGIVLGIVLINVAFWACIILAYLLTTLFECIGKWIKK* |
Ga0164294_101732122 | 3300013006 | Freshwater | MGNLEVILGLKIGVGIVLGIVLINVAFWACIILAYLFATLFECIGKWINK* |
Ga0164294_103946152 | 3300013006 | Freshwater | MILALKIAVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0177922_101486842 | 3300013372 | Freshwater | VILALKIAVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK* |
Ga0177922_103734771 | 3300013372 | Freshwater | VGIVLGIVLLNVAFWACIILAYLLATVFECIGKWINK* |
Ga0177922_109990802 | 3300013372 | Freshwater | MILGLKIAVGIVLAVVILNVAFWGFIILAYLIVTFFECIGKWINK* |
Ga0177922_111316241 | 3300013372 | Freshwater | ILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK* |
Ga0181364_10031711 | 3300017701 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVVFWACVILAYLLATLFECIGKWIKK |
Ga0181364_10447332 | 3300017701 | Freshwater Lake | MILALKIAVGIVLGIVLINVAFWGLIILAYLIVTLFECIWKWINLLPSDLLFLH |
Ga0181350_11015681 | 3300017716 | Freshwater Lake | MILGLKIGVGIVLGIVIINVAFWACIILAYLLATLFECIGKWIKK |
Ga0181347_10855631 | 3300017722 | Freshwater Lake | MILALTIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0181347_11456712 | 3300017722 | Freshwater Lake | MILGLKIAVGIVLAVVILNVAFWGFIILAYLIVTFFECIGKWLNK |
Ga0181347_11740341 | 3300017722 | Freshwater Lake | LALKIAVGIVLAIVILNVAFWGFIILAYLIVTFFECIGKWLNK |
Ga0181362_10617474 | 3300017723 | Freshwater Lake | ALKIAVGIVLAVVILNVAFWACIILAYLIVTFFECIGKWLNK |
Ga0181362_10981552 | 3300017723 | Freshwater Lake | MILALKIAVGIVLAIVILNVAFWACIILAYLIVTFFECIGKWLNK |
Ga0181365_10065646 | 3300017736 | Freshwater Lake | VILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGK |
Ga0181365_10895742 | 3300017736 | Freshwater Lake | MTLALKIAVGIVLAIVILNVAFWGFIILAYLIVTFFECIGKWLNK |
Ga0181358_10464291 | 3300017774 | Freshwater Lake | MLGLKIGVGIVLGIVLLNVAFWGCIILAYLLATLFECIGKWIKK |
Ga0181358_10993972 | 3300017774 | Freshwater Lake | MLALKIAVGIVLAVVILNVAFWACIILACLLATISECKGKWIKK |
Ga0181358_11291043 | 3300017774 | Freshwater Lake | YNPKSRRRVQMILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0181357_11516502 | 3300017777 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWACIILAYLITTLFECIGKWINK |
Ga0181349_10288483 | 3300017778 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWACIILAYLIVTFFECIGKWINK |
Ga0181349_10776923 | 3300017778 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWACIILAYLIVTFF |
Ga0181349_11598272 | 3300017778 | Freshwater Lake | MILGLKIGVGIVLAIVLLNVAFWACVIFAYLLATLFECIGKWMKK |
Ga0181346_12425392 | 3300017780 | Freshwater Lake | MILALKIAVGIVLGIVLINVAFWGFIILAYLIVTLFECI |
Ga0181348_10234101 | 3300017784 | Freshwater Lake | IAVGIVLAVVILNVAFWACIILAYLLATLFECIGKWINK |
Ga0181355_10940483 | 3300017785 | Freshwater Lake | MLGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWINK |
Ga0181355_11792151 | 3300017785 | Freshwater Lake | MILALKIAVGIVLAIVILNVACWAAVTLADLPATLFENIGNAMNK |
Ga0181359_10004953 | 3300019784 | Freshwater Lake | MLGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWINK |
Ga0181359_10043904 | 3300019784 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWLNK |
Ga0181359_10053884 | 3300019784 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0181359_10223983 | 3300019784 | Freshwater Lake | VILGLKIGVGIVLGIVIINVAFWACIILAYLLATLFECIGKWIKK |
Ga0181359_10294964 | 3300019784 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECIGKWIKK |
Ga0181359_10298204 | 3300019784 | Freshwater Lake | MILALKIAVGIVLAIVILNVAFWGFIILAYLIVTFFECIGKWLNK |
Ga0181359_10322672 | 3300019784 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0181359_10334351 | 3300019784 | Freshwater Lake | MILALKIAVGIVLGVVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0181359_10346053 | 3300019784 | Freshwater Lake | MILGLKIGVGIVLAIVLLNVAFWACVIFAYLLATLFECIGKWIKK |
Ga0181359_10468942 | 3300019784 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVVFWACVILAYLLATLFECIGKWMKK |
Ga0181359_11813082 | 3300019784 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWACIILAYLIVTFFECIGKWLNK |
Ga0181359_12115682 | 3300019784 | Freshwater Lake | MILALKIAVGIVLAIVILNVAFWACVILAYLLATLFECIGKWMNK |
Ga0211729_103599892 | 3300020172 | Freshwater | MILGLKIGVGIVLGIVLLNIAFWACVILAYLLATLFECIGKWINK |
Ga0181354_10320073 | 3300022190 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWINK |
Ga0181354_10891811 | 3300022190 | Freshwater Lake | LKIGVGIVLAIVLLNVAFWACVIFAYLLATLFECIGKWIKK |
Ga0181351_11678011 | 3300022407 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTLFECIG |
Ga0181351_12369962 | 3300022407 | Freshwater Lake | MILALKIAVGIVLAIVILNVAFWGFIILAYLITTLFECIGKWLNK |
Ga0214917_1000192033 | 3300022752 | Freshwater | VILGLKIGVGIVLGIVLLNVAFWACIIFAYLLATLFECIGKWINK |
Ga0214921_100015838 | 3300023174 | Freshwater | MLGLKIGVGIVLGIVLLNVAFWACVILAYLLATLFECMGKWIKK |
Ga0244775_107091842 | 3300024346 | Estuarine | MILALKIAVGIVLAIVILNVAFWGFIILAYLIVTLFECIGKWLNK |
Ga0244775_107888771 | 3300024346 | Estuarine | VILGLKIGVGIVLGIVLLNVAFWACIILAYLVATLFECIGKWINK |
Ga0208923_10109183 | 3300027320 | Estuarine | MLALKIAVGIVLAVVILNVAFWACIILAYLLATLFECIGKWINK |
Ga0208942_10618991 | 3300027627 | Freshwater Lentic | MGKLEMILALKIAVGIVLAIVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0209357_10020313 | 3300027656 | Freshwater Lake | VILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWINK |
(restricted) Ga0247836_11623873 | 3300027728 | Freshwater | MILALKIAVGIVLAIVILNVAFWACVILAYLLATLFECIGKWINK |
(restricted) Ga0247833_11973602 | 3300027730 | Freshwater | MILGLKIGVGIVLGIVLLNIAFWACVILAYLLTTLFECIGKWINK |
