| Basic Information | |
|---|---|
| Family ID | F047945 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.18 % |
| % of genes near scaffold ends (potentially truncated) | 26.85 % |
| % of genes from short scaffolds (< 2000 bps) | 87.92 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.336 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.779 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.362 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.19% β-sheet: 0.00% Coil/Unstructured: 57.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF04542 | Sigma70_r2 | 11.41 |
| PF08281 | Sigma70_r4_2 | 5.37 |
| PF01734 | Patatin | 4.70 |
| PF06532 | NrsF | 4.70 |
| PF02683 | DsbD | 2.68 |
| PF00106 | adh_short | 1.34 |
| PF07883 | Cupin_2 | 1.34 |
| PF00126 | HTH_1 | 1.34 |
| PF03625 | DUF302 | 0.67 |
| PF03466 | LysR_substrate | 0.67 |
| PF13442 | Cytochrome_CBB3 | 0.67 |
| PF07508 | Recombinase | 0.67 |
| PF07690 | MFS_1 | 0.67 |
| PF14342 | DUF4396 | 0.67 |
| PF00248 | Aldo_ket_red | 0.67 |
| PF09361 | Phasin_2 | 0.67 |
| PF04982 | HPP | 0.67 |
| PF01339 | CheB_methylest | 0.67 |
| PF07992 | Pyr_redox_2 | 0.67 |
| PF00174 | Oxidored_molyb | 0.67 |
| PF10262 | Rdx | 0.67 |
| PF00440 | TetR_N | 0.67 |
| PF01430 | HSP33 | 0.67 |
| PF06764 | DUF1223 | 0.67 |
| PF02627 | CMD | 0.67 |
| PF00190 | Cupin_1 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 11.41 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 11.41 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 11.41 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 11.41 |
| COG4944 | Uncharacterized conserved protein | Function unknown [S] | 4.70 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 4.70 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 4.70 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 4.70 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.34 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.67 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.67 |
| COG3448 | CBS-domain-containing membrane protein | Signal transduction mechanisms [T] | 0.67 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.67 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.67 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.67 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.67 |
| COG1281 | Redox-regulated molecular chaperone, HSP33 family | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.34 % |
| All Organisms | root | All Organisms | 49.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01CXMW2 | Not Available | 538 | Open in IMG/M |
| 2124908007|FWIRElOz_GKZ9IRQ02JEJHR | Not Available | 523 | Open in IMG/M |
| 2228664021|ICCgaii200_c0797009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 880 | Open in IMG/M |
| 3300000567|JGI12270J11330_10011677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5794 | Open in IMG/M |
| 3300005332|Ga0066388_100142037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2967 | Open in IMG/M |
| 3300005337|Ga0070682_100233375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300005341|Ga0070691_10129480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1277 | Open in IMG/M |
| 3300005344|Ga0070661_100030900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3871 | Open in IMG/M |
| 3300005355|Ga0070671_100004051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11557 | Open in IMG/M |
