NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F048067

Metagenome Family F048067

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048067
Family Type Metagenome
Number of Sequences 148
Average Sequence Length 100 residues
Representative Sequence MSSSKPNKKDKGKAIQKAEDYQLQVPTQNQFSLLTKFPPLPYKSAVTNPSSSNSDAYVIRFTEHLLLTSCKPPPSTNIISSIVQKTFGTK
Number of Associated Samples 8
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 81.76 %
% of genes near scaffold ends (potentially truncated) 56.08 %
% of genes from short scaffolds (< 2000 bps) 93.92 %
Associated GOLD sequencing projects 4
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(100.000 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.80%    β-sheet: 0.00%    Coil/Unstructured: 82.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF00078RVT_1 14.19
PF01107MP 0.68
PF00077RVP 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG3577Predicted aspartyl proteaseGeneral function prediction only [R] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009144|Ga0058702_10034998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1889Open in IMG/M
3300009144|Ga0058702_10056297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1481Open in IMG/M
3300009144|Ga0058702_10063812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1389Open in IMG/M
3300009144|Ga0058702_10072573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1299Open in IMG/M
3300009144|Ga0058702_10078626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1246Open in IMG/M
3300009144|Ga0058702_10081376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1224Open in IMG/M
3300009144|Ga0058702_10089545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1167Open in IMG/M
3300009144|Ga0058702_10108749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1057Open in IMG/M
3300009144|Ga0058702_10124284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha989Open in IMG/M
3300009144|Ga0058702_10148884All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha905Open in IMG/M
3300009144|Ga0058702_10163816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha863Open in IMG/M
3300009144|Ga0058702_10194830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha793Open in IMG/M
3300009144|Ga0058702_10258739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha692Open in IMG/M
3300009144|Ga0058702_10295738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha649Open in IMG/M
3300009144|Ga0058702_10311503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha633Open in IMG/M
3300009144|Ga0058702_10324565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha621Open in IMG/M
3300009144|Ga0058702_10326326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha619Open in IMG/M
3300009144|Ga0058702_10334601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha612Open in IMG/M
3300009144|Ga0058702_10351306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha598Open in IMG/M
3300009144|Ga0058702_10368393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha585Open in IMG/M
3300009144|Ga0058702_10379915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha577Open in IMG/M
3300009144|Ga0058702_10383639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha574Open in IMG/M
3300009144|Ga0058702_10386933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha572Open in IMG/M
3300009144|Ga0058702_10387990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha571Open in IMG/M
3300009144|Ga0058702_10399122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha564Open in IMG/M
3300009144|Ga0058702_10410781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha556Open in IMG/M
3300010395|Ga0058701_10041853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4017Open in IMG/M
3300010395|Ga0058701_10044667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3857Open in IMG/M
3300010395|Ga0058701_10050839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3549Open in IMG/M
3300010395|Ga0058701_10075590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2731Open in IMG/M
3300010395|Ga0058701_10105038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2167Open in IMG/M
3300010395|Ga0058701_10120445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1963Open in IMG/M
3300010395|Ga0058701_10122300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1942Open in IMG/M
3300010395|Ga0058701_10123095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1933Open in IMG/M
3300010395|Ga0058701_10128758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1870Open in IMG/M