Ga0209597_10002258 | 3300027746 | Freshwater Lake | MILGLKIGVGIVLGIVLLNVAFWTCIILAYLLATLFECIGKWINK |
Ga0209084_10155065 | 3300027749 | Freshwater Lake | MILVLKIALGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0209596_100065547 | 3300027754 | Freshwater Lake | MILALKIAVGIVLAVVILNVAFWGFIILAYLIVTFFECIGKWINK |
Ga0209596_10076797 | 3300027754 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGRWIKK |
Ga0209596_10446851 | 3300027754 | Freshwater Lake | MILGLKIGMGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0209596_11113753 | 3300027754 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWACIILAYLITTLFECIGKWINK |
Ga0209296_100253014 | 3300027759 | Freshwater Lake | MILGLKIGVGIVLGIVLINVAFWGCIILAYLLATLFECIGKWINK |
Ga0209088_1000029819 | 3300027763 | Freshwater Lake | VILGLKIGVGIVLGIVLLNVAFWTCIILAYLLATLFECIGKWIKK |
Ga0209829_100216802 | 3300027777 | Freshwater Lake | MILALKIAMGIVLGVVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0209354_101045212 | 3300027808 | Freshwater Lake | KIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWIKK |
Ga0209298_101107401 | 3300027973 | Freshwater Lake | QMILGLKIGVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0304729_11190562 | 3300028392 | Freshwater Lake | ILGLKIGVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
(restricted) Ga0247831_11401703 | 3300028559 | Freshwater | MILGLKIGVGIVLGIVLLNIAFWACVILAYLLTTLFECIGK |
(restricted) Ga0247840_101044185 | 3300028581 | Freshwater | KIGVGIVLGIVLLNIAFWACVILAYLLTTLFECIGKWINK |
Ga0315291_101326332 | 3300031707 | Sediment | MILALKIAVGIVLAIVILNVAFWACIILAYLITTLFECIGKWLNK |
Ga0315291_103287273 | 3300031707 | Sediment | MGNLEMILGLKIGVGIVLGIALINVAFWACIILAYLFATLFECIGKWIKK |
Ga0315291_105046191 | 3300031707 | Sediment | YNPKSRRRVQMILALKIALGIVLGVVILNVAFWGFIILAYLITTLFECIGKWINK |
Ga0315293_101067611 | 3300031746 | Sediment | QMILALKIAVGIVLAVVILNVAFWGFIILAHLIVTLFECIGKWLNK |
Ga0315293_102337682 | 3300031746 | Sediment | MILALKIAVGIVLGIVLINVAFWGFIILAHLIVTLFECIGKWLNK |
Ga0315293_102339533 | 3300031746 | Sediment | MILGLKIGVGIVLGVVILNVAFWGFIILAYLIVTLFECIGKWINK |
Ga0315293_104089062 | 3300031746 | Sediment | MILGLKIGVGIVLGIALINVAFWACIILAYLFATLFECIGKWIKK |
Ga0315288_109540491 | 3300031772 | Sediment | MILGLKIGVGIVLGIVLINVAFWGFIILAYLITTLFECIGKWLNK |
Ga0315297_106150722 | 3300031873 | Sediment | MILGLKIGVGIVLGIVLINVAFWGFIILAYLITTLFECIGKWINK |
Ga0315285_100581994 | 3300031885 | Sediment | MMLALKIAVGIVLAIVILNVAFWAFIILAYLIVTLFECIGKWLNK |
Ga0315285_100727922 | 3300031885 | Sediment | MILALKIALGIVLGVVILNVAFWACIILAYLITTLFECIGKWLNK |
Ga0315285_101176322 | 3300031885 | Sediment | MILALKIALGIVLAVVILNVAFWGFIILAYLIVTLFECIGKWLNK |
Ga0315285_101579964 | 3300031885 | Sediment | MILALKIALGIVLAVVILNVAFWGFIILAYLITTLFECIGKWINK |