| 3300005543|Ga0070672_100005488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8410 | Open in IMG/M |
| 3300005548|Ga0070665_102220678 | Not Available | 552 | Open in IMG/M |
| 3300005615|Ga0070702_101744770 | Not Available | 518 | Open in IMG/M |
| 3300005617|Ga0068859_100759428 | Not Available | 1058 | Open in IMG/M |
| 3300005713|Ga0066905_100031921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3000 | Open in IMG/M |
| 3300005713|Ga0066905_100167844 | Not Available | 1603 | Open in IMG/M |
| 3300005713|Ga0066905_101237809 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005764|Ga0066903_100561941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1961 | Open in IMG/M |
| 3300005764|Ga0066903_100662324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1829 | Open in IMG/M |
| 3300005764|Ga0066903_101003312 | Not Available | 1526 | Open in IMG/M |
| 3300005764|Ga0066903_101118399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300005764|Ga0066903_104828069 | Not Available | 717 | Open in IMG/M |
| 3300005764|Ga0066903_104986307 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005764|Ga0066903_105008894 | Not Available | 703 | Open in IMG/M |
| 3300005764|Ga0066903_107092180 | Not Available | 581 | Open in IMG/M |
| 3300006049|Ga0075417_10076190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1491 | Open in IMG/M |
| 3300006059|Ga0075017_100235527 | Not Available | 1335 | Open in IMG/M |
| 3300006059|Ga0075017_100770419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 742 | Open in IMG/M |
| 3300006163|Ga0070715_10327654 | Not Available | 829 | Open in IMG/M |
| 3300006163|Ga0070715_11038496 | Not Available | 513 | Open in IMG/M |
| 3300006172|Ga0075018_10315790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 775 | Open in IMG/M |
| 3300006172|Ga0075018_10364985 | Not Available | 727 | Open in IMG/M |
| 3300006172|Ga0075018_10401923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300006174|Ga0075014_100994604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300006175|Ga0070712_100139009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1851 | Open in IMG/M |
| 3300006806|Ga0079220_11966608 | Not Available | 520 | Open in IMG/M |
| 3300006845|Ga0075421_101382590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300006845|Ga0075421_102235652 | Not Available | 576 | Open in IMG/M |
| 3300006954|Ga0079219_10084355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
| 3300006954|Ga0079219_12447842 | Not Available | 507 | Open in IMG/M |
| 3300009094|Ga0111539_10281358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1936 | Open in IMG/M |
| 3300009100|Ga0075418_11397457 | Not Available | 759 | Open in IMG/M |
| 3300009100|Ga0075418_12683639 | Not Available | 544 | Open in IMG/M |
| 3300009156|Ga0111538_10156205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2898 | Open in IMG/M |
| 3300009156|Ga0111538_11658878 | Not Available | 805 | Open in IMG/M |
| 3300009156|Ga0111538_11691836 | Not Available | 797 | Open in IMG/M |
| 3300009162|Ga0075423_10505912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300009162|Ga0075423_12080990 | Not Available | 615 | Open in IMG/M |
| 3300009521|Ga0116222_1022634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2831 | Open in IMG/M |
| 3300009551|Ga0105238_12993077 | Not Available | 508 | Open in IMG/M |
| 3300009804|Ga0105063_1063293 | Not Available | 557 | Open in IMG/M |
| 3300009839|Ga0116223_10332553 | Not Available | 902 | Open in IMG/M |
| 3300010046|Ga0126384_10383641 | Not Available | 1181 | Open in IMG/M |
| 3300010046|Ga0126384_11119019 | Not Available | 723 | Open in IMG/M |
| 3300010048|Ga0126373_12229036 | Not Available | 609 | Open in IMG/M |
| 3300010362|Ga0126377_10877389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 959 | Open in IMG/M |
| 3300010371|Ga0134125_11103717 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010376|Ga0126381_101540356 | Not Available | 961 | Open in IMG/M |
| 3300010379|Ga0136449_102086272 | Not Available | 833 | Open in IMG/M |
| 3300010396|Ga0134126_11684401 | Not Available | 696 | Open in IMG/M |
| 3300010398|Ga0126383_12923353 | Not Available | 558 | Open in IMG/M |
| 3300010399|Ga0134127_11773974 | Not Available | 693 | Open in IMG/M |
| 3300012019|Ga0120139_1074401 | Not Available | 831 | Open in IMG/M |
| 3300012685|Ga0137397_10930803 | Not Available | 643 | Open in IMG/M |
| 3300012904|Ga0157282_10423338 | Not Available | 505 | Open in IMG/M |
| 3300012929|Ga0137404_10790560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 861 | Open in IMG/M |
| 3300012951|Ga0164300_10147307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
| 3300012951|Ga0164300_10318263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 821 | Open in IMG/M |
| 3300012957|Ga0164303_11343598 | Not Available | 531 | Open in IMG/M |
| 3300012958|Ga0164299_10934937 | Not Available | 632 | Open in IMG/M |
| 3300012960|Ga0164301_10416981 | Not Available | 945 | Open in IMG/M |
| 3300012960|Ga0164301_11019150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 652 | Open in IMG/M |
| 3300012961|Ga0164302_10980894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300012961|Ga0164302_11931243 | Not Available | 503 | Open in IMG/M |
| 3300012971|Ga0126369_10979149 | Not Available | 933 | Open in IMG/M |
| 3300012984|Ga0164309_10314957 | Not Available | 1134 | Open in IMG/M |
| 3300012985|Ga0164308_10426939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1091 | Open in IMG/M |
| 3300012987|Ga0164307_10548900 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012988|Ga0164306_10151273 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300012989|Ga0164305_10671165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300013296|Ga0157374_12550308 | Not Available | 539 | Open in IMG/M |
| 3300013307|Ga0157372_11974979 | Not Available | 670 | Open in IMG/M |
| 3300013766|Ga0120181_1078211 | Not Available | 728 | Open in IMG/M |
| 3300014823|Ga0120170_1010450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3011 | Open in IMG/M |
| 3300015201|Ga0173478_10548092 | Not Available | 590 | Open in IMG/M |
| 3300015372|Ga0132256_101616635 | Not Available | 758 | Open in IMG/M |
| 3300016341|Ga0182035_10206282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300016341|Ga0182035_11854272 | Not Available | 546 | Open in IMG/M |
| 3300016357|Ga0182032_10806388 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300016371|Ga0182034_10507580 | Not Available | 1007 | Open in IMG/M |
| 3300016404|Ga0182037_10163042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1694 | Open in IMG/M |
| 3300016445|Ga0182038_10282418 | Not Available | 1350 | Open in IMG/M |
| 3300017792|Ga0163161_10422436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1073 | Open in IMG/M |
| 3300017821|Ga0187812_1202845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300017822|Ga0187802_10035328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1790 | Open in IMG/M |
| 3300017822|Ga0187802_10142726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 913 | Open in IMG/M |
| 3300017932|Ga0187814_10206538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300017955|Ga0187817_10133394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1575 | Open in IMG/M |
| 3300017974|Ga0187777_10304333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1090 | Open in IMG/M |
| 3300017974|Ga0187777_10786390 | Not Available | 679 | Open in IMG/M |
| 3300018001|Ga0187815_10110593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300018006|Ga0187804_10273917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300018007|Ga0187805_10024147 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300018058|Ga0187766_10980472 | Not Available | 601 | Open in IMG/M |
| 3300019356|Ga0173481_10369104 | Not Available | 692 | Open in IMG/M |
| 3300019356|Ga0173481_10590009 | Not Available | 582 | Open in IMG/M |
| 3300019356|Ga0173481_10719100 | Not Available | 542 | Open in IMG/M |
| 3300021560|Ga0126371_10279897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1790 | Open in IMG/M |
| 3300021560|Ga0126371_11524203 | Not Available | 796 | Open in IMG/M |
| 3300021855|Ga0213854_1217739 | Not Available | 642 | Open in IMG/M |
| 3300021855|Ga0213854_1287217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300022467|Ga0224712_10310438 | Not Available | 739 | Open in IMG/M |
| 3300023077|Ga0247802_1067113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 589 | Open in IMG/M |
| 3300023263|Ga0247800_1055469 | Not Available | 732 | Open in IMG/M |
| 3300025899|Ga0207642_10762695 | Not Available | 613 | Open in IMG/M |
| 3300025904|Ga0207647_10033622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3282 | Open in IMG/M |
| 3300025904|Ga0207647_10227872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1073 | Open in IMG/M |
| 3300025905|Ga0207685_10431556 | Not Available | 681 | Open in IMG/M |
| 3300025913|Ga0207695_11061728 | Not Available | 690 | Open in IMG/M |
| 3300025915|Ga0207693_10045165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3461 | Open in IMG/M |
| 3300026118|Ga0207675_100005269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12440 | Open in IMG/M |
| 3300026118|Ga0207675_101522131 | Not Available | 690 | Open in IMG/M |
| 3300026498|Ga0257156_1094979 | Not Available | 620 | Open in IMG/M |
| 3300027570|Ga0208043_1013680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2669 | Open in IMG/M |
| 3300027696|Ga0208696_1021587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2419 | Open in IMG/M |
| 3300027703|Ga0207862_1135880 | Not Available | 737 | Open in IMG/M |
| 3300027894|Ga0209068_10281302 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300028047|Ga0209526_10099297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2049 | Open in IMG/M |
| 3300028802|Ga0307503_10277445 | Not Available | 831 | Open in IMG/M |
| 3300030659|Ga0316363_10234946 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031057|Ga0170834_110560557 | Not Available | 1159 | Open in IMG/M |
| 3300031545|Ga0318541_10593347 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031573|Ga0310915_10140545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1664 | Open in IMG/M |
| 3300031573|Ga0310915_10286892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
| 3300031573|Ga0310915_10582993 | Not Available | 793 | Open in IMG/M |
| 3300031720|Ga0307469_10889012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium album | 824 | Open in IMG/M |
| 3300031744|Ga0306918_11120294 | Not Available | 609 | Open in IMG/M |
| 3300031873|Ga0315297_10005630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8276 | Open in IMG/M |
| 3300031879|Ga0306919_10508294 | Not Available | 929 | Open in IMG/M |
| 3300031910|Ga0306923_11327026 | Not Available | 762 | Open in IMG/M |
| 3300031912|Ga0306921_12020651 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031941|Ga0310912_10724916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 770 | Open in IMG/M |
| 3300031947|Ga0310909_10643310 | Not Available | 884 | Open in IMG/M |
| 3300031947|Ga0310909_10959904 | Not Available | 700 | Open in IMG/M |
| 3300031954|Ga0306926_10273770 | Not Available | 2091 | Open in IMG/M |
| 3300032013|Ga0310906_10511858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 814 | Open in IMG/M |
| 3300032076|Ga0306924_11251899 | Not Available | 800 | Open in IMG/M |
| 3300032261|Ga0306920_101426599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 991 | Open in IMG/M |
| 3300032261|Ga0306920_101766067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300032892|Ga0335081_10924241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1026 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.01% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.01% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.01% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.34% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_7104230 | 2035918004 | Soil | MKKLLVAVALVVAFAAPAMADPFPNYYATNSDAVSR |
| FWIRElOz_09306880 | 2124908007 | Soil | MKKLFLAAALAVAFAAPALAQEFTNYYATDSDAMSH |
| ICCgaii200_07970093 | 2228664021 | Soil | YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR |
| JGI12270J11330_100116773 | 3300000567 | Peatlands Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATNSGAMGR* |
| Ga0066388_1001420372 | 3300005332 | Tropical Forest Soil | VATFVMEKLFLATALVIAFAAPALAHEFPNYYATDSDAMSR* |
| Ga0070682_1002333754 | 3300005337 | Corn Rhizosphere | RRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0070691_101294803 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RRFVMKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR* |
| Ga0070661_1000309006 | 3300005344 | Corn Rhizosphere | MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSRRAVRDHI |
| Ga0070671_1000040511 | 3300005355 | Switchgrass Rhizosphere | MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMAARAVRDHI |
| Ga0070672_1000054884 | 3300005543 | Miscanthus Rhizosphere | MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0070665_1022206782 | 3300005548 | Switchgrass Rhizosphere | MKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR* |
| Ga0070702_1017447703 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR* |
| Ga0068859_1007594282 | 3300005617 | Switchgrass Rhizosphere | MKKLFLAVALVVAFAAPAMAQNFVNPYSASCDACR* |
| Ga0066905_1000319213 | 3300005713 | Tropical Forest Soil | MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR* |
| Ga0066905_1001678442 | 3300005713 | Tropical Forest Soil | MKKLFLAVALVVTFAAPALADPFPNYYATSSDAMGH* |
| Ga0066905_1012378091 | 3300005713 | Tropical Forest Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATASDAMGR* |
| Ga0066903_1005619413 | 3300005764 | Tropical Forest Soil | MKKIVLAVALVLSFAAPAMAGQFPNLYATSADARR* |
| Ga0066903_1006623244 | 3300005764 | Tropical Forest Soil | MNKLFLAIALIVAFAAPAMAEQFPNNYATNSDAVSR* |
| Ga0066903_1010033122 | 3300005764 | Tropical Forest Soil | MKKLFLAAALVVAFAAPAMAEQFPNNYATTSDAMGR* |
| Ga0066903_1011183992 | 3300005764 | Tropical Forest Soil | MKKLFLALALVVAFAAPAMAEPFPNYYATNSDAMSR* |
| Ga0066903_1048280692 | 3300005764 | Tropical Forest Soil | GDSSMKKLFLAVALVVAFAAPAMAEQFPNNYATASDAMGR* |
| Ga0066903_1049863071 | 3300005764 | Tropical Forest Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATNSDAISR* |
| Ga0066903_1050088942 | 3300005764 | Tropical Forest Soil | MKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR* |
| Ga0066903_1070921802 | 3300005764 | Tropical Forest Soil | MKKLLVAVALVVTFAAPAMAEPFPNYYATNSDAMSR* |
| Ga0075417_100761901 | 3300006049 | Populus Rhizosphere | YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0075017_1002355272 | 3300006059 | Watersheds | MKKLFLAVALVVAFAAPAMAEQFPNLYATNADAGGR* |
| Ga0075017_1007704192 | 3300006059 | Watersheds | MKKLFLAVALVVAFAAPAMAEQFPNPYATNSDALGH* |
| Ga0070715_103276542 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAVSR* |
| Ga0070715_110384961 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLFIAVALVVAFAAPAMAGQFPNLYATNADAMSH* |
| Ga0075018_103157901 | 3300006172 | Watersheds | MKKLFLAVALVVAFAAPAMAEQFPNNYATDSDAMSR* |
| Ga0075018_103649852 | 3300006172 | Watersheds | MKKLFLAVALVVAFAAPAMAEQFPNLYATNADAGGH* |
| Ga0075018_104019233 | 3300006172 | Watersheds | MKKIVLAVALVVAFAAPAMAQNFPNPYLTDSQQQQ* |
| Ga0075014_1009946042 | 3300006174 | Watersheds | MKKLFLAVALVVAFAAPAMAEQFPNPYATNSDAMGH* |
| Ga0070712_1001390093 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLFLAAALAVAFAAPALAQEFTNYYATDSDAMSH* |
| Ga0079220_119666081 | 3300006806 | Agricultural Soil | MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSH* |
| Ga0075421_1013825901 | 3300006845 | Populus Rhizosphere | YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR* |
| Ga0075421_1022356521 | 3300006845 | Populus Rhizosphere | LRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0079219_100843552 | 3300006954 | Agricultural Soil | MKKLFLVLALVVASAAPALADAFPNYYATNSDARNH* |
| Ga0079219_124478421 | 3300006954 | Agricultural Soil | MKKLFLAVALVVAFAAPAMAEQFPNLYATSSDTMGN* |
| Ga0111539_102813584 | 3300009094 | Populus Rhizosphere | FSQPRRSSMKKLFLVLALVVASAAPALADAFPNYYATNSDARNH* |
| Ga0075418_113974571 | 3300009100 | Populus Rhizosphere | RFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0075418_126836392 | 3300009100 | Populus Rhizosphere | VMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0111538_101562053 | 3300009156 | Populus Rhizosphere | MKKLFLAAALVVAFAAPALAHEFTNYYATVSYAMSR* |
| Ga0111538_116588781 | 3300009156 | Populus Rhizosphere | KKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0111538_116918361 | 3300009156 | Populus Rhizosphere | RFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR* |
| Ga0075423_105059122 | 3300009162 | Populus Rhizosphere | MKKLFLAAALVVAFAAPALAHEFTNYYATNSDAMSR* |
| Ga0075423_120809901 | 3300009162 | Populus Rhizosphere | MKKLFIAVALVVASAAPAMAGQFPNLYATNADAMSH* |
| Ga0116222_10226343 | 3300009521 | Peatlands Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATNSDAMGR* |
| Ga0105238_129930771 | 3300009551 | Corn Rhizosphere | MKKLFLAAALVVAFAAPALAHEFTNYYATDSDAMSR* |
| Ga0105063_10632931 | 3300009804 | Groundwater Sand | KKLFLAVALAVAFAAPARAEQFPNYYATSSDTMGQ* |
| Ga0116223_103325532 | 3300009839 | Peatlands Soil | MKKVFLAVALIVAFAAPAMAGQFPNAYATNSDAMRH* |
| Ga0126384_103836412 | 3300010046 | Tropical Forest Soil | MKKLFLAVALVVACAAPAMAEPFPNYYATNSDAMSR* |
| Ga0126384_111190191 | 3300010046 | Tropical Forest Soil | RRFVMKKLFLAAALVVAFAAPAMAEQFPNNYATTSDAMGR* |
| Ga0126373_122290361 | 3300010048 | Tropical Forest Soil | MKKLLVTVALVVAFAAPALADPFPNYYATNSDVMNR* |
| Ga0126377_108773892 | 3300010362 | Tropical Forest Soil | MKKLFLAAALVVAFAAPALAHEFPNYYATDSDARAARPGS* |
| Ga0134125_111037172 | 3300010371 | Terrestrial Soil | MKKLFLAAALVVAFAAPALAQEFTNYYATDSDAMSR* |
| Ga0126381_1015403561 | 3300010376 | Tropical Forest Soil | MKKIVLAVALVLSFAAPAMAGKFPNLYATSADARR* |
| Ga0136449_1020862722 | 3300010379 | Peatlands Soil | MKKLFIAVALVVAFAAPAMAGQFPNLYATNADVMGH* |
| Ga0134126_116844011 | 3300010396 | Terrestrial Soil | MKKLFLAVALVVAFAAPALAHEFPNYYATSSDTMDH* |
| Ga0126383_129233531 | 3300010398 | Tropical Forest Soil | MKKLFLAVALVVAFAAPALADPFPNYYATNSDAISR* |
| Ga0134127_117739742 | 3300010399 | Terrestrial Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATDSDAMGR* |
| Ga0120139_10744012 | 3300012019 | Permafrost | MKKLFLAVALVVAFAAPALAHEFPNYYATASNAMGR* |
| Ga0137397_109308032 | 3300012685 | Vadose Zone Soil | MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAISR* |
| Ga0157282_104233382 | 3300012904 | Soil | FVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0137404_107905601 | 3300012929 | Vadose Zone Soil | MKKLFLAVALVVACAAPAMAEQFPNSYATDSDAMSR* |
| Ga0164300_101473071 | 3300012951 | Soil | KLFLAAALVVAFAAPALAHEFLNYYATDSDAMSR* |
| Ga0164300_103182633 | 3300012951 | Soil | MKKLFLAAALVVAFAAPALAHEFTNYYATDSGAMSL* |
| Ga0164303_113435981 | 3300012957 | Soil | MKKLFLAVALIVAFAAPAMAGQFPNPYATNSDAMSR* |
| Ga0164299_109349372 | 3300012958 | Soil | MKKLFLAVALVVAFVAPAMAEQFPNNYATDSDAMSR* |
| Ga0164301_104169813 | 3300012960 | Soil | MKKLFLAAALVVAFAAPALAHEFANYYATDSDAMSR* |
| Ga0164301_110191502 | 3300012960 | Soil | MKKLFLAVALVVAFVAPAMAEQFPNNYATDSDAMS |
| Ga0164302_109808941 | 3300012961 | Soil | MKKLFIAVALVVAFAAPAMAGAFPNLYATNADAMSH* |
| Ga0164302_119312431 | 3300012961 | Soil | MKKLFLAIALVVAFAAPAMAEQFPNNYATDSDAMSR* |
| Ga0126369_109791493 | 3300012971 | Tropical Forest Soil | MKKLFLAIALVVACAAPAMAEQFPNNYATNSDAVSR* |
| Ga0164309_103149572 | 3300012984 | Soil | MKKLFLAAALVVAFAAPALAHEFLNYYATDSDAMSR* |
| Ga0164308_104269392 | 3300012985 | Soil | MKKLFLAAALVVAFAAPALVHEFPNYYATDSDAMSR* |
| Ga0164307_105489002 | 3300012987 | Soil | MKKLFLAAALVVAFAAPAVANEFPNYYATDSHAMSR* |
| Ga0164306_101512731 | 3300012988 | Soil | MTKLFLAAALVVAFAAPALAHEFQNYYTTDSDAMSR* |
| Ga0164305_106711652 | 3300012989 | Soil | MKKLFIAAALVVAFAAPSMAGEFPNLYATNADAMSH* |
| Ga0157374_125503082 | 3300013296 | Miscanthus Rhizosphere | KLFLAAAMVVAFAAPALAHEFPNYYATDSGAMSR* |
| Ga0157372_119749792 | 3300013307 | Corn Rhizosphere | MKKLVLAAALVVAFAAPALAHEFTNYYATDSDAMSR* |
| Ga0120181_10782111 | 3300013766 | Permafrost | MKKLFLAVALVVAFAAPALAHEFPNNYATDSNAMGR* |
| Ga0120170_10104504 | 3300014823 | Permafrost | MKKLFLAVALVVAFAAPALAHEFPNYYATDSNAMGR* |
| Ga0173478_105480922 | 3300015201 | Soil | MKKLFLTAALVVAFAAPALAHEFQNYYATDSDAMSR* |
| Ga0132256_1016166352 | 3300015372 | Arabidopsis Rhizosphere | MKKLFIAVALVVAFAAPAMAGQFPNLYATNADAMSR* |
| Ga0182035_102062823 | 3300016341 | Soil | MKKIVLAVALVLSFAAPAMAGQFPNLYATNADARSQ |
| Ga0182035_118542722 | 3300016341 | Soil | MKKLFLVLPLVVAFAAPAMAEPFPNYYATTSDAMSR |
| Ga0182032_108063881 | 3300016357 | Soil | KSLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0182034_105075802 | 3300016371 | Soil | MNKLFLAVALVVAFAAPAMAGHQFPNPYASNSDAMDH |
| Ga0182037_101630423 | 3300016404 | Soil | MSKIVLAVALVLSFAAPAMAGQFPNLYATNADARSQ |
| Ga0182038_102824183 | 3300016445 | Soil | MSKIVLAVALVLSFAAPAMAGQFPNLYATNADARTQ |
| Ga0163161_104224361 | 3300017792 | Switchgrass Rhizosphere | RRFVMKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR |
| Ga0187812_12028453 | 3300017821 | Freshwater Sediment | MKKLFLAVALVVAFAAPAMAGHQFPNLYATNSDAMDH |
| Ga0187802_100353281 | 3300017822 | Freshwater Sediment | MKKLFLAVALVVAFAAPAMAGHQFPNPYATNSDAMGQ |
| Ga0187802_101427262 | 3300017822 | Freshwater Sediment | MKKLFLAVALVVAFAAPAMAAHQFPNPYATNVDARGQ |
| Ga0187814_102065382 | 3300017932 | Freshwater Sediment | MKKLFLAVALVVAFAAPAMAAHQFPNPYATNVDARGL |
| Ga0187817_101333941 | 3300017955 | Freshwater Sediment | MKKLFIAVALVVAFAAPAMAGEFPNLYATNADAMSH |
| Ga0187777_103043332 | 3300017974 | Tropical Peatland | MFKTLILAVALIATSAAALPAMAGQFPNLYATNADARSH |
| Ga0187777_107863902 | 3300017974 | Tropical Peatland | MKKIVLAIALVLSFAAPAMAGQFPNLYATNADARTH |
| Ga0187815_101105931 | 3300018001 | Freshwater Sediment | ARSTGPRIDRRTPMMKLFLAVALVVAFAAPAMAGHQFPNPYATNVDARGQ |
| Ga0187804_102739172 | 3300018006 | Freshwater Sediment | MKKLFLAVALVAAFAAPAMAGHQFPNPYATNMDARGQ |
| Ga0187805_100241472 | 3300018007 | Freshwater Sediment | MKKLFLAVALVVAFAAPAMAGHQFPNPYATNVDARDQ |
| Ga0187766_109804721 | 3300018058 | Tropical Peatland | MKKLFLAVALVVAFATPAMAGHQFPNLYATNSDAMDH |
| Ga0173481_103691041 | 3300019356 | Soil | MKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR |
| Ga0173481_105900091 | 3300019356 | Soil | YLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR |
| Ga0173481_107191001 | 3300019356 | Soil | MKKLFLAAALVVAFAAPALAHEFQNYYATDSGAMSR |
| Ga0126371_102798973 | 3300021560 | Tropical Forest Soil | MKKLFLAVALVVAFAAPALADPFPNYYATNSDAISR |
| Ga0126371_115242031 | 3300021560 | Tropical Forest Soil | MKKLFLALALVVAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0213854_12177391 | 3300021855 | Watersheds | MKKLFLAVALVVAFAAPAMAEQFPNLYATNADAGGR |
| Ga0213854_12872171 | 3300021855 | Watersheds | RPSIDRRIPMKKLFLAVALVVAFAAPAMAGQFPNLYATGADARSH |
| Ga0224712_103104382 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR |
| Ga0247802_10671132 | 3300023077 | Soil | MKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMS |
| Ga0247800_10554691 | 3300023263 | Soil | MKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR |
| Ga0207642_107626951 | 3300025899 | Miscanthus Rhizosphere | RRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR |
| Ga0207647_100336225 | 3300025904 | Corn Rhizosphere | FEGHYLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR |
| Ga0207647_102278721 | 3300025904 | Corn Rhizosphere | FEGHYLRRFVMKKLFLAAALVVAFAAPALAHEFTNYYATDSDAMSR |
| Ga0207685_104315561 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLFLAAALVVAFAAPALAHEFLNYYATDSDAMSR |
| Ga0207695_110617281 | 3300025913 | Corn Rhizosphere | QSGCGKSHYLRRFVMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR |
| Ga0207693_100451651 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RFVMKKLFLAAALVVAFAAPALAHEFQNYYATDSDAMSR |
| Ga0207675_1000052691 | 3300026118 | Switchgrass Rhizosphere | VMKKLFLAAALVVAFAAPALAHEFPNYYATDSGAMSR |
| Ga0207675_1015221313 | 3300026118 | Switchgrass Rhizosphere | VMKKLFLAAALVVAFAAPALAHEFPNYYATDSDAMSR |
| