| Basic Information | |
|---|---|
| Family ID | F048051 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.35 % |
| % of genes near scaffold ends (potentially truncated) | 52.70 % |
| % of genes from short scaffolds (< 2000 bps) | 74.32 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.865 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (19.595 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.838 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.892 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF13451 | zf-trcl | 31.08 |
| PF01300 | Sua5_yciO_yrdC | 29.73 |
| PF02698 | DUF218 | 6.08 |
| PF04055 | Radical_SAM | 5.41 |
| PF01165 | Ribosomal_S21 | 1.35 |
| PF00266 | Aminotran_5 | 1.35 |
| PF13006 | Nterm_IS4 | 1.35 |
| PF00919 | UPF0004 | 1.35 |
| PF01944 | SpoIIM | 1.35 |
| PF07726 | AAA_3 | 0.68 |
| PF13242 | Hydrolase_like | 0.68 |
| PF02357 | NusG | 0.68 |
| PF13358 | DDE_3 | 0.68 |
| PF03447 | NAD_binding_3 | 0.68 |
| PF06271 | RDD | 0.68 |
| PF00903 | Glyoxalase | 0.68 |
| PF03702 | AnmK | 0.68 |
| PF13592 | HTH_33 | 0.68 |
| PF03795 | YCII | 0.68 |
| PF00149 | Metallophos | 0.68 |
| PF00582 | Usp | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 6.08 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 6.08 |
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 1.35 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 1.35 |
| COG1300 | Stage II sporulation protein SpoIIM, component of the engulfment complex | Cell cycle control, cell division, chromosome partitioning [D] | 1.35 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.68 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.68 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.68 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.86 % |
| Unclassified | root | N/A | 10.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10009900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6400 | Open in IMG/M |
| 3300000567|JGI12270J11330_10050649 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300001356|JGI12269J14319_10044440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2732 | Open in IMG/M |
| 3300004473|Ga0068919_1423552 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004489|Ga0068929_1116702 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005899|Ga0075271_10122876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 501 | Open in IMG/M |
| 3300009518|Ga0116128_1113507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300009518|Ga0116128_1127685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300009519|Ga0116108_1053648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300009519|Ga0116108_1088778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300009519|Ga0116108_1126682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300009519|Ga0116108_1134240 | Not Available | 738 | Open in IMG/M |
| 3300009519|Ga0116108_1140176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300009519|Ga0116108_1251663 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009521|Ga0116222_1169377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300009547|Ga0116136_1034737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| 3300009547|Ga0116136_1076625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300009548|Ga0116107_1130350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300009549|Ga0116137_1084761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300009549|Ga0116137_1095391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300009614|Ga0116104_1000879 | All Organisms → cellular organisms → Bacteria | 16700 | Open in IMG/M |
| 3300009614|Ga0116104_1036114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300009614|Ga0116104_1101434 | Not Available | 573 | Open in IMG/M |
| 3300009621|Ga0116116_1098519 | Not Available | 803 | Open in IMG/M |
| 3300009631|Ga0116115_1076246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300009632|Ga0116102_1013330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2956 | Open in IMG/M |
| 3300009636|Ga0116112_1043560 | Not Available | 1355 | Open in IMG/M |
| 3300009636|Ga0116112_1118485 | Not Available | 742 | Open in IMG/M |
| 3300009639|Ga0116122_1133656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300009762|Ga0116130_1059543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1203 | Open in IMG/M |
| 3300010341|Ga0074045_10063984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2620 | Open in IMG/M |