Ga0315285_105261151 | 3300031885 | Sediment | MILGLKIGVGIVLGIALINVAFWACIILAYLLATLFECIGKWIKK |
Ga0315285_108320401 | 3300031885 | Sediment | GGIQMILGLKIGVGIVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0315285_109805022 | 3300031885 | Sediment | MILGLKIGVGIVLGIVLLNVAFWACIILAYLLATLFECI |
Ga0315294_100754114 | 3300031952 | Sediment | MILALKIAVGIVLAVVILNVAFWGFIILAYLITTLFECIGKWLNK |
Ga0315294_104517193 | 3300031952 | Sediment | MILGLKIGVGIVLGIVLINVAFWGFIILAHLIVTLFECIGKWLNK |
Ga0315294_106088392 | 3300031952 | Sediment | MILGLKIGVGIVLGVVILNVAFWACIILAYLITTLFECIGKWLNK |
Ga0315294_107336712 | 3300031952 | Sediment | MILALKIALGIVLAIVILNVAFWGFIILAYLIVTLFECIGKWLNK |
Ga0315294_108374962 | 3300031952 | Sediment | MILGLKIGVGIVIGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0315294_114693472 | 3300031952 | Sediment | MILALKIAVGIVLAVVILNVAFWACIILAYLITTLFECIGKWLNK |
Ga0315294_115865112 | 3300031952 | Sediment | MILGLKIAVGIVLAVVILNVAFWGFIILAYLITTLFECIGKWLNK |
Ga0315278_108736702 | 3300031997 | Sediment | MILALKIALGIVLGVVILNVAFWGFIILAYLITTLFECIGKWINK |
Ga0315278_118663221 | 3300031997 | Sediment | MILGLKIGVGIVLGIVLINVAFWACIILVYLITTLFECIGKWLNK |
Ga0315274_103373611 | 3300031999 | Sediment | QMILALKIALGIVLGVVILNVAFWGFIILAYLITTLFECIGKWINK |
Ga0315274_108806822 | 3300031999 | Sediment | MILALKIALGIVLGVVILNVAFWGFIILAYLITTLFECIGKWLNK |
Ga0315274_117767263 | 3300031999 | Sediment | VQMILGLKIGVGIVLGIVLINVAFWGFIILAYLITTLFECIGKWLNK |
Ga0315274_118520881 | 3300031999 | Sediment | SRGGIQMILGLKIGVGIVLGIVLINVAFWGFIILAHLIVTLFECIGKWLNK |
Ga0315289_110347061 | 3300032046 | Sediment | IVLGIVLINVAFWGFIILAYLIVTLFECIGKWINK |
Ga0315905_103833211 | 3300032092 | Freshwater | KIAVGIVLAVVILNVAFWACIILAYLIITLFECIGKWINK |
Ga0315292_108166622 | 3300032143 | Sediment | MILGLKIGVGIVLAIVILNVTFWGFIILAYLITTLFECMGKWLNK |
Ga0315292_110344171 | 3300032143 | Sediment | MILGLKIGVGIVLGIALINVAFWACIILAYLFATLFECIGKW |
Ga0315276_108379133 | 3300032177 | Sediment | MGNLEMILGLKIGVGIVLGIALINVAFWACIILAYLLATLFECIGKWIKK |
Ga0315271_117320811 | 3300032256 | Sediment | RGGVQMILALKIALGIVLGVVILNVAFWGFIILAYLIVTLFECIGKWLNK |
Ga0315286_112392712 | 3300032342 | Sediment | IGVGIVLGIVLINVAFWGFIILAYLITTLFECIGKWINK |
Ga0334722_104424511 | 3300033233 | Sediment | VILGLKIGVGIVLGIVLINVAFWACIILAYLFATLFECIGKWIKK |
Ga0334722_104529472 | 3300033233 | Sediment | MILGLKIGVGIVLGIVLLNIAFWACVVLAYLFATLFECIGKWMNK |
Ga0334981_0001511_6511_6648 | 3300033980 | Freshwater | MILGLKIGVGIVLGIVLINVAFWACIILAYLLTTLFECIGKWIKK |
Ga0334981_0274770_492_629 | 3300033980 | Freshwater | MILGLKIGVGIVLGIVLINVAFWACIILAYLLATLFECIGKWIKK |
Ga0335056_0078687_246_380 | 3300034120 | Freshwater | MLALKIAVGIVLAVVILNVAFWACIILAYLLATLFECIGKWIKK |
⦗Top⦘ |