Metagenome / Metatranscriptome Family F047945

Overview

Basic Information

• Family ID: F047945
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 149
• Average Sequence Length: 37 residues
• Representative Sequence: MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR
• Number of Associated Samples: 113
• Number of Associated Scaffolds: 149

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 77.18 %
• % of genes near scaffold ends (potentially truncated): 26.85 %
• % of genes from short scaffolds (< 2000 bps): 87.92 %
• Associated GOLD sequencing projects: 106
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (50.336 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.752 % of family members)
• Environment Ontology (ENVO): Unclassified (16.779 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (54.362 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 42.19%
  β-sheet: 0.00%
  Coil/Unstructured: 57.81%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 149 Family Scaffolds
PF04542	Sigma70_r2	11.41
PF08281	Sigma70_r4_2	5.37
PF01734	Patatin	4.70
PF06532	NrsF	4.70
PF02683	DsbD	2.68
PF00106	adh_short	1.34
PF07883	Cupin_2	1.34
PF00126	HTH_1	1.34
PF03625	DUF302	0.67
PF03466	LysR_substrate	0.67
PF13442	Cytochrome_CBB3	0.67
PF07508	Recombinase	0.67
PF07690	MFS_1	0.67
PF14342	DUF4396	0.67
PF00248	Aldo_ket_red	0.67
PF09361	Phasin_2	0.67
PF04982	HPP	0.67
PF01339	CheB_methylest	0.67
PF07992	Pyr_redox_2	0.67
PF00174	Oxidored_molyb	0.67
PF10262	Rdx	0.67
PF00440	TetR_N	0.67
PF01430	HSP33	0.67
PF06764	DUF1223	0.67
PF02627	CMD	0.67
PF00190	Cupin_1	0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 149 Family Scaffolds
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	11.41
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	11.41
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	11.41
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	11.41
COG4944	Uncharacterized conserved protein	Function unknown [S]	4.70
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	4.70
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	4.70
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	4.70
COG2201	Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains	Signal transduction mechanisms [T]	1.34
COG5429	Uncharacterized conserved protein, DUF1223 domain	Function unknown [S]	0.67
COG3915	Uncharacterized conserved protein	Function unknown [S]	0.67
COG3448	CBS-domain-containing membrane protein	Signal transduction mechanisms [T]	0.67
COG3439	Uncharacterized conserved protein, DUF302 family	Function unknown [S]	0.67
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.67
COG2041	Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases	Energy production and conversion [C]	0.67
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.67
COG1281	Redox-regulated molecular chaperone, HSP33 family	Posttranslational modification, protein turnover, chaperones [O]	0.67
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.67

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
All Organisms	root	All Organisms	49.66 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
cellular organisms	root	All Organisms → cellular organisms	49.66 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	49.66 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	42.28 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	27.52 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	19.46 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4.03 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.34 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.34 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.36 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.34 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1.34 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.34 %
Bradyrhizobium icense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	0.67 %
unclassified Hyphomicrobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium	0.67 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.67 %
Hyphomicrobium album	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium album	0.67 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.34 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.34 %
Hyphomicrobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp.	0.67 %
Bradyrhizobium sp. NAS80.1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1	0.67 %
Bradyrhizobium icense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	0.67 %
Hyphomicrobium album	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium album	0.67 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2035918004|FACENC_F56XM5W01CXMW2	Not Available	538
2124908007|FWIRElOz_GKZ9IRQ02JEJHR	Not Available	523
2228664021|ICCgaii200_c0797009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	880
3300000567|JGI12270J11330_10011677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5794
3300005332|Ga0066388_100142037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2967
3300005337|Ga0070682_100233375	All Organisms → cellular organisms → Bacteria → Proteobacteria	1316
3300005341|Ga0070691_10129480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1	1277
3300005344|Ga0070661_100030900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3871
3300005355|Ga0070671_100004051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11557
3300005543|Ga0070672_100005488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8410
3300005548|Ga0070665_102220678	Not Available	552
3300005615|Ga0070702_101744770	Not Available	518
3300005617|Ga0068859_100759428	Not Available	1058
3300005713|Ga0066905_100031921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3000
3300005713|Ga0066905_100167844	Not Available	1603
3300005713|Ga0066905_101237809	All Organisms → cellular organisms → Bacteria	669
3300005764|Ga0066903_100561941	All Organisms → cellular organisms → Bacteria → Proteobacteria	1961
3300005764|Ga0066903_100662324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1829
3300005764|Ga0066903_101003312	Not Available	1526
3300005764|Ga0066903_101118399	All Organisms → cellular organisms → Bacteria → Proteobacteria	1454
3300005764|Ga0066903_104828069	Not Available	717
3300005764|Ga0066903_104986307	All Organisms → cellular organisms → Bacteria	704
3300005764|Ga0066903_105008894	Not Available	703
3300005764|Ga0066903_107092180	Not Available	581
3300006049|Ga0075417_10076190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1491
3300006059|Ga0075017_100235527	Not Available	1335
3300006059|Ga0075017_100770419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	742
3300006163|Ga0070715_10327654	Not Available	829
3300006163|Ga0070715_11038496	Not Available	513
3300006172|Ga0075018_10315790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	775
3300006172|Ga0075018_10364985	Not Available	727
3300006172|Ga0075018_10401923	All Organisms → cellular organisms → Bacteria → Proteobacteria	697
3300006174|Ga0075014_100994604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	508
3300006175|Ga0070712_100139009	All Organisms → cellular organisms → Bacteria → Proteobacteria	1851
3300006806|Ga0079220_11966608	Not Available	520
3300006845|Ga0075421_101382590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	775
3300006845|Ga0075421_102235652	Not Available	576
3300006954|Ga0079219_10084355	All Organisms → cellular organisms → Bacteria → Proteobacteria	1504
3300006954|Ga0079219_12447842	Not Available	507
3300009094|Ga0111539_10281358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1936
3300009100|Ga0075418_11397457	Not Available	759
3300009100|Ga0075418_12683639	Not Available	544
3300009156|Ga0111538_10156205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2898
3300009156|Ga0111538_11658878	Not Available	805
3300009156|Ga0111538_11691836	Not Available	797
3300009162|Ga0075423_10505912	All Organisms → cellular organisms → Bacteria → Proteobacteria	1270
3300009162|Ga0075423_12080990	Not Available	615
3300009521|Ga0116222_1022634	All Organisms → cellular organisms → Bacteria → Proteobacteria	2831
3300009551|Ga0105238_12993077	Not Available	508
3300009804|Ga0105063_1063293	Not Available	557
3300009839|Ga0116223_10332553	Not Available	902
3300010046|Ga0126384_10383641	Not Available	1181
3300010046|Ga0126384_11119019	Not Available	723
3300010048|Ga0126373_12229036	Not Available	609
3300010362|Ga0126377_10877389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp.	959
3300010371|Ga0134125_11103717	All Organisms → cellular organisms → Bacteria	868
3300010376|Ga0126381_101540356	Not Available	961
3300010379|Ga0136449_102086272	Not Available	833
3300010396|Ga0134126_11684401	Not Available	696
3300010398|Ga0126383_12923353	Not Available	558
3300010399|Ga0134127_11773974	Not Available	693
3300012019|Ga0120139_1074401	Not Available	831
3300012685|Ga0137397_10930803	Not Available	643
3300012904|Ga0157282_10423338	Not Available	505
3300012929|Ga0137404_10790560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	861
3300012951|Ga0164300_10147307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1098
3300012951|Ga0164300_10318263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	821
3300012957|Ga0164303_11343598	Not Available	531
3300012958|Ga0164299_10934937	Not Available	632
3300012960|Ga0164301_10416981	Not Available	945
3300012960|Ga0164301_11019150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	652
3300012961|Ga0164302_10980894	All Organisms → cellular organisms → Bacteria → Proteobacteria	656
3300012961|Ga0164302_11931243	Not Available	503
3300012971|Ga0126369_10979149	Not Available	933
3300012984|Ga0164309_10314957	Not Available	1134
3300012985|Ga0164308_10426939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1091
3300012987|Ga0164307_10548900	All Organisms → cellular organisms → Bacteria	882
3300012988|Ga0164306_10151273	All Organisms → cellular organisms → Bacteria	1582
3300012989|Ga0164305_10671165	All Organisms → cellular organisms → Bacteria → Proteobacteria	843
3300013296|Ga0157374_12550308	Not Available	539
3300013307|Ga0157372_11974979	Not Available	670
3300013766|Ga0120181_1078211	Not Available	728
3300014823|Ga0120170_1010450	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3011
3300015201|Ga0173478_10548092	Not Available	590
3300015372|Ga0132256_101616635	Not Available	758
3300016341|Ga0182035_10206282	All Organisms → cellular organisms → Bacteria → Proteobacteria	1558
3300016341|Ga0182035_11854272	Not Available	546
3300016357|Ga0182032_10806388	All Organisms → cellular organisms → Bacteria	794
3300016371|Ga0182034_10507580	Not Available	1007
3300016404|Ga0182037_10163042	All Organisms → cellular organisms → Bacteria → Proteobacteria	1694
3300016445|Ga0182038_10282418	Not Available	1350
3300017792|Ga0163161_10422436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1073
3300017821|Ga0187812_1202845	All Organisms → cellular organisms → Bacteria → Proteobacteria	634
3300017822|Ga0187802_10035328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1790
3300017822|Ga0187802_10142726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	913
3300017932|Ga0187814_10206538	All Organisms → cellular organisms → Bacteria → Proteobacteria	739
3300017955|Ga0187817_10133394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1575
3300017974|Ga0187777_10304333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1090
3300017974|Ga0187777_10786390	Not Available	679
3300018001|Ga0187815_10110593	All Organisms → cellular organisms → Bacteria → Proteobacteria	1159
3300018006|Ga0187804_10273917	All Organisms → cellular organisms → Bacteria → Proteobacteria	732
3300018007|Ga0187805_10024147	All Organisms → cellular organisms → Bacteria	2672
3300018058|Ga0187766_10980472	Not Available	601
3300019356|Ga0173481_10369104	Not Available	692
3300019356|Ga0173481_10590009	Not Available	582
3300019356|Ga0173481_10719100	Not Available	542
3300021560|Ga0126371_10279897	All Organisms → cellular organisms → Bacteria → Proteobacteria	1790
3300021560|Ga0126371_11524203	Not Available	796
3300021855|Ga0213854_1217739	Not Available	642
3300021855|Ga0213854_1287217	All Organisms → cellular organisms → Bacteria → Proteobacteria	813
3300022467|Ga0224712_10310438	Not Available	739
3300023077|Ga0247802_1067113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	589
3300023263|Ga0247800_1055469	Not Available	732
3300025899|Ga0207642_10762695	Not Available	613
3300025904|Ga0207647_10033622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3282
3300025904|Ga0207647_10227872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1073
3300025905|Ga0207685_10431556	Not Available	681
3300025913|Ga0207695_11061728	Not Available	690
3300025915|Ga0207693_10045165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3461
3300026118|Ga0207675_100005269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12440
3300026118|Ga0207675_101522131	Not Available	690
3300026498|Ga0257156_1094979	Not Available	620
3300027570|Ga0208043_1013680	All Organisms → cellular organisms → Bacteria → Proteobacteria	2669
3300027696|Ga0208696_1021587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2419
3300027703|Ga0207862_1135880	Not Available	737
3300027894|Ga0209068_10281302	All Organisms → cellular organisms → Bacteria	931
3300028047|Ga0209526_10099297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2049
3300028802|Ga0307503_10277445	Not Available	831
3300030659|Ga0316363_10234946	All Organisms → cellular organisms → Bacteria	751
3300031057|Ga0170834_110560557	Not Available	1159
3300031545|Ga0318541_10593347	All Organisms → cellular organisms → Bacteria	620
3300031573|Ga0310915_10140545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1664
3300031573|Ga0310915_10286892	All Organisms → cellular organisms → Bacteria → Proteobacteria	1162
3300031573|Ga0310915_10582993	Not Available	793
3300031720|Ga0307469_10889012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium album	824
3300031744|Ga0306918_11120294	Not Available	609
3300031873|Ga0315297_10005630	All Organisms → cellular organisms → Bacteria → Proteobacteria	8276
3300031879|Ga0306919_10508294	Not Available	929
3300031910|Ga0306923_11327026	Not Available	762
3300031912|Ga0306921_12020651	All Organisms → cellular organisms → Bacteria	613
3300031941|Ga0310912_10724916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	770
3300031947|Ga0310909_10643310	Not Available	884
3300031947|Ga0310909_10959904	Not Available	700
3300031954|Ga0306926_10273770	Not Available	2091
3300032013|Ga0310906_10511858	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	814
3300032076|Ga0306924_11251899	Not Available	800
3300032261|Ga0306920_101426599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	991
3300032261|Ga0306920_101766067	All Organisms → cellular organisms → Bacteria → Proteobacteria	874
3300032892|Ga0335081_10924241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1026

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.88%
Host-Associated	Host-Associated	18.12%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	69.80%
Plants	Host-Associated → Plants	18.12%
Aquatic	Environmental → Aquatic	12.08%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	69.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.42%
Freshwater	Environmental → Aquatic → Freshwater	7.38%
Sediment	Environmental → Aquatic → Sediment	4.70%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.70%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	51.68%
Loam	Environmental → Terrestrial → Soil → Loam	14.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.07%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.37%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.70%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.70%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.36%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.68%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.34%
Lake	Environmental → Aquatic → Freshwater → Lake	0.67%
Sand	Environmental → Terrestrial → Soil → Sand	0.67%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.86%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	16.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.40%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	5.37%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.37%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.70%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.70%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.36%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.68%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.01%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.34%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.67%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.67%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.67%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.40%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.72%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.38%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.04%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	5.