| 3300010341|Ga0074045_10366110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300010341|Ga0074045_10486255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300010379|Ga0136449_103550022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300011025|Ga0138561_115273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 659 | Open in IMG/M |
| 3300011026|Ga0138566_109698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 527 | Open in IMG/M |
| 3300011027|Ga0138580_116671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 511 | Open in IMG/M |
| 3300011038|Ga0138547_125141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 865 | Open in IMG/M |
| 3300011041|Ga0138591_132771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 709 | Open in IMG/M |
| 3300011051|Ga0138540_114710 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300011059|Ga0138597_1087305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 533 | Open in IMG/M |
| 3300011064|Ga0138525_1043333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 657 | Open in IMG/M |
| 3300011064|Ga0138525_1090231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 740 | Open in IMG/M |
| 3300011072|Ga0138563_1141224 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300011073|Ga0138584_1107128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 507 | Open in IMG/M |
| 3300011074|Ga0138559_1048647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 547 | Open in IMG/M |
| 3300011074|Ga0138559_1066586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 682 | Open in IMG/M |
| 3300011077|Ga0138572_1088003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 746 | Open in IMG/M |
| 3300011082|Ga0138526_1013842 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300011082|Ga0138526_1063886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 737 | Open in IMG/M |
| 3300011084|Ga0138562_1032167 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300011086|Ga0138564_1037586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 702 | Open in IMG/M |
| 3300011109|Ga0138539_1130366 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300011305|Ga0138532_1010571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 684 | Open in IMG/M |
| 3300014153|Ga0181527_1236175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300014156|Ga0181518_10007698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8787 | Open in IMG/M |
| 3300014159|Ga0181530_10349713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 763 | Open in IMG/M |
| 3300014162|Ga0181538_10317496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300016698|Ga0181503_1142544 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300016730|Ga0181515_1239561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 738 | Open in IMG/M |
| 3300016750|Ga0181505_10467400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1003 | Open in IMG/M |
| 3300017823|Ga0187818_10029015 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300017823|Ga0187818_10071839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1491 | Open in IMG/M |
| 3300017924|Ga0187820_1147807 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300017925|Ga0187856_1062211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300017925|Ga0187856_1105420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300017925|Ga0187856_1312347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300017929|Ga0187849_1063116 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300017929|Ga0187849_1095256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300017929|Ga0187849_1245460 | Not Available | 683 | Open in IMG/M |
| 3300017933|Ga0187801_10348642 | Not Available | 609 | Open in IMG/M |
| 3300017938|Ga0187854_10005626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8933 | Open in IMG/M |
| 3300017946|Ga0187879_10010291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5994 | Open in IMG/M |
| 3300017955|Ga0187817_10749906 | Not Available | 623 | Open in IMG/M |
| 3300017961|Ga0187778_10527212 | Not Available | 786 | Open in IMG/M |
| 3300017972|Ga0187781_10002972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12799 | Open in IMG/M |
| 3300017972|Ga0187781_10012877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5950 | Open in IMG/M |
| 3300017972|Ga0187781_10043940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3074 | Open in IMG/M |
| 3300017972|Ga0187781_10483671 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300017975|Ga0187782_10024140 | All Organisms → cellular organisms → Bacteria | 4431 | Open in IMG/M |