3300010395|Ga0058701_10133304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1823Open in IMG/M
3300010395|Ga0058701_10146181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1702Open in IMG/M
3300010395|Ga0058701_10146275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1702Open in IMG/M
3300010395|Ga0058701_10159057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1598Open in IMG/M
3300010395|Ga0058701_10165056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1554Open in IMG/M
3300010395|Ga0058701_10183965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus balsamifera1434Open in IMG/M
3300010395|Ga0058701_10186571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus balsamifera1418Open in IMG/M
3300010395|Ga0058701_10203618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1328Open in IMG/M
3300010395|Ga0058701_10232251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1203Open in IMG/M
3300010395|Ga0058701_10247154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1148Open in IMG/M
3300010395|Ga0058701_10288853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1021Open in IMG/M
3300010395|Ga0058701_10306844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta976Open in IMG/M
3300010395|Ga0058701_10335954All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha913Open in IMG/M
3300010395|Ga0058701_10360065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta868Open in IMG/M
3300010395|Ga0058701_10360143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha867Open in IMG/M
3300010395|Ga0058701_10373685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha845Open in IMG/M
3300010395|Ga0058701_10396370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha809Open in IMG/M
3300010395|Ga0058701_10412061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta787Open in IMG/M
3300010395|Ga0058701_10428281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha766Open in IMG/M
3300010395|Ga0058701_10437961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha754Open in IMG/M
3300010395|Ga0058701_10455476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha734Open in IMG/M
3300010395|Ga0058701_10473325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha714Open in IMG/M
3300010395|Ga0058701_10485712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha702Open in IMG/M
3300010395|Ga0058701_10546787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta649Open in IMG/M
3300010395|Ga0058701_10547236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha648Open in IMG/M
3300010395|Ga0058701_10572209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha630Open in IMG/M
3300010395|Ga0058701_10646969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha583Open in IMG/M
3300010395|Ga0058701_10655132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha579Open in IMG/M
3300010395|Ga0058701_10659185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha577Open in IMG/M
3300010395|Ga0058701_10736486All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta540Open in IMG/M
3300010395|Ga0058701_10744211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha537Open in IMG/M
3300010395|Ga0058701_10775282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha524Open in IMG/M
3300010395|Ga0058701_10837828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha502Open in IMG/M
3300010395|Ga0058701_10843467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha500Open in IMG/M
3300027718|Ga0209795_10105577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha805Open in IMG/M
3300027766|Ga0209796_10099050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha897Open in IMG/M
3300027766|Ga0209796_10115640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha830Open in IMG/M
3300027766|Ga0209796_10306755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha511Open in IMG/M
3300030495|Ga0268246_10015516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2273Open in IMG/M
3300030495|Ga0268246_10025383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1745Open in IMG/M
3300030495|Ga0268246_10027199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1682Open in IMG/M
3300030495|Ga0268246_10030284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1589Open in IMG/M
3300030495|Ga0268246_10066840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1048Open in IMG/M
3300030495|Ga0268246_10072660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1003Open in IMG/M
3300030495|Ga0268246_10079719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa955Open in IMG/M