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.37%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.70%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	4.70%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.70%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.01%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.01%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.01%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.01%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.01%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	1.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.34%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.34%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.34%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.34%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.67%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.67%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.67%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.67%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.67%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2035918004	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-	Environmental
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009521	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG	Environmental
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009804	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40	Environmental
3300009839	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300012019	Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012904	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300013766	Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M	Environmental
3300014823	Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M	Environmental
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental
3300015372	Soil combined assembly	Host-Associated
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017821	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2	Environmental
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental
3300017932	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4	Environmental
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300018001	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5	Environmental
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300021855	Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)	Environmental
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300023077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6	Environmental
3300023263	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6	Environmental
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300026498	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A	Environmental
3300027570	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)	Environmental
3300027696	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)	Environmental
3300027703	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300030659	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCA_7104230	2035918004	Soil	MKKLLVAVALVVAFAAPAMADPFPNYYATNSDAVSR
FWIRElOz_09306880	2124908007	Soil	MKKLFLAAALAVAFAAPALAQEFTNYYATDSDAMSH
ICCgaii200_07970093	2228664021	Soil	YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR
JGI12270J11330_100116773	3300000567	Peatlands Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATNSGAMGR*
Ga0066388_1001420372	3300005332	Tropical Forest Soil	VATFVMEKLFLATALVIAFAAPALAHEFPNYYATDSDAMSR*
Ga0070682_1002333754	3300005337	Corn Rhizosphere	RRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0070691_101294803	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	RRFVMKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR*
Ga0070661_1000309006	3300005344	Corn Rhizosphere	MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSRRAVRDHI
Ga0070671_1000040511	3300005355	Switchgrass Rhizosphere	MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMAARAVRDHI
Ga0070672_1000054884	3300005543	Miscanthus Rhizosphere	MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0070665_1022206782	3300005548	Switchgrass Rhizosphere	MKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR*
Ga0070702_1017447703	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	RRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR*
Ga0068859_1007594282	3300005617	Switchgrass Rhizosphere	MKKLFLAVALVVAFAAPAMAQNFVNPYSASCDACR*
Ga0066905_1000319213	3300005713	Tropical Forest Soil	MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR*
Ga0066905_1001678442	3300005713	Tropical Forest Soil	MKKLFLAVALVVTFAAPALADPFPNYYATSSDAMGH*
Ga0066905_1012378091	3300005713	Tropical Forest Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATASDAMGR*
Ga0066903_1005619413	3300005764	Tropical Forest Soil	MKKIVLAVALVLSFAAPAMAGQFPNLYATSADARR*
Ga0066903_1006623244	3300005764	Tropical Forest Soil	MNKLFLAIALIVAFAAPAMAEQFPNNYATNSDAVSR*
Ga0066903_1010033122	3300005764	Tropical Forest Soil	MKKLFLAAALVVAFAAPAMAEQFPNNYATTSDAMGR*
Ga0066903_1011183992	3300005764	Tropical Forest Soil	MKKLFLALALVVAFAAPAMAEPFPNYYATNSDAMSR*
Ga0066903_1048280692	3300005764	Tropical Forest Soil	GDSSMKKLFLAVALVVAFAAPAMAEQFPNNYATASDAMGR*
Ga0066903_1049863071	3300005764	Tropical Forest Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATNSDAISR*
Ga0066903_1050088942	3300005764	Tropical Forest Soil	MKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR*
Ga0066903_1070921802	3300005764	Tropical Forest Soil	MKKLLVAVALVVTFAAPAMAEPFPNYYATNSDAMSR*
Ga0075417_100761901	3300006049	Populus Rhizosphere	YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0075017_1002355272	3300006059	Watersheds	MKKLFLAVALVVAFAAPAMAEQFPNLYATNADAGGR*
Ga0075017_1007704192	3300006059	Watersheds	MKKLFLAVALVVAFAAPAMAEQFPNPYATNSDALGH*
Ga0070715_103276542	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAVSR*
Ga0070715_110384961	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLFIAVALVVAFAAPAMAGQFPNLYATNADAMSH*
Ga0075018_103157901	3300006172	Watersheds	MKKLFLAVALVVAFAAPAMAEQFPNNYATDSDAMSR*
Ga0075018_103649852	3300006172	Watersheds	MKKLFLAVALVVAFAAPAMAEQFPNLYATNADAGGH*
Ga0075018_104019233	3300006172	Watersheds	MKKIVLAVALVVAFAAPAMAQNFPNPYLTDSQQQQ*
Ga0075014_1009946042	3300006174	Watersheds	MKKLFLAVALVVAFAAPAMAEQFPNPYATNSDAMGH*
Ga0070712_1001390093	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLFLAAALAVAFAAPALAQEFTNYYATDSDAMSH*
Ga0079220_119666081	3300006806	Agricultural Soil	MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSH*
Ga0075421_1013825901	3300006845	Populus Rhizosphere	YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR*
Ga0075421_1022356521	3300006845	Populus Rhizosphere	LRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0079219_100843552	3300006954	Agricultural Soil	MKKLFLVLALVVASAAPALADAFPNYYATNSDARNH*
Ga0079219_124478421	3300006954	Agricultural Soil	MKKLFLAVALVVAFAAPAMAEQFPNLYATSSDTMGN*
Ga0111539_102813584	3300009094	Populus Rhizosphere	FSQPRRSSMKKLFLVLALVVASAAPALADAFPNYYATNSDARNH*
Ga0075418_113974571	3300009100	Populus Rhizosphere	RFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0075418_126836392	3300009100	Populus Rhizosphere	VMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0111538_101562053	3300009156	Populus Rhizosphere	MKKLFLAAALVVAFAAPALAHEFTNYYATVSYAMSR*
Ga0111538_116588781	3300009156	Populus Rhizosphere	KKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0111538_116918361	3300009156	Populus Rhizosphere	RFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR*
Ga0075423_105059122	3300009162	Populus Rhizosphere	MKKLFLAAALVVAFAAPALAHEFTNYYATNSDAMSR*
Ga0075423_120809901	3300009162	Populus Rhizosphere	MKKLFIAVALVVASAAPAMAGQFPNLYATNADAMSH*
Ga0116222_10226343	3300009521	Peatlands Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATNSDAMGR*
Ga0105238_129930771	3300009551	Corn Rhizosphere	MKKLFLAAALVVAFAAPALAHEFTNYYATDSDAMSR*
Ga0105063_10632931	3300009804	Groundwater Sand	KKLFLAVALAVAFAAPARAEQFPNYYATSSDTMGQ*
Ga0116223_103325532	3300009839	Peatlands Soil	MKKVFLAVALIVAFAAPAMAGQFPNAYATNSDAMRH*