| 3300018003|Ga0187876_1193501 | Not Available | 686 | Open in IMG/M |
| 3300018004|Ga0187865_1107504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300018013|Ga0187873_1190876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300018017|Ga0187872_10017144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4288 | Open in IMG/M |
| 3300018017|Ga0187872_10131311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300018019|Ga0187874_10300137 | Not Available | 654 | Open in IMG/M |
| 3300018021|Ga0187882_1124754 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300018022|Ga0187864_10150533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300018024|Ga0187881_10358341 | Not Available | 600 | Open in IMG/M |
| 3300018035|Ga0187875_10351245 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300018040|Ga0187862_10276605 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300018057|Ga0187858_10126725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
| 3300018057|Ga0187858_10296249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300018062|Ga0187784_10002580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14528 | Open in IMG/M |
| 3300018062|Ga0187784_10015176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6221 | Open in IMG/M |
| 3300018062|Ga0187784_10033204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4168 | Open in IMG/M |
| 3300018062|Ga0187784_10192226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1666 | Open in IMG/M |
| 3300018062|Ga0187784_11128891 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018085|Ga0187772_10124690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1683 | Open in IMG/M |
| 3300018085|Ga0187772_10472049 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300018085|Ga0187772_11096142 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018086|Ga0187769_10077473 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300018086|Ga0187769_10422306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300018088|Ga0187771_10075152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2679 | Open in IMG/M |
| 3300018088|Ga0187771_10180557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
| 3300018088|Ga0187771_10232256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1535 | Open in IMG/M |
| 3300018088|Ga0187771_10817495 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300019230|Ga0181501_1041588 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300019251|Ga0187795_1130251 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300019264|Ga0187796_1464248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 680 | Open in IMG/M |
| 3300019273|Ga0187794_1185707 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300019273|Ga0187794_1370613 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300019275|Ga0187798_1632697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 629 | Open in IMG/M |
| 3300019275|Ga0187798_1758371 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300019278|Ga0187800_1008648 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300019278|Ga0187800_1455178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 622 | Open in IMG/M |
| 3300019278|Ga0187800_1514870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 765 | Open in IMG/M |
| 3300019278|Ga0187800_1631654 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025419|Ga0208036_1001206 | All Organisms → cellular organisms → Bacteria | 11656 | Open in IMG/M |
| 3300025419|Ga0208036_1004927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3733 | Open in IMG/M |
| 3300025439|Ga0208323_1002182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6739 | Open in IMG/M |
| 3300025441|Ga0208456_1002046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6572 | Open in IMG/M |
| 3300025460|Ga0208562_1060754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300025480|Ga0208688_1033958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300027896|Ga0209777_10275386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1313 | Open in IMG/M |
| 3300030659|Ga0316363_10005875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8019 | Open in IMG/M |
| 3300031670|Ga0307374_10048246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4465 | Open in IMG/M |
| 3300032783|Ga0335079_10572292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1195 | Open in IMG/M |
| 3300032805|Ga0335078_10209039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2701 | Open in IMG/M |