3300030495|Ga0268246_10081238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa946Open in IMG/M
3300030495|Ga0268246_10083121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha935Open in IMG/M
3300030495|Ga0268246_10111328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha802Open in IMG/M
3300030495|Ga0268246_10113948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha792Open in IMG/M
3300030495|Ga0268246_10117081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales781Open in IMG/M
3300030495|Ga0268246_10125896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha752Open in IMG/M
3300030495|Ga0268246_10137272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha719Open in IMG/M
3300030495|Ga0268246_10146626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha695Open in IMG/M
3300030495|Ga0268246_10156367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha673Open in IMG/M
3300030495|Ga0268246_10157600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha670Open in IMG/M
3300030495|Ga0268246_10168217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha648Open in IMG/M
3300030495|Ga0268246_10181972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha623Open in IMG/M
3300030495|Ga0268246_10183014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha621Open in IMG/M
3300030495|Ga0268246_10190363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha609Open in IMG/M
3300030495|Ga0268246_10191900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha606Open in IMG/M
3300030495|Ga0268246_10194637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha602Open in IMG/M
3300030495|Ga0268246_10262921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha519Open in IMG/M
3300030495|Ga0268246_10267535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha515Open in IMG/M
3300030495|Ga0268246_10273106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha510Open in IMG/M
3300030495|Ga0268246_10280775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha503Open in IMG/M
3300030495|Ga0268246_10282006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha502Open in IMG/M
3300030498|Ga0268247_10002814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4702Open in IMG/M
3300030498|Ga0268247_10024094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2244Open in IMG/M
3300030498|Ga0268247_10027781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2139Open in IMG/M
3300030498|Ga0268247_10062170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1586Open in IMG/M
3300030498|Ga0268247_10070671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1504Open in IMG/M
3300030498|Ga0268247_10083290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1405Open in IMG/M
3300030498|Ga0268247_10089064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1365Open in IMG/M
3300030498|Ga0268247_10112834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1227Open in IMG/M
3300030498|Ga0268247_10123597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1176Open in IMG/M
3300030498|Ga0268247_10131801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1141Open in IMG/M
3300030498|Ga0268247_10137610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1118Open in IMG/M
3300030498|Ga0268247_10138771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1113Open in IMG/M
3300030498|Ga0268247_10141387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1103Open in IMG/M
3300030498|Ga0268247_10150987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1069Open in IMG/M
3300030498|Ga0268247_10167333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1014Open in IMG/M
3300030498|Ga0268247_10173343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha996Open in IMG/M
3300030498|Ga0268247_10198739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta928Open in IMG/M
3300030498|Ga0268247_10251885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha816Open in IMG/M
3300030498|Ga0268247_10269718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha786Open in IMG/M
3300030498|Ga0268247_10287172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha758Open in IMG/M
3300030498|Ga0268247_10287795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales757Open in IMG/M
3300030498|Ga0268247_10296026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha745Open in IMG/M
3300030498|Ga0268247_10313995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha720Open in IMG/M
3300030498|Ga0268247_10318048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta715Open in IMG/M
3300030498|Ga0268247_10322436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha710Open in IMG/M
3300030498|Ga0268247_10322627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha709Open in IMG/M
3300030498|Ga0268247_10325791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha705Open in IMG/M
3300030498|Ga0268247_10335204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha694Open in IMG/M
3300030498|Ga0268247_10342170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha686Open in IMG/M
3300030498|Ga0268247_10353316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha673Open in IMG/M
3300030498|Ga0268247_10368325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha657Open in IMG/M
3300030498|Ga0268247_10371179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha654Open in IMG/M
3300030498|Ga0268247_10391133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha634Open in IMG/M
3300030498|Ga0268247_10397368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha628Open in IMG/M
3300030498|Ga0268247_10421570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha607Open in IMG/M
3300030498|Ga0268247_10422170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha606Open in IMG/M
3300030498|Ga0268247_10428587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha601Open in IMG/M
3300030498|Ga0268247_10432827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha597Open in IMG/M
3300030498|Ga0268247_10464043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha573Open in IMG/M
3300030498|Ga0268247_10470739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha568Open in IMG/M
3300030498|Ga0268247_10481489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha560Open in IMG/M
3300030498|Ga0268247_10505739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha544Open in IMG/M
3300030498|Ga0268247_10531017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta528Open in IMG/M
3300030498|Ga0268247_10533993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha527Open in IMG/M
3300030498|Ga0268247_10579964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha501Open in IMG/M
3300030515|Ga0268254_10215419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta629Open in IMG/M
3300030516|Ga0268255_10155867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha668Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave100.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030515Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2)Host-AssociatedOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058702_1003499833300009144AgaveMSSSKPNKKDKGKAIQRAEDYQLQIPVQNQFAPLAKTQFPPLPCKTAVTNLSSSTNDYMIRFTEHLLLTSCKPPPPTNIISNIVQKS*
Ga0058702_1005629733300009144AgaveMSSSKNKKDKGKAIQKAEDYQLQIPTQNQFAPLQTQFPPLPYKTAVTNPSSSTPADAYIIRHIEHLLLTSCKPPPPTNIISSITQKTFGPIISLRMISVSPKNSTS*
Ga0058702_1006381223300009144AgaveMSSSKHPSKKDKGKEVQKAEDYQLQVSTKNQFLPLANFLPLPYKTTVTNPAPSSNPNDAYIIRHAEHLLLISCKNITTHKCHPKYS*
Ga0058702_1007257343300009144AgaveMSSSKPKKDKGKVIQKAEDYQLQIPTQNQFMALAQTQFPPLPYKNAITNASSSATVEAYMIRFTEHLLLTSCKPFPPTNIISDIVQKTFGPNHFATNDLRKSQK
Ga0058702_1007862613300009144AgaveGTNMSSSKPTKKDKGKAIQKAEDYQLQVPVQNPSLPYKTAVTNPSSSQSADAYLIRCNEHLLLTSCKPPPPINIISNIVQNHLAIISLPLMICANHKSSTS*
Ga0058702_1008137613300009144AgaveMSKQPNKKDKGKAVQKAEDYQLQIPVQNQFAPLTQTQFPPLPYKTAVTNPTSSSSTNYYIIRFTEHLLLTSCKPPPPTSIISSIIQKTFGSHYFATDDLRKSQKFYKLI
Ga0058702_1008954543300009144AgaveMSKQPNKKDKGKAVQKAEDYLLQIPVQNQFTPLTFPPLPYKNAVTNPSSSSSTNEYVIRFTEHLLLTSCKPPSPTNIISSIV*
Ga0058702_1010874913300009144AgaveMSSSKNKKDEGKTIQKAEDYQLQIPVQNQFAPLTQTQFLPLPYKTAVTNPSLSSSTNDYIICFTEHLLLTSCKPPPPTNII
Ga0058702_1012428423300009144AgaveMSSSKNPNKKDKGKAIQRAEDYQLRIPTQNQFTPLTQTQFPPLPYKTVVTNPSPSNPADTYVIRFTEHLLLTSCKPPPPTNIISSIVQENLWNKPFCYG*
Ga0058702_1014888413300009144AgaveMSRQPNKKDKGKAVQKAEDYQLQIAVQNQFTPLTFPPLPYKNAVTNPSSSSSTNDYVIRFTEHLLLTSCKPPPPTNIISSIVQKTFGTNHLATDDLRMTQKFYELILVDTHSVSITHT
Ga0058702_1016381623300009144AgaveMSKQPQKKDKGKAVQKAEDYQLQVPVQNQFPPLAFPPLPYKQAITNPTSSASTNEYTIRFTEHLLLTSCKPPPPTNIISSIVQKHLGQTTLLWMISIIPKNIMS*
Ga0058702_1019483023300009144AgaveMSSSKHPQKKDKGKVVQRAEDYQVQTLTQNQFTPLNNFPPLPYKTAVTNPSPSNSADAYVVRHTEHLLFTSCKPPPPSNIISSITQKNIWSKPIRNG*
Ga0058702_1025873923300009144AgaveMSKQPQKKDKGTAVQKAEDYQLQVPVQNQFPPLAFPPLPYKQAVTNPTSSASTNEYTIRFTEHLLLTSCKPPPPTNIISSIVQKTFRPNNFATDDLR*
Ga0058702_1029573813300009144AgaveMSSSKPNKKDKEKAIQKAKEYQLQVPTQNQFLPLSNFPPLPYKSAVTNPSSSNSADAYVIRFTEHLLLTSCKPPPPTTIISSIVQKTYGTKHYATDD
Ga0058702_1031150313300009144AgaveMSSGKPNKKDKGKAIQKAEDYQLQVPTQNQFSPLTNFPPLPYKSAVTNPSSSTSDAYIVRFSEHLLLTSCKPPPPANIISSIVQKTFGTKHYATDDLRKT
Ga0058702_1032456513300009144AgaveKGKAVQKAEDYQLQILVQNQFTPLTNFPPLPYKHAVTNPSSSNSTNDYVIRFTEYLLLTSCKPPPPTNIISSIVQKTFVTKSLRYG*
Ga0058702_1032632613300009144AgaveYKFLSAGHKMSCSKHPGKKDKGKAIQKAEDYQLQVPTKNQFLSLTNFPPLPYKTAVPNPAPSSNPNNAYIVRHVEHLLLTSCKT*
Ga0058702_1033460113300009144AgaveMSSSHHPNKTDKGKAVQKAEDYQLQIPTQNQFTPLTNFPPLPYKTAVTNPSSNPTDAYIIRYTKHLLLTSCKPPPPINIISSIVQKTFGPNHFATDDLRRTQKFYKLILIDTNSV
Ga0058702_1035130613300009144AgaveMSKQPQKKDKGKAVQKAEDYQLQVPIQNQFAPLAFPRLPYKQAVTNPTSSSSTNEYHIRFTEHLLLTSCKPPPPTNIISSIVQK
Ga0058702_1036839313300009144AgaveMSSSKKKDKGKAIQKAEDYQLQVPVQNQFSPLQTQFPPLPYKTAVTNPSSSNPTDAYVIRHIEHLLVTSCKPPPPRNIISSITQKTFGPHHFATDDLRKSQKFYELI
Ga0058702_1037991513300009144AgaveMQGEMSSSKNKNKKDKGKAIQTAEDYQLQVPVQNQFTPLTQNQFPPLPYKTVVTNPSPSSSTNDYMTRFIEHILLTSCKPPPPKNIISSIIQKTFGLHQFATDDLRKSQKFYELILVDSQSVSIT
Ga0058702_1038363913300009144AgaveMSSSKNPGKKDKGKAIQKAEDYQLQVPTKNQFLPLVNFPPLPYKTAVTNQAPSANPNNAYIVHHIKHLLLTSCKTLPTTNVIPNIIQKTFGSIHFAMDDLRRTQQFYE
Ga0058702_1038693313300009144AgaveMSSSKNKSKKDKGKAIQKAEDYQLQIPAQNQFTPLTQTQFPQLPYKIAVRNPNSSSSTNDYMIRFIEHIRLTSCKPPPPTNIIPS
Ga0058702_1038799013300009144AgaveVSKQPNRKDKGKAAQKAEDYQLQIPVQNQFTPLTFPPLPYKNAVTNPCSSSSTNDYVIRFTEHLLLTSCKPPPPTNIISSIVQKTFGTN*
Ga0058702_1039912223300009144AgaveMSSSKPNKKDKRKAIQKGEDYQLQVPTQNQFSPLTNFPPLLYKSAVTKPSSSNSDAYVIRFTEHLLLTSCKPPPPTNIISSIV*
Ga0058702_1041078123300009144AgaveMSSNKPKKDKGKAIQRAEDYQLAIPTQNQFTPLTQTQFPPLPYKNAITNPSSSNAPEAYMIRFTEHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDLRKTQK
Ga0058701_1004185353300010395AgaveMSSSKNPNKKDKGKAVQKTEDYQLSVSTKNQFAPLNKFPPLPYKTAVTNPAPSNPNDAYIVRHIEHLLLTSCKSLPSTNIISSILQKTFGVFHYATDDTQRTQ*
Ga0058701_1004466713300010395AgaveMSSSKPKKDKGKAIQRAEDYQLQIPTQNQFMALAQTQFPPLPYKNAITNASSLATVEAYMIRFTEHLLLTSCKPFPPTNIISDIVQKTFGPNHFATNDLRKSQK*
Ga0058701_1005083943300010395AgaveMSSSKHPSKKDKGKEVQKAEDYQLQVSTKNQFLPLANFLPLPYKTTLTNPAPSSNPNDAYIIRHAEHLLLISCKNITTHKCHPKYS*
Ga0058701_1007559053300010395AgaveMSSNKPSKKDKGKAIQKAEDYQLQITTQNQFTPLAQINFPPLPYKTAVTNPSASNSADVYTIRFTEHLLLTSCKPPPPTNIISNIVQKSFGINHFATDDLRKTQKFYELILC*
Ga0058701_1010503833300010395AgaveMSKQPQKKNKGKAVQKAEDYQLQVPVQNQFAPLTFPPLPYKQAVTNPTSSSSTNEYTIRFMEHLLLTSCKPPPPTNIISKSYILFW*
Ga0058701_1012044543300010395AgaveMSSSKHPSKKHKGKAVQKAEDYQLQVPTKNQFLPLANFPPLPYKTTVTNPAPSPNPNDAYIVHHIEHLLLTSCKTLPPTNVIPSILQKIFGSNHFATDDFHRTQ*
Ga0058701_1012230033300010395AgaveMSCSKHPGKKDKGKAIQKAEDYQLQVPTKNQFLSLTNFPPLPYKTAVPNPAPSSNPNDAYIVRHVEHLLLTSCKTLPTANVIPSIIQKTFGSTHFATNDLRRTQ*
Ga0058701_1012309533300010395AgaveMSSSKHPQKKDKGKAVQRAEDYQLQIPTQNQFTPLNNFPPLLNKTAVTNPSSSNSANAYVVRHIEHLLLTSCKPPPPTNIISSIT*
Ga0058701_1012875823300010395AgaveMSSSKNKKDEGKTIQKAEDYQLQIPVQNQFAPLTQTQFLPLPYKTAVTNPSLSSSTNDYIICFTEHLLLTSCKPPPPTNIISSIIQKTFGPHHFATDDLRKSQKFYELILVDT*
Ga0058701_1013330433300010395AgaveMSKQPNKKDKGKAVQKVEDYQLQIRVQNQFAPLTQTQFPPLPYKTAVINPTSSSSTNDYIIRFTEHLLLTSCKPPPPTNIISSIIQKTFGPHHFATDDL
Ga0058701_1014618143300010395AgaveMSKQPNKKDKGKAVQKAEDYQLQIPVQNQFTPLTNFPPLPYKNAVTNPSLSNSTNDYVIRFTEHLLLTSCKPPPPTNIISSIVQKA*
Ga0058701_1014627543300010395AgaveMSSSKNPNKKDKGKAVQKAEDCQLSVRIKNQFAPLDKFPPLPYKTVVTNPGNSNPNDAYIFRHIEHLLLSSCKSLPPTNIISSILQKSFGLFHYATDDPQR
Ga0058701_1015905743300010395AgaveMSSGKPNKKDKDKAIQRAEDYQLQIPTQNQFTPLTQTQFPPLPYKTAVTNPSPSNPADAYVIRFTERLLLTSCKPPPPTNIISNIVQKTFGTKHFATDDLRQTQKF*
Ga0058701_1016505623300010395AgaveMSSSNHPNKKDKGKAVQKAEDYQLQIPTQNQFAPLTNFPPLPYKTAVTNHPSSNPTDAYIIRYTEHLLLTSCKPPPPTNIISSIVQKILVQIILLRMTSVAHKSSMN*
Ga0058701_1018396533300010395AgaveMSSSKNKKDKGKAIHKAEDYQLQIPTQNQFAPLQTQFPPLPYKTAVTNPSSSTPADAYIIRHIEHLLLTSCKPPPPTNIISSITQKTFGPHHFATDDLRKSQKF*
Ga0058701_1018657133300010395AgaveMSSSKQSQKKDKEKAIQTTADYQLQIPSQNQFTTLTANLPLLPYKAAVTNPSPSNTADSYVIRHTEHLVLSSCKPPPPTNIIHSIVQKTFGPNHHFAADNLRKTQKFYELILVDTNSLSLTHTFDKYHPA*
Ga0058701_1020361823300010395AgaveMSKQPNKKDKGKAVQKVEDYQLQIPVQNQFTPLTFPPLPYKNTVTNPSSSSSTNDYIICFTKHLLLTSCNPLLRQILFQVLIKRHLEQITSLRMISV*
Ga0058701_1023225123300010395AgaveMSKQPNRKDKGKAVQKAEDYQLQIPVQNQFTPLTFPPLPYKNAVTNPSSSSSTNDYVIRFTEHLLLTSYKPPPPTNIISSVVQKTSGTNHFATDNLRMTQKNL*
Ga0058701_1024715423300010395AgaveMSSSKPKKDKGKAIQKADDYQLQVPVKNQFTPLTFPPLPYKQAVSNPTSLSSTNDYTIRFTEHLLLTSCKPPPPTTIISSIVQKS
Ga0058701_1028885323300010395AgaveMSSSKNKKDKGKVVQKAEDYQLQIPIQNQFAPLTQTQFPPLPYKTAVTNPSSCNSTNDYMIRFAEHLLQTSCKPPPFTNIISSIIQKTFGPHHFATDDLRKSQKFYELI
Ga0058701_1030684423300010395AgaveMSSSKPNKKDKRKAIQKGEDYQLQVPTRNQFSPLTNFPPLLYKSAVTKPSSSNSDAYVIRFTEHLLLTSCKPPPPTNIISSIV*
Ga0058701_1033595423300010395AgaveVQKAEDYQLQIPVQNQFTPLTFPPLPCKHPVTNPSSSSSANDYIIRFTEHLLLTSCKPPPPINIISSIVQRPLEQITSQWITSV*
Ga0058701_1036006523300010395AgaveMSSSKNPGNKDKGKAVQKAEDYQLQVSTKNQFLPLANFPPLAYKTAVTNPASTANPNDAYIVRHVEHLLLTSCKILLPIIVTSSIL*
Ga0058701_1036014313300010395AgaveCFFAGSIMSKQPNKKDKGKAVQKAEDYLLQIPVQNQFTPLTFPPLPYKNAVTNPSSSSSTNEYVIRFTEHLLLTSCKPPSPTNIISSIV*
Ga0058701_1037368513300010395AgaveMCSGKPNKKDKGKATQRAEDYQLQIPTQNQFTPLTQTQFPPLPYKTTVTNPSPSANAYVIRFTEHRLLTSCKPPPPTNIISSIVQKTFGTKYFTTDDLQKGQKFYELILVDTHSVSLTHTF*
Ga0058701_1039637013300010395AgaveMSSSKPNKKDKGKAIQKVEDYQLQVPIQNQFSPLTNFPPLPYKSAVTNPSSSNSDAYVIRFTEHLLLTCCKPPPPTNIISSIVQKTFGTKHYATDDLRKTQKFYE
Ga0058701_1041206123300010395AgaveMSSSKNKNKKDKGKAIQTAEDYQLQIPVQNQFTPLTQTQFPLLPYKTAVTNPTSSNLTNDYMIRFTGHLLLTSCKPPPPTNIISGIIQKTF
Ga0058701_1042828123300010395AgaveMSSSKNKNKNKKDKGKAIQKAEDYQLQIPIQNLFTPLTQTQFPPLPYKTAVTNPSSSNPTNDYMIRFTEHLLLTSCKRPPPTNIISSIIQKTFGLD*
Ga0058701_1043796123300010395AgaveMSSCKPNKKDKGKAIQKVEDYQLQVPTQNQFSPLTNFPPLPYKSAVTNPSSSNSDAYVNRFTEHLLLTSCKPPPPTNIISSIVKKTYGTKHFATDNLRKTQKFYELILVDTNSVSLHPKSSQMG*
Ga0058701_1045547623300010395AgaveMSSNKPKKDKGKAIQRVEDYQLTIPTQNQFQPSTQTQFPPLPYKNAITNPSSSNSSEAYMVRFREHLLLRSCKPPAPTNIISEIVQKSFGTNHFATDDPLKHTNSMS*
Ga0058701_1047332523300010395AgaveLQETSDTNNSAQEQKMSSSKNKSKKDKGKAIQKAEDYQLQIPVQNQFTPLTQTQFLPLPYKTAVTNPNSSSSTNDYMIRFIEHILLTSCKPPP
Ga0058701_1048571223300010395AgaveMSSGKPNKKDKGKAIQKAEDYQLQVPTQNQFSPLTNFPPLPYKSAVTNPSSSTSDAYIVRFSEHLLLTSCKPPPPANIISSIVQKTFGTKHYATDDLRKT*
Ga0058701_1054678723300010395AgaveMSSSKNSNKKDKGKAVQKAEDYQLQVPTKNQFLPLDKFPPLPYKMAVTNPAPSNPNDAYVGRHIEHLLLTSCKTLPTTNIIPSIT
Ga0058701_1054723613300010395AgaveMSSNKPKEDKGKAIQRAEDYQLAIPTQNQFTPLTQTQFPPLPYKYAITNPSSSNAPEAHMIRFTEHLLLTSCKPPAPTNIISEIVQK
Ga0058701_1057220913300010395AgaveYDFAGTNTSSSKPTKKDKGKAIQKAEDYQLQVPVHNQFAPLSQNQFPPLPYKTAVTNPSSSSDAYLIRYNEHLLLTSCKPPPPINIISNIV*
Ga0058701_1064696913300010395AgaveMSSSKSNKKDKGKAIQKAEDYQLQVPTQNEFSPLTNFPRLPYKSAVTNPSSSNSADAYVIRFTTHLLLTSCKPPPPTNIISSIVQKTYGTKHYATDDLRKTQKFYELIL
Ga0058701_1065513223300010395AgaveMSPSKNKNKNKNDKGKAIQKAEDYQLQIPVQNQFAPLTQTQFPSLPYKTAVTNPASSRSTNDYMIRFTEHLLLTSCKPPPPTNIISSIIQKTFGPHHFATDDLRKSQKFYELILVDTQS
Ga0058701_1065918523300010395AgaveMSSSKPTKKDKGKAIQKAEDYQLQVPVQNQFTPLAFPPLPYKQAITNPTSSSSTNEYTIRFTEHLLLTSCKPPRPTNIISSIVQKSFGRHHFATDDLRKSQKF*
Ga0058701_1073648613300010395AgaveMSSSKPTKKDKGKAIQKAEDYQLQIPTQNQFAPLAQNQFPPLPYKTAVTNPSSSNSADAYLIRYNEHLLLTSCKPPPPTNII
Ga0058701_1074421113300010395AgaveMSSSHHPNKTDKGKAVQKAEDYQLQIPTQNQFTPLTNFPPLPYKTAVTNPSSNPTDAYIIRYTEHLLLTSCKPPPPTNIISSI
Ga0058701_1077528213300010395AgaveMSKQPQKKDKGKAVQKAEDYQLQVPVQNQFPPLAFPPLPYKQAITNPTSSASTNEYTIRFTEHLLPTSCKPPPPTNIISSIV
Ga0058701_1083782813300010395AgaveIGTNMSSSKPTKKDKGKAIQKAEDYQLQVPVQNPSLPYKTAVTNPSSSQSADAYLIRCNEHLLLTSCKPPPPINIISNIVQNHLAIISLPLMICANHKSSTS*
Ga0058701_1084346723300010395AgaveMSSSKPKKDKGKAIQTAEDHQLQVRVQNQFTHLTFPPLPYKQAVSNPTSSSSTNDYTIRFTEHLLLTSCKPP
Ga0209795_1010557723300027718AgaveMSSSKNKKDKGKAIQKAEDYQLQIPTQNQFAPLQTQFPPLPYKTAVTNPSSSTPADAYIIRHIEHLLLTSCKPPPPTNIISSITQKTFGPHHFATDDLRKSQKF
Ga0209796_1009905023300027766AgaveMSSNKPKKDKGKAIQRAEDYQLAIPTQNQFTPLTQTQFPPLPYKNAIINPSSSNAPEAYMIRFAEHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDLRKTRKFL
Ga0209796_1011564023300027766AgaveMSSSKNKNKKDKGKAIQKAEDYQLQIPVQNQFTPLTQTQFPPLPYKTAVTNPNSSSSTNDYMIRFIEHILLTSCKPPPPTNIIPS
Ga0209796_1030675523300027766AgaveMSSSKNSNKKDKGKAVQKAEDYQLQVPTKNQFLPLDKFPPLPYKMAVTNPAPSNPNDAYVGRHIEHLLLTSCKTLPTTNIIPSITPKT
Ga0268246_1001551613300030495AgaveLKYVSAGTNMSKQPQKKNKGKAVQKAEDYQLQVPVQNQFAPLTFPPLPYKQAVTNPTSSSSTNEYTIRFMEHLLLTSCKPPPPTNIISKSYILFW
Ga0268246_1002538333300030495AgaveMSSSKPNKKDKGKAIQRAEDYQLQIPVQNQFAPLAKTQFPPLPCKTAVTNLSSSTNDYMIRFTEHLLLTSCKPPPPTNIISNIVQKS
Ga0268246_1002719943300030495AgaveMSSSKHPGKKEKGKAVQKAEDYQLQVPTKNQFLPLINFPPLPYKTAVTNPAPSNPNNAYIVCHIEHLLLTSCKTLPTTNVIPNIIQKTFGST
Ga0268246_1003028413300030495AgaveMSSSKPKKDKGKAIQRAEDYQLHVPTQNQFTPLAQTRFPPLPYKNAITNPSSSNTAEAYMIRFTEHLLLTSCKPPAPTNIISVIVQKTFGNHQFATNDLRKSQKFYELILVHTNSVSLTHTYDIY
Ga0268246_1006684023300030495AgaveMSSSKNKKDEGKTIQKAEDYQLQIPVQNQFAPLTQTQFLPLPYKTAVTNPSLSSSTNDYIICFTEHLLLTSCKPPPPTNI
Ga0268246_1007266023300030495AgaveMSSSKPTKKDKGKAIQKAEDYQLQVPVQNQFAPLSQNQFPPLPYKTAVTNPSSSQSANAYLIRCNEHLQLTSCKPPPPTNIISNIVQK
Ga0268246_1007971913300030495AgaveMSSSKNPGKHDKGKAVQKAEDYQLQVPTKNQFLPLQNFPPLPYKTAVTNAAPSSNSNDAYIVRHVEHLFLTSCKTLPKTNVISSILQKTFGSIHYT
Ga0268246_1008123813300030495AgaveMSSSNHPNRKDKGKSVQKAEDYQLQIPTQNQFTPLTNFPPLPYKTAVTNHSSSNLADAYIIRYTEHLLLASCKPPPPTNIISSIVQKTFGPNHFATDDLRRTQKFYELILVDTNSV
Ga0268246_1008312123300030495AgaveMSSSKPTKKDKGKAIQRAEDYQLQIPTQNQFTPLTQTQFPPLPYKNAITNPSSSNMAEAYMIRFTEHLLLTSCKPPAPTNLISEIVQKTFGDAAFCH
Ga0268246_1011132823300030495AgaveMSSSKHPSKKDKGKEVQKAEDYQLQVSTKNQFLPLANFLPLPYKTTVTNPAPSSNPNDAYIIRHAEHLLLISCKNITTHKCHPKYS
Ga0268246_1011394813300030495AgaveSKNNNKKDKGKAIQRAEDYQIPVQNQFIPLTQTQFPPLPYKTAVTNPNSSSSTNEYMIRFTEHILLTSCKPPPPTNIISSIT
Ga0268246_1011708133300030495AgaveMSSSKNPSKKDKGKAVQKAEDYQLQVPTNNQFLPLQNFPPLPYKTAVTNPAPSPNSNDAYIVRHVEHLLLTSCKTLPQTNVISSILQKTFGSIHYATDEPRRTQQFYELILVD
Ga0268246_1012589613300030495AgaveMSSSQNKKDKGKAVQKAEDYQLQIPIQNQFAPLTQTQFPPLPYKTAVTNPSSCNSTNDYMIRFAEHLLQTSCKPPPPTNIISSIIQKTFGPHHFATDDLRKSQKFYELILVDTQSVSITHTFD
Ga0268246_1013727223300030495AgaveMSSSKPTKKDKGKAIQKAEDYQLQVPVQNPSLPYKTAVTNPSSSQSADAYLIRCNEHLLLTSCKPPPPINIISNIVQNHLAIISLPLMICANHKSSTS
Ga0268246_1014662623300030495AgaveMSLSNHPNKKDKGKAVTKAEDYQLQISTQNQFTPLTNFPPLPYKTAVTNHSSNPTDAYIIRYTEHLLLTICKPPPPTNIISSIVQKTFGPNHFATDDLRRTQKFYEVILVDTNSVSITHTFDKYHPA
Ga0268246_1015636713300030495AgaveMSKQPQKKDKGKAVQKAEDYQLQVPVQNQFAPLAFPPLTYKQAVTNPTSSASTNEYTIRFTEHLLLTSGKPPPPTNIISSIVQKTFGPNNFATDDLRCTQKYYGLILVDTQSVSITHTYD
Ga0268246_1015760013300030495AgaveMSSGKPNKKDKGKAIQRAEDYQLQILTQNQFTPLTQTQFPPLPYKTAVTNPSPSNLVDAYVIRFTEHLLLTSCKPPPPTNIISSIVQKNLWNKPFRYG
Ga0268246_1016821713300030495AgaveMSKQPNKKDKGKAVQKVEDYQLQIPVQNQFAPLTQTQFPPLPYKTAVTNPTSSSSTNDYIIRFTEHLLLTSCKSPPLTNIISSIIQKTFGPHHFATNDLRKSQKFYELILVDTQ
Ga0268246_1018197213300030495AgaveMSSSKQSQKKDKEKAIQTTADYQLQIPSQNQFTTLTANFPLLPYKAAVTNPSPSNTADSYVIRHTEHLVLSSCKPPPPTNIIHSIVQKTFGPNHHFAADNLRKTQKFYELILVDTNSLSLTHTFDKYHPA
Ga0268246_1018301423300030495AgaveNKGKAVQKAEDYQLQILVQNQFTPLTNFPPLPYKHAVTNPSSSNSTNDYVIRFTEYLLLTSCKPPPPTNIISSIVQKTFVTKSLRYG
Ga0268246_1019036323300030495AgaveMSKQPQKKDKGKAVQKAEDYQLQVPVQNQFPPLAFPPLPYKQAITNPTSSASTNEYTIRFTEHLLLTSCKPPPPTNIISSIVQKHLGQTTLLWMISIIPKNIMS
Ga0268246_1019190013300030495AgaveMSSSKPNKKDKGKAIQKVEDYQLQVPIQNQFSPLTNFPPLPYKSAVTNPSSSNSDAYVIRFTEHLLLTCCKPPPPTNIISSIVQKTFGTKHYATDD
Ga0268246_1019463713300030495AgaveMSSSKKKDKGKAIQKAEDYQLQVPVQNQFSPLQTQFPPLPYKTAVTNPSSSNPTDAYVIRHIEHLLVTSCKPPPPRNIISSITQKTFGPHHFATDDLRKSQKFYELILVDTQ
Ga0268246_1026292123300030495AgaveMSSSKPNKKDKGKAIQKAEDYQLQVPTQNQFSLLTKFPPLPYKSAVTNPSSSNSDAYVIRFTEHLLLTSCKPPPSTNIISSIVQKTFGTK
Ga0268246_1026753523300030495AgaveMSSNKPTKKDKGKAIPKAEDYQLQVSTQNQFTPLTQTQFPPLPYKIAVTKPATSSSTNEYTIRFTEHLLLTSCKPPPPTNII
Ga0268246_1027310613300030495AgaveMSSSKPNKKDKEKAIQKAKEYQLQVPTQNQFLPLSNFPPLPYKSAVTNPSSSNSADAYVIRFTEHLLLTSCKPPPPTTIISSIVQKTYGTKHYATDDLRKT
Ga0268246_1028077513300030495AgaveMSSSKPNKKDKGKAIQKAEDYQLQVPTQNQFLPLTNFHPLPYKSAVTNPSSSNSDAYIIRFTEHLLLTNCKPPPPTNIISSIVQKTYGTKHYATDDLR
Ga0268246_1028200623300030495AgaveMSSSKNKEDKGKAIQKAENYQLQIPVQNQFTPLTQTQFPPLPYKTVITNPTSSSSTNDYTIRFTEHLLVTSCKPPPPNNIISSIVQKS
Ga0268247_1000281453300030498AgaveMSSSKNPNKKDKGKAVQKTEDYQLSVSTKNQFAPLNKFPPLPYKTAVTNPAPSNPNDAYIVRHIEHLLLTSCKSLPSTNIISSILQKTFGVFHYATDDTQRTQ
Ga0268247_1002409433300030498AgaveMCSGKPNKKDKGKATQRAEDYQLQIPTQNQFTPLTQTQFPPLPYKTTVTNPSPSANAYVIRFTEHRLLTSCKPPPPTNIISSIVQKTFGTKYFTTDDLQKGQKFYELILVDTHSVSLTHT
Ga0268247_1002778133300030498AgaveMSSSNHPNKKDKGKAVQKAEDYQLQIPTQNQFAPLTNFPPLPYKTAVTNHPSSNPTDAYIIRYTEHLLLTSCKPPPPTNIISSIVQKILVQIILLRMTSVAHKSSMN
Ga0268247_1006217013300030498AgaveMSKQPQKKNKGKAVQKAEDYQLQVPVQNQFAPLTFPPLPYKQAVTNPTSSSSTNEYTIRFMEHLLLTSCKPPPPTNIISKSYILFW
Ga0268247_1007067133300030498AgaveMSSSKQSQKKDKEKAIQTTADYQLQIPSQNQFTTLTANLPLLPYKAAVTNPSPSNTADSYVIRHTEHLVLSSCKPPPPTNIIHSIVQKTFGPNHHFAADNLRKTQKFYELILVDTNSLSLTHTFDKYHPA
Ga0268247_1008329013300030498AgaveMSSSKPNKKDKGKAIQKAEDYQLQVPTQNQFFPLTNFHPLPYKSAVTNPSSSNSDAYIIRFTEHLLLTNCKPPPPTNII
Ga0268247_1008906423300030498AgaveMSASKQPQQKDKGKAIQIAADYQLQIPAQNQFTPLSANFQPLPYKAAVTNPSPSNPTDAYVIQHTEHLLLTCCKPPPPTNIIPSIVQKTIRSNHDFATDDLHKT
Ga0268247_1011283413300030498AgaveMQGEMSSSKNKNKKDKGKAIQTAEDYQLQVPVQNQFTPLTQNQFPPLPYKTVVTNPSPSSSTNDYMTRFIEHILLTSCKPLPPKKYYL
Ga0268247_1012359733300030498AgaveMSSIKPKKDKGKAIQRAKDYQLAIPTQNQFTPLTQTQFPPLPYKNAIANPSSSNAPEAYMIRFTEHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDL
Ga0268247_1013180113300030498AgaveMSSSKPKKDKGKAIQRAEDYQLAIPTQNQFQPLTQTQFPPLPYKNAITNLSSFNSAEAYMVRFIEHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDLRKTQKFYELILV
Ga0268247_1013761013300030498AgaveMSARKQLQKKDKGKAIQTAADYQLQIPTQNQFTPLSANFPPLPYKAAVTTPSPSNPADAYVIRRTEHLLLTSCKPPPPTNIIPSIVQKTFGSNDRSATDDLHKT
Ga0268247_1013877123300030498AgaveREFLQETSDTNNSVQEQKMSSSKNKNKKDKGKAIQKAEDYQLQIPVQNQFTPLTQTQFPPLPYKTAVTNPNSSSSTNDYMIRFIEHILLTSCKPPPPTNIIPSITQKTFGPHQFSTDDLRKS
Ga0268247_1014138723300030498AgaveMSCSKHPGKKDKGKAIQKAEDYQLQVPTKNQFLSLTNFPPLPYKTAVPNPAPSSNPNDAYIVRHVEHLLLTSCKT
Ga0268247_1015098723300030498AgaveMSSSKNKNKNKKDKGKAIQKAEDYQLQIPIQNLFTPLTQTQFPPLPYKTAVTNPSSSNPTNDYMIRFTEHLLLTSCKRPPPTNIISSIIQKTFGLD
Ga0268247_1016733323300030498AgavePIQTAEDYQLTIPTQNQFTPLAQTQFPPLPYKNAITNPSSSNTAEAYLIRFTEHLLLTSCKPPAPTNIISDIVQKTFGVHQFATDDLRKSQKFYELILVDTNSVSLTHTYDKYQPA
Ga0268247_1017334323300030498AgaveMSSGKPNKKDKGKAIQKAEDYQLQVPTQNQFSPLTNFPLLPYKSAVTNPSSSTSDAYIVRFSEHLLLTSCKPPPPANIISSIVQKTFGTKHYATDDLRKT
Ga0268247_1019873923300030498AgaveMSSSKPNKKDKEKAIQKAKEYQLQVPTQNQFLPLSNFPPLPYKSAVTNPSSSNSTDAYVIRFTEHLLLTSCKPPPPTTIISSIVQKTYGTKHYATDDLRKTQKFYELILVDTNSVSLTHTFDKYH
Ga0268247_1025188523300030498AgaveMSASKATKKDKGKAIQKAENYQLQVPVQNQFTPLTFPPLPYKQAITNPTSSSSTNEYTIRFTEHLLLTSCKPPPPTNIISSIVQKSFGRHHFATDD
Ga0268247_1026971813300030498AgaveRAEDYQLQIPTQNQFTPLTQTQFPPLPYKTVVTNPSPSNPADTYVIRFTEHLLLTSCKPPPPTNIISSIVQ
Ga0268247_1028717223300030498AgaveMSSCKPNKKDKGKAIQKVEDYQLQVPTQNQFSPLTNFPPLPYKSAVTNPSSSNSDAYVNRFTEHLLLTSCKPPPPTNIISSIVKKTYGTKHFATDNLRKTQKFYELILVDTNSVSLHPKSSQMG
Ga0268247_1028779513300030498AgaveMSSSKHPSKKHKGKAVQKAEDYQLQVPTKNQFLPLANFPPLPYKTTVTNPAPSPNPNDAYIVHHIEHLLLTSCKTLPPTNVIPSILQKIFGSNHFATDDFHRTQ
Ga0268247_1029602623300030498AgaveMSSNKPKKDKGKAIQRVEDYQLTIPTQNQFQPSTQTQFPPLPYKNAITNPSSSNSSEAYMVRFREHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDPLKHTNSMS
Ga0268247_1031399523300030498AgaveMSASKATKKDKGKAIQKAEDYQLQVPIQKQFTPLTFPPLPYKQAVTNPTSSSSTNEYTIRFTEHLLLTSCKPPPPTNIISSIVQKSFGRHHYATDDLRKSQKFYELILVDSNSVSLTHTM
Ga0268247_1031804813300030498AgaveMSLSNHPNKKDKGKAVTKAEDYQLQISTQNQFTPLTNFPPLPYKTAVTNHSSNPTDAYIIRYTEHLLLTICKPPPPTNIISSIVQKT
Ga0268247_1032243613300030498AgaveMSSSKNKKDKGKAIQEAEDYQLQVPVQNQFAPLSQNQFPPLPYKTAVTNPSSSHSADAYLIRYNEHLLLTSCKPPPLTNIISNIVQKSFGNHHFATDDLRKFQ
Ga0268247_1032262713300030498AgaveMSSSKPKKDKGKAIQKADDYQLQVPVQNQFTPLTFPALPYKQAVSNPTSSSSTNDYTIRFTEHLLLTSCKPPP
Ga0268247_1032579113300030498AgaveKKDKGKAIHKAEDYQLQIPTQNQFAPLQTQFPPLPYKTAVTNPSSSTPADAYIIRHIEHLLLTSCKPPPPTNIISSITQKTFGPHHFATDDLRKSQKF
Ga0268247_1033520423300030498AgaveMSSSKNPNKKDKGKAVQKAKDYQLQVPTKNQFPPLDKFPPLPYKTTVTNPAPSNPNNAYVGRHIEHLLLNSCKTLPTTNIIPSIVQNTFGPYHFATDDLRR
Ga0268247_1034217023300030498AgaveMSSSKHPQKKDKGKAVQRAEDYQLQIPTQNQFTPLNNFPPLLNKTAVTNPSSSNSANAYVVRHIEHLLLTSCKPPPPTNIISSIT
Ga0268247_1035331623300030498AgaveNIAMQGEMSSSKNKNKKDKGKAIQTTEDYQLQIPVQNQFTPLTQNQFPPLPYKTVVTNPSPSISTNDYMIRFIKHILLTSCKPPPPTNIISSIIQKTFVFTSLLRMISVSPKNSMSSYLLILSQ
Ga0268247_1036832523300030498AgaveMSKQPQKKDKGKAIQKAEDYQLQIPTQNQFAPLSQNQFPPLPYKTAVTNPSSSHSGDAYLIRFNEHLLLTSCKPPPPTNILSNIIQKSFGSHHFATDDLRKSQKFYELILVD
Ga0268247_1037117913300030498AgaveMSSDKPNKKDKGKAIQKAEDYQLQVPTQNQFLPLTNFPPLPYKSAVTNPSSSTSDAYIIRFTEHLLLTSCKPPPPTNIISSIVQKTFGTKHYATDDLRKTQKFYELILVDTNSVSLTHTF
Ga0268247_1039113313300030498AgaveMSSSKPKKDKGKAIQRAEDYQLQVPTQNQFTPLAQTQFPPLPYKNAITNPSSSNTAEAYMVHFTEHLLLTSCKPPAPTNIISEIVQKTFRIHQFATDDLRKSQKFYEL
Ga0268247_1039736823300030498AgaveMSSNKNKKDKGKTIQKAEDYQLQISVQNQFAPLTQTQFPPLPYKTAVTNPSSSSSINDYIIRFTEHLLLTSCKPPPPINIISSIIQKTFGPHHFATDDLRKSQKFYELILVDT
Ga0268247_1042157023300030498AgaveMSPSKNKNKNKNDKGKAIQKAEDYQLQIPVQNQFARLTQTQFPSLPYKTAVTNPASSRSTNDYMIRFTEHLLLTSCKPPPPTNIISSIIQKTFGPHHFATDDLRKSQKFYELILVDTQS
Ga0268247_1042217023300030498AgaveMSSSKPKKDKGKAIQKADDYQLQVPVKNQFTPLTFPPLPYKQAVSNPTSLSSTNDYTIRFTEHLLLTSCKPPPPTTIISSIVQKSFGRHHFTTDDYANHKNSMS
Ga0268247_1042858723300030498AgaveMSSSKNPNKKDKGKAVQKAEDYQISVPTKNQFAPLDKFPPLPYKTAVTNPASSNPNDAYIVRHIEHILLTSCKTLPPTNIISSILQKTFGVFHYATDDS
Ga0268247_1043282713300030498AgaveMSSSKPTKKDKGKAIHKAEDYQLQVPVQNQFAPLSQNQFPSLPYKTAVTNPSSSQSADAYLIRYNEHLLLTSCKPPPPTNIISNIVQKSFGNHHFATDDLRKSQK
Ga0268247_1046404323300030498AgaveMSKQPNKKDKGKAVQKAEDYQLQIPVQNQFTPLTNFPPLPYKNAVTNPSLSNSTNDYVIRFTEHLLLTSCKPPPPTNIISSIVQKA
Ga0268247_1047073923300030498AgaveMSSSKPNKKDKRKAIQKGEDYQLQVPTQNQFSPLTNFPPLLYKSVVTKPSSSNSDAYVIRFTEHLLLTSCKPPPPTNIISSIV
Ga0268247_1048148923300030498AgaveMSSSNHPNRKDKGKSVQKAEDYQLQIPTQNQFTPLTNFPPLPYKTAVTNHSSSNLADAYIIRYTEHLLLASCKPPPPTNIISSIVQKTFGPNHFATDDLRRTQKFYELILVDT
Ga0268247_1050573923300030498AgaveMSSSKNKNKKDKGKAIQTAEDYQLQIPIQNQFTPLTQTQFPPLSYKTPVTNPSSSNLTSDYMIRFTEHLLLTSCKPPPPTNIISSIIQKTFGPHQF
Ga0268247_1053101723300030498AgaveMSSSKNLNKKDKGKAVQKAEDYQLQVPTKNQFLPLDKFSPLPYKTAVTNPATPNPNDAYIGRHIEHLLLTSCKTLP
Ga0268247_1053399313300030498AgaveMSSSKNNKKDKGKAIQKAEDYQLQVPVQNQFTPLTQIQFPPLPYKTAVTKPSAASSSNEYTIRFTEHLILTSCKPPPPTNIISSIVQKSFGNHQFATDDLRKSQKYYELILVDSNSVSLT
Ga0268247_1057996413300030498AgaveMSSSKPKKDKGKAIQRVEDYQLAIPTQNQFQPLTQTQFPPLPYKNAITNPSSSNSAEAYMVRFTEHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDLRKTE
Ga0268254_1021541923300030515AgaveMSSSKPKKDKGKAIQRVEDYQLAIPTQNQFQPLTQTQFPPLPYKNAITNPSSSNSAEAYMVRFTEHLLLTSCKVLPKFAEDSSTK
Ga0268255_1015586723300030516AgaveMSSSKPKKDKGKAIQRAEDYQLTIPTQNQFQPLTQTQFPPLPYKNAITNPSSSNSSEAYMVRFTEHLLLTSCKPPAPTNIISEIVQKSFGTNHFATDDLRKT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.