Ga0126384_103836412	3300010046	Tropical Forest Soil	MKKLFLAVALVVACAAPAMAEPFPNYYATNSDAMSR*
Ga0126384_111190191	3300010046	Tropical Forest Soil	RRFVMKKLFLAAALVVAFAAPAMAEQFPNNYATTSDAMGR*
Ga0126373_122290361	3300010048	Tropical Forest Soil	MKKLLVTVALVVAFAAPALADPFPNYYATNSDVMNR*
Ga0126377_108773892	3300010362	Tropical Forest Soil	MKKLFLAAALVVAFAAPALAHEFPNYYATDSDARAARPGS*
Ga0134125_111037172	3300010371	Terrestrial Soil	MKKLFLAAALVVAFAAPALAQEFTNYYATDSDAMSR*
Ga0126381_1015403561	3300010376	Tropical Forest Soil	MKKIVLAVALVLSFAAPAMAGKFPNLYATSADARR*
Ga0136449_1020862722	3300010379	Peatlands Soil	MKKLFIAVALVVAFAAPAMAGQFPNLYATNADVMGH*
Ga0134126_116844011	3300010396	Terrestrial Soil	MKKLFLAVALVVAFAAPALAHEFPNYYATSSDTMDH*
Ga0126383_129233531	3300010398	Tropical Forest Soil	MKKLFLAVALVVAFAAPALADPFPNYYATNSDAISR*
Ga0134127_117739742	3300010399	Terrestrial Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATDSDAMGR*
Ga0120139_10744012	3300012019	Permafrost	MKKLFLAVALVVAFAAPALAHEFPNYYATASNAMGR*
Ga0137397_109308032	3300012685	Vadose Zone Soil	MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAISR*
Ga0157282_104233382	3300012904	Soil	FVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0137404_107905601	3300012929	Vadose Zone Soil	MKKLFLAVALVVACAAPAMAEQFPNSYATDSDAMSR*
Ga0164300_101473071	3300012951	Soil	KLFLAAALVVAFAAPALAHEFLNYYATDSDAMSR*
Ga0164300_103182633	3300012951	Soil	MKKLFLAAALVVAFAAPALAHEFTNYYATDSGAMSL*
Ga0164303_113435981	3300012957	Soil	MKKLFLAVALIVAFAAPAMAGQFPNPYATNSDAMSR*
Ga0164299_109349372	3300012958	Soil	MKKLFLAVALVVAFVAPAMAEQFPNNYATDSDAMSR*
Ga0164301_104169813	3300012960	Soil	MKKLFLAAALVVAFAAPALAHEFANYYATDSDAMSR*
Ga0164301_110191502	3300012960	Soil	MKKLFLAVALVVAFVAPAMAEQFPNNYATDSDAMS
Ga0164302_109808941	3300012961	Soil	MKKLFIAVALVVAFAAPAMAGAFPNLYATNADAMSH*
Ga0164302_119312431	3300012961	Soil	MKKLFLAIALVVAFAAPAMAEQFPNNYATDSDAMSR*
Ga0126369_109791493	3300012971	Tropical Forest Soil	MKKLFLAIALVVACAAPAMAEQFPNNYATNSDAVSR*
Ga0164309_103149572	3300012984	Soil	MKKLFLAAALVVAFAAPALAHEFLNYYATDSDAMSR*
Ga0164308_104269392	3300012985	Soil	MKKLFLAAALVVAFAAPALVHEFPNYYATDSDAMSR*
Ga0164307_105489002	3300012987	Soil	MKKLFLAAALVVAFAAPAVANEFPNYYATDSHAMSR*
Ga0164306_101512731	3300012988	Soil	MTKLFLAAALVVAFAAPALAHEFQNYYTTDSDAMSR*
Ga0164305_106711652	3300012989	Soil	MKKLFIAAALVVAFAAPSMAGEFPNLYATNADAMSH*
Ga0157374_125503082	3300013296	Miscanthus Rhizosphere	KLFLAAAMVVAFAAPALAHEFPNYYATDSGAMSR*
Ga0157372_119749792	3300013307	Corn Rhizosphere	MKKLVLAAALVVAFAAPALAHEFTNYYATDSDAMSR*
Ga0120181_10782111	3300013766	Permafrost	MKKLFLAVALVVAFAAPALAHEFPNNYATDSNAMGR*
Ga0120170_10104504	3300014823	Permafrost	MKKLFLAVALVVAFAAPALAHEFPNYYATDSNAMGR*
Ga0173478_105480922	3300015201	Soil	MKKLFLTAALVVAFAAPALAHEFQNYYATDSDAMSR*
Ga0132256_1016166352	3300015372	Arabidopsis Rhizosphere	MKKLFIAVALVVAFAAPAMAGQFPNLYATNADAMSR*
Ga0182035_102062823	3300016341	Soil	MKKIVLAVALVLSFAAPAMAGQFPNLYATNADARSQ
Ga0182035_118542722	3300016341	Soil	MKKLFLVLPLVVAFAAPAMAEPFPNYYATTSDAMSR
Ga0182032_108063881	3300016357	Soil	KSLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR
Ga0182034_105075802	3300016371	Soil	MNKLFLAVALVVAFAAPAMAGHQFPNPYASNSDAMDH
Ga0182037_101630423	3300016404	Soil	MSKIVLAVALVLSFAAPAMAGQFPNLYATNADARSQ
Ga0182038_102824183	3300016445	Soil	MSKIVLAVALVLSFAAPAMAGQFPNLYATNADARTQ
Ga0163161_104224361	3300017792	Switchgrass Rhizosphere	RRFVMKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR
Ga0187812_12028453	3300017821	Freshwater Sediment	MKKLFLAVALVVAFAAPAMAGHQFPNLYATNSDAMDH
Ga0187802_100353281	3300017822	Freshwater Sediment	MKKLFLAVALVVAFAAPAMAGHQFPNPYATNSDAMGQ
Ga0187802_101427262	3300017822	Freshwater Sediment	MKKLFLAVALVVAFAAPAMAAHQFPNPYATNVDARGQ
Ga0187814_102065382	3300017932	Freshwater Sediment	MKKLFLAVALVVAFAAPAMAAHQFPNPYATNVDARGL
Ga0187817_101333941	3300017955	Freshwater Sediment	MKKLFIAVALVVAFAAPAMAGEFPNLYATNADAMSH
Ga0187777_103043332	3300017974	Tropical Peatland	MFKTLILAVALIATSAAALPAMAGQFPNLYATNADARSH
Ga0187777_107863902	3300017974	Tropical Peatland	MKKIVLAIALVLSFAAPAMAGQFPNLYATNADARTH
Ga0187815_101105931	3300018001	Freshwater Sediment	ARSTGPRIDRRTPMMKLFLAVALVVAFAAPAMAGHQFPNPYATNVDARGQ
Ga0187804_102739172	3300018006	Freshwater Sediment	MKKLFLAVALVAAFAAPAMAGHQFPNPYATNMDARGQ
Ga0187805_100241472	3300018007	Freshwater Sediment	MKKLFLAVALVVAFAAPAMAGHQFPNPYATNVDARDQ
Ga0187766_109804721	3300018058	Tropical Peatland	MKKLFLAVALVVAFATPAMAGHQFPNLYATNSDAMDH
Ga0173481_103691041	3300019356	Soil	MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR
Ga0173481_105900091	3300019356	Soil	YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR
Ga0173481_107191001	3300019356	Soil	MKKLFLAAALVVAFAAPALAHEFQNYYATDSGAMSR
Ga0126371_102798973	3300021560	Tropical Forest Soil	MKKLFLAVALVVAFAAPALADPFPNYYATNSDAISR
Ga0126371_115242031	3300021560	Tropical Forest Soil	MKKLFLALALVVAFAAPAMAEPFPNYYATNSDAMSR
Ga0213854_12177391	3300021855	Watersheds	MKKLFLAVALVVAFAAPAMAEQFPNLYATNADAGGR
Ga0213854_12872171	3300021855	Watersheds	RPSIDRRIPMKKLFLAVALVVAFAAPAMAGQFPNLYATGADARSH
Ga0224712_103104382	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR
Ga0247802_10671132	3300023077	Soil	MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMS
Ga0247800_10554691	3300023263	Soil	MKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR
Ga0207642_107626951	3300025899	Miscanthus Rhizosphere	RRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR
Ga0207647_100336225	3300025904	Corn Rhizosphere	FEGHYLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR
Ga0207647_102278721	3300025904	Corn Rhizosphere	FEGHYLRRFVMKKLFLAAALVVAFAAPALAHEFTNYYATDSDAMSR
Ga0207685_104315561	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLFLAAALVVAFAAPALAHEFLNYYATDSDAMSR
Ga0207695_110617281	3300025913	Corn Rhizosphere	QSGCGKSHYLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR
Ga0207693_100451651	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	RFVMKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR
Ga0207675_1000052691	3300026118	Switchgrass Rhizosphere	VMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR
Ga0207675_1015221313	3300026118	Switchgrass Rhizosphere	VMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR
Ga0257156_10949792	3300026498	Soil	MKKLFLAVALVVAFAAPALAHEFPNYYATSSDTMHQ
Ga0208043_10136803	3300027570	Peatlands Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATNSGAMGR
Ga0208696_10215873	3300027696	Peatlands Soil	MKKLFLAVALVVAFAAPAMAEQFPNNYATNSDAMGR
Ga0207862_11358802	3300027703	Tropical Forest Soil	MKKLFLAVALVVAFAAPAMAGHQFPNPYATSVDAMDH
Ga0209068_102813022	3300027894	Watersheds	MKKLFLAVALVVAFAAPAMAGQFPNAYATNSNAMGH
Ga0209526_100992971	3300028047	Forest Soil	ATEGESSMKKLFLAVALVVAFAAPALAHEFPNNYATDSNAMGR
Ga0307503_102774452	3300028802	Soil	MKKLFLAVALVVAFAAPAMAQNFVNPYSASCDACR
Ga0316363_102349461	3300030659	Peatlands Soil	MKKVFLAVALIVAFAAPAMAGQFPNAYATNSDAMRH
Ga0170834_1105605573	3300031057	Forest Soil	MKKLFLAVALVVAFAAPAMAEQFHNNYATDSDAMSR
Ga0318541_105933472	3300031545	Soil	MNKLFLAVALVVAFAAPAMAAAGHRFPNPHATNSDAMD
Ga0310915_101405451	3300031573	Soil	MKKLFLAVALVVAFAAPAMAGHQFPNPYASNSDAMDH
Ga0310915_102868922	3300031573	Soil	MKKLFFAVALVFAFAAPAMAEPFPNYYATNSDAMSR
Ga0310915_105829932	3300031573	Soil	MKKIVLAVALVLSFAAPAMAGQFPNLYATNADARTQ
Ga0307469_108890122	3300031720	Hardwood Forest Soil	MKKLFLAAALVVACAAPALAHEFPNYYATDSDAMSR
Ga0306918_111202942	3300031744	Soil	MKKIMLAVALVLSFAAPAMAGQFPNLYATSADARTQ
Ga0315297_1000563012	3300031873	Sediment	MKKLFLAVALVVAFAAPAMAQNFVNPYSAACDACR
Ga0306919_105082941	3300031879	Soil	MKKLFLAVALVVAFAAPAMAAAGHQFPNPYATNSDAMDH
Ga0306923_113270262	3300031910	Soil	SMKKLVLAVALVVAFAAPAMAEPFPNYYATNSDAMSR
Ga0306921_120206511	3300031912	Soil	MKSLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR
Ga0310912_107249161	3300031941	Soil	MKKLLIAIALVVAFAAPALAQPFPNYYATNSDAISH
Ga0310909_106433101	3300031947	Soil	LSMKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR
Ga0310909_109599042	3300031947	Soil	MKKIVLAVALVLSFAAPAMAGQFPNLYATSADARTQ
Ga0306926_102737702	3300031954	Soil	MKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR
Ga0310906_105118581	3300032013	Soil	MKKLFLAAALVVAFAAPSLAHEFPNYYATDSGAMSR
Ga0306924_112518992	3300032076	Soil	MKKLLIAIALVVTFAAPALAQPFPNYYATNSDAISH
Ga0306920_1014265992	3300032261	Soil	MNKLFLAVALVVAFAAPAMAAAGHQFPNPYATNSDAMDH
Ga0306920_1017660672	3300032261	Soil	MKKLFLAVALVVAFAAPAMAEPFPNYYATNFDAMSR
Ga0335081_109242411	3300032892	Soil	MKKLFLAVALVVAFGAPAMADQFPNSYATASDAMSH