| 3300032892|Ga0335081_10341260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1958 | Open in IMG/M |
| 3300033158|Ga0335077_10383323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1515 | Open in IMG/M |
| 3300033158|Ga0335077_12023519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300033402|Ga0326728_10000198 | All Organisms → cellular organisms → Bacteria | 251154 | Open in IMG/M |
| 3300033402|Ga0326728_10002977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 54575 | Open in IMG/M |
| 3300033402|Ga0326728_10007000 | All Organisms → cellular organisms → Bacteria | 29684 | Open in IMG/M |
| 3300033402|Ga0326728_10036806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7871 | Open in IMG/M |
| 3300033402|Ga0326728_10058867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5376 | Open in IMG/M |
| 3300033402|Ga0326728_10132585 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300033402|Ga0326728_10672725 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300033405|Ga0326727_10107203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3615 | Open in IMG/M |
| 3300033405|Ga0326727_10233934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1931 | Open in IMG/M |
| 3300033977|Ga0314861_0000029 | All Organisms → cellular organisms → Bacteria | 226482 | Open in IMG/M |
| 3300033977|Ga0314861_0003745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14140 | Open in IMG/M |
| 3300033977|Ga0314861_0062287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2017 | Open in IMG/M |
| 3300033977|Ga0314861_0343894 | Not Available | 663 | Open in IMG/M |
| 3300033977|Ga0314861_0402739 | Not Available | 599 | Open in IMG/M |
| 3300034091|Ga0326724_0203012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 19.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 19.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 16.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 13.51% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 10.14% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 6.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.70% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.03% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004489 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 14 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011025 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 46 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011026 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 51 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011027 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011038 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011041 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011059 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011109 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100099003 | 3300000567 | Peatlands Soil | MSFDFFYDIFLLHLTFEAAKRVFQGLSVLKSYFSQTINTPISD* |
| JGI12270J11330_100506491 | 3300000567 | Peatlands Soil | DLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTMNTPISN* |
| JGI12269J14319_100444403 | 3300001356 | Peatlands Soil | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTMNTPISN* |
| Ga0068919_14235521 | 3300004473 | Peatlands Soil | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPV |
| Ga0068929_11167022 | 3300004489 | Peatlands Soil | MSFDFFYDIFLLHLTFEAAKRVFQGLSVLKSYFSQTINTPIS |
| Ga0075271_101228762 | 3300005899 | Rice Paddy Soil | MLFDFLDDVLLLHLSLEAAEGAFQRLSLLKSNFSQTINTPISY* |
| Ga0116128_11135072 | 3300009518 | Peatland | FLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD* |
| Ga0116128_11276852 | 3300009518 | Peatland | DFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116108_10536481 | 3300009519 | Peatland | SFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116108_10887782 | 3300009519 | Peatland | FDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116108_11266822 | 3300009519 | Peatland | FLLHLTFEAAKRVFQGLSVLKSYFSQTINTPISD* |
| Ga0116108_11342401 | 3300009519 | Peatland | FDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD* |
| Ga0116108_11401761 | 3300009519 | Peatland | LYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD* |
| Ga0116108_12516632 | 3300009519 | Peatland | MSFDFLYDIFLLHLTLEAAKRVFQGLSVLKSYFSQTINTPISD* |
| Ga0116222_11693772 | 3300009521 | Peatlands Soil | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISD* |
| Ga0116136_10347371 | 3300009547 | Peatland | QVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD* |
| Ga0116136_10766251 | 3300009547 | Peatland | QVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116107_11303501 | 3300009548 | Peatland | FLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116137_10847612 | 3300009549 | Peatland | FLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116137_10953911 | 3300009549 | Peatland | RFQVERMSFDFLYDVFLLNLTFEAAKRVFQGLPVLKSYFSQPIYTPVSV* |
| Ga0116104_10008791 | 3300009614 | Peatland | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD* |
| Ga0116104_10361142 | 3300009614 | Peatland | VFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116104_11014341 | 3300009614 | Peatland | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD* |
| Ga0116116_10985192 | 3300009621 | Peatland | SFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD* |
| Ga0116115_10762462 | 3300009631 | Peatland | DVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116102_10133303 | 3300009632 | Peatland | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISS* |
| Ga0116112_10435602 | 3300009636 | Peatland | MSFDFFYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHT |
| Ga0116112_11184851 | 3300009636 | Peatland | VFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD* |
| Ga0116122_11336563 | 3300009639 | Peatland | LYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0116130_10595431 | 3300009762 | Peatland | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISN* |
| Ga0074045_100639842 | 3300010341 | Bog Forest Soil | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0074045_103661101 | 3300010341 | Bog Forest Soil | MSLDFFYDVFLLNLSLEAAKCVFQRLSVLKPYFSQPINTPISD* |
| Ga0074045_104862552 | 3300010341 | Bog Forest Soil | QVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQTIHTPISN* |
| Ga0136449_1000685723 | 3300010379 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQPISTPISVCNIVPTITAVVRLF* |
| Ga0136449_1035500222 | 3300010379 | Peatlands Soil | FLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISD* |
| Ga0138561_1152731 | 3300011025 | Peatlands Soil | MSLDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQTIYTPISN* |
| Ga0138566_1096982 | 3300011026 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQPIST |
| Ga0138580_1166712 | 3300011027 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQ |
| Ga0138547_1251413 | 3300011038 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQPISTPISVCNII |
| Ga0138591_1327712 | 3300011041 | Peatlands Soil | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIY |
| Ga0138540_1147102 | 3300011051 | Peatlands Soil | MSLDFLYDVFMLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSLWIKET |
| Ga0138597_10873051 | 3300011059 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQPISTPISVCNIVPTI |
| Ga0138525_10433332 | 3300011064 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQPISTPISVCNIDPTI |
| Ga0138525_10902312 | 3300011064 | Peatlands Soil | MSFDFLYDVFLLNLTFEAAKRVFQGLPVLKSYFSQPIYTPVSVWNIETT |
| Ga0138563_11412242 | 3300011072 | Peatlands Soil | MSFDFLYDIFLLHLTLEAAKRVFQGLSVLKSYFSQTINT |
| Ga0138584_11071281 | 3300011073 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQPISTPISVCNIVPTIT |
| Ga0138559_10486472 | 3300011074 | Peatlands Soil | MSFDFFYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVS |
| Ga0138559_10665862 | 3300011074 | Peatlands Soil | MSFDFFYDIFLLHLTFEAAKRVFQGLSVLKSYFSQTINTPISN* |
| Ga0138572_10880032 | 3300011077 | Peatlands Soil | MSFDFFYDIFLLHLTFEAAKRVFQGLSVLKSYFSQPISTPISVCNIVP |
| Ga0138526_10138421 | 3300011082 | Peatlands Soil | MSFDFLYDVFLLNLTFEAAKRVFQGLFFLKASATTEIYTPVSVWNIETT |
| Ga0138526_10638861 | 3300011082 | Peatlands Soil | MSFDFFYDVFLLDLPLEAAKRVFQGLSVLKSYFSQQIYTPVSVWNNE |
| Ga0138562_10321671 | 3300011084 | Peatlands Soil | MSLDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSLWIKETT |
| Ga0138564_10375861 | 3300011086 | Peatlands Soil | MPFDFLYDVLLLDLAFEAAQSVFQGLPVLKSYFSQPINTPVSVW |
| Ga0138539_11303661 | 3300011109 | Peatlands Soil | MSFDFFYDIFLLHLTFEAAKRVFQGLSVLKSYFSQTMNTPISN |
| Ga0138532_10105712 | 3300011305 | Peatlands Soil | MSFDFFYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD* |
| Ga0181527_12361751 | 3300014153 | Bog | YDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV* |
| Ga0181518_100076985 | 3300014156 | Bog | MSFDLFYDVFLLHLSFEAAKRVFQGLSVLKSYFSQTINTPISN* |
| Ga0181530_103497132 | 3300014159 | Bog | MSFDFFYDVFLLNLTFEAAKRVFQGLSVLKSYFSQTIYTPISN* |
| Ga0181538_103174962 | 3300014162 | Bog | VFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISS* |
| Ga0181503_11425442 | 3300016698 | Peatland | MWFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISS |
| Ga0181515_12395612 | 3300016730 | Peatland | MSFDFFYDVFLLNLTFEAAKRVFQGLSVLKSYFSQTIYTPISN |
| Ga0181505_104674003 | 3300016750 | Peatland | MSFDFLYDIFLLHLTLEAAKRVFQGLSVLKSYFSQTINTPISS |
| Ga0187818_100290152 | 3300017823 | Freshwater Sediment | MSFDFLYDVFLLNFSLEAAKCVFQGLSVLKPYLSQPINTPISD |
| Ga0187818_100718393 | 3300017823 | Freshwater Sediment | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISS |
| Ga0187820_11478072 | 3300017924 | Freshwater Sediment | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISN |
| Ga0187856_10622113 | 3300017925 | Peatland | QVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD |
| Ga0187856_11054202 | 3300017925 | Peatland | QVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187856_13123472 | 3300017925 | Peatland | VFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISS |
| Ga0187849_10631161 | 3300017929 | Peatland | FLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187849_10952561 | 3300017929 | Peatland | SFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187849_12454602 | 3300017929 | Peatland | FLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD |
| Ga0187801_103486421 | 3300017933 | Freshwater Sediment | MSFDFLYDVFLLNLSLEAAKCVFQGLSVLKPYLSQPINTPISD |
| Ga0187854_100056266 | 3300017938 | Peatland | MSFDFLYDIFLLHLTLEAAKRVFQGLSVLKSYFSQTINTPISD |
| Ga0187879_100102916 | 3300017946 | Peatland | MSFDFFYDIFLLHLTFEAAKRVFQGLSVLKSYFSQTINTPISD |
| Ga0187817_107499061 | 3300017955 | Freshwater Sediment | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKPYFSQTINTPISN |
| Ga0187778_105272122 | 3300017961 | Tropical Peatland | MSFNFLYDIFLLNLTLEAAKRVFQGLSVLKSYFSQPIYTSVSV |
| Ga0187781_100029725 | 3300017972 | Tropical Peatland | MSLDFFYDIFLLNLALKAAKCIFQRLSVLKPYFSQTIATPIRIELLNP |
| Ga0187781_100128772 | 3300017972 | Tropical Peatland | MSFDFLYDILLLHLALEAAKRVFQGLSLLKSHFSQTINTPISN |
| Ga0187781_100439403 | 3300017972 | Tropical Peatland | MSLDFLYDVFLLHLALEAAQRVFQGLSVLKSYFSQTINTPISD |
| Ga0187781_104836711 | 3300017972 | Tropical Peatland | MSLDFFYDVFLLHLSLKAAKRVFQGLSVLKSYFSQTINTPISN |
| Ga0187782_100241403 | 3300017975 | Tropical Peatland | MSFDFLYDVFLLNLALEAAKRVFQGLPVLKSYFSQPIYTPVSV |
| Ga0187876_11935011 | 3300018003 | Peatland | DVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD |
| Ga0187865_11075042 | 3300018004 | Peatland | SLFLTRFQVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKPYFSQPIYTPVSV |
| Ga0187873_11908762 | 3300018013 | Peatland | FDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187872_100171444 | 3300018017 | Peatland | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD |
| Ga0187872_101313112 | 3300018017 | Peatland | DFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187874_103001372 | 3300018019 | Peatland | TSQGRLDSLFLTRFQVERMSLDFLYDVFLLNLTFKAAKRVFQGLSVLKSYFSQPIYTPVS |
| Ga0187882_11247542 | 3300018021 | Peatland | MSFDFLYDIFLLHLTLEAAKRVFQGLSVLKSYFIQTINTPISD |
| Ga0187864_101505331 | 3300018022 | Peatland | FDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD |
| Ga0187881_103583412 | 3300018024 | Peatland | DSLFLTRFQVERMSLDFLYDVFLLNLTFKAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187875_103512452 | 3300018035 | Peatland | MSFDLFYDVFLLYLSLEAAKRVFQGLSVLKSYFSQTINTPISN |
| Ga0187862_102766052 | 3300018040 | Peatland | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPIST |
| Ga0187858_101267254 | 3300018057 | Peatland | RFQVERMSFDFLYDIFLLHLTLEAAKRVFQGLSVLKSYFSHTINTPISD |
| Ga0187858_102962493 | 3300018057 | Peatland | DVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISS |
| Ga0187784_1000258014 | 3300018062 | Tropical Peatland | MSFDFLYDILLLHLALEAAKRVFQGLSLLKSYFSQTINTPISN |
| Ga0187784_100151764 | 3300018062 | Tropical Peatland | MSLDFFYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0187784_100332043 | 3300018062 | Tropical Peatland | MSLDFFYDIFLLNLALKAAKCIFQRLSVLKPYFSQTIATHIRIELLNP |
| Ga0187784_101922261 | 3300018062 | Tropical Peatland | MSFDFLYDVFLLNLALEAAKCVFQGLSILKPYLSQPINTPISD |
| Ga0187784_111288911 | 3300018062 | Tropical Peatland | MSFDFLYDVFLLDLPLEAAKRVFQGLTVLKSYFRQTIYTPVSICML |
| Ga0187772_101246901 | 3300018085 | Tropical Peatland | MSLDFLYDIFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPVSD |
| Ga0187772_104720491 | 3300018085 | Tropical Peatland | MSFDFLYDIFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTSVSV |
| Ga0187772_110961421 | 3300018085 | Tropical Peatland | MSLDFFYDIFLLNLALKAAKCIFQRLSVLKPYFSQTIATPIRIELLN |
| Ga0187769_100774733 | 3300018086 | Tropical Peatland | MSFDFLYDVFLLNLSLEAAKCVFQRLSILKSNFSQPFNTPISD |
| Ga0187769_104223062 | 3300018086 | Tropical Peatland | MSFDLFDDVFLLHLSLEAAKRVFQGLSVLKSNFSQTINTPISN |
| Ga0187771_100751521 | 3300018088 | Tropical Peatland | MSFDFLYDVFLLNLPLEAAKRVFQGLPVLKSHFSQPIYTSISV |
| Ga0187771_101805572 | 3300018088 | Tropical Peatland | MSFDFLYDIFLLNLTLEAAKRVFQGLSVLKSYFSQPIYTSVSV |
| Ga0187771_102322562 | 3300018088 | Tropical Peatland | MSFDFLYDVFLLNLSFEAAKRVFQGLSVLKPYFSQPIYTPVSV |
| Ga0187771_108174952 | 3300018088 | Tropical Peatland | MSLDFFYDVFLLHLSLKAAKRVFQGLSVLKSNFSQTINTPVSN |
| Ga0181501_10415882 | 3300019230 | Peatland | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQ |
| Ga0187795_11302512 | 3300019251 | Peatland | MSLDFLYDVFLLNLAFEAAKRVFQGLPVLKSYFSQTIYTPISVCNVI |
| Ga0187796_14642482 | 3300019264 | Peatland | MSFDFLYDIFLLNLALEAAKRVFQGLPVLKSYFSQPIYTPIS |
| Ga0187794_11857072 | 3300019273 | Peatland | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPISD |
| Ga0187794_13706132 | 3300019273 | Peatland | MSLDFLYDVFLLHLTLEAAKRVFQGLSVLKSYFSQTINTPIS |
| Ga0187798_16326971 | 3300019275 | Peatland | MSFDFLYDVFLLNLSFEAAKRVFQGLSVLKSYFSQPIYTSVSV |
| Ga0187798_17583713 | 3300019275 | Peatland | MSFDFLYDVFLLNLSFEAAKCVFQGLSVLKSYFSQPFNTPVS |
| Ga0187800_10086482 | 3300019278 | Peatland | MSFDFLYDVFLLNLTLEAAKCVFQGLSVLKSYFSQP |
| Ga0187800_14551782 | 3300019278 | Peatland | MSLDFLYDIFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPV |
| Ga0187800_15148703 | 3300019278 | Peatland | MSFDFLYDGFLLNLSFEAAKRVFQGLSVLKSYFSQPIY |
| Ga0187800_16316542 | 3300019278 | Peatland | MSLDFLYDIFLLHLSLEAAKRVFQGLSVLKSYFSQTINTPIS |
| Ga0208036_100120610 | 3300025419 | Peatland | FQVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD |
| Ga0208036_10049273 | 3300025419 | Peatland | FQVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0208323_10021822 | 3300025439 | Peatland | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0208456_10020461 | 3300025441 | Peatland | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPI |
| Ga0208562_10607541 | 3300025460 | Peatland | VFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0208688_10339582 | 3300025480 | Peatland | LDSLFLTRFQVERMSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIHTPVSD |
| Ga0209777_102753862 | 3300027896 | Freshwater Lake Sediment | MSFDFLYDVFLLNLTFEAAKRVFQGLSVLKSYFSQPIYTPVSD |
| Ga0316363_100058759 | 3300030659 | Peatlands Soil | MSFDLFYDVFLLHLSLEAAKRVFQGLSVLKSYFSQTMNTPISN |
| Ga0307374_100482464 | 3300031670 | Soil | MLLDFLNDILLLHLALEAAESAFQRLPFLKSNFGQTINTPIS |
| Ga0335079_105722922 | 3300032783 | Soil | MSFDLFYDVFLLYLSLEAAKRVFQGLSVLKSYFSQTMNTPISN |
| Ga0335078_102090393 | 3300032805 | Soil | MSFDFLYDIFLLHLSLEAAKRVFQRLSVLKPYFSQTINTPVSN |
| Ga0335081_103412603 | 3300032892 | Soil | MSLDFLYDVFLLHLSLKAAKRVFQRLSVLKSHFSQTINTPISN |
| Ga0335077_103833233 | 3300033158 | Soil | MSFDLFYDVFLLYLSLEAAKRVFQGLSVLKSYFSQTMNTPISD |
| Ga0335077_120235191 | 3300033158 | Soil | SLYFFYDVFLLNLSLEAAKCIFQRFSVLKPYFSQPINTPISD |
| Ga0326728_10000198207 | 3300033402 | Peat Soil | MSFDFLYDVFLLNLSLEAAKCVFQGLSVLKSYFSQPFNTPVSD |
| Ga0326728_1000297746 | 3300033402 | Peat Soil | MSLDFLYDVFLLNLTFEAAKRVFQGLSVLKPYFSQPIYTPVSV |
| Ga0326728_1000700015 | 3300033402 | Peat Soil | MSLDFFYDVFLLNLSLEAAKCIFQRLSVLKPYFSQPINTPISD |
| Ga0326728_100368069 | 3300033402 | Peat Soil | MSFDFLYDVFLLNLPFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0326728_100588675 | 3300033402 | Peat Soil | MSFDLFYDVFLLHLSFEAAKRVFQGLSVLKSYFSQTINTPISN |
| Ga0326728_101325852 | 3300033402 | Peat Soil | MSLDFLYDVFLLNLTFEAAKRVFQGLPVLKSYFSQPIYTPVSV |
| Ga0326728_106727252 | 3300033402 | Peat Soil | MSFDFLYDVFLLDLAFEAAKRVFQGLSVLKSYFSQPIYTPVSV |
| Ga0326727_101072031 | 3300033405 | Peat Soil | YDVFLLNLSLEAAKCIFQRLSVLKPYFSQPINTPISD |
| Ga0326727_102339341 | 3300033405 | Peat Soil | DLFYDVFLLHLSFEAAKRVFQGLSVLKSYFSQTINTPISN |
| Ga0314861_0000029_130181_130312 | 3300033977 | Peatland | MSFDFLYDIFLLNLALEAAKRVFQGLPVLKSYFSQPMYTPVSV |
| Ga0314861_0003745_6709_6840 | 3300033977 | Peatland | MSFDFLYDVFLLNLSFEAAKRVFQGLPVLKSYFSQPIYTSVSV |
| Ga0314861_0062287_829_960 | 3300033977 | Peatland | MSFDFLYDVFLLNLPLEAAKRVFQGLPVLKSHFSQPIYTPVSV |
| Ga0314861_0343894_40_171 | 3300033977 | Peatland | MPFDFLYDVFLLNLTLEAAKRVFQGLPVLQSYFSQPICTPVSV |
| Ga0314861_0402739_439_570 | 3300033977 | Peatland | MPFDLFYDVFLLNLTFEAAKRVFQGLSVLKPYFSQPIHTPVSV |
| Ga0326724_0203012_2_112 | 3300034091 | Peat Soil | DVFLLNLSLKAAKCIFQRLSVLKPYFSQPINTPISD |
| ⦗Top⦘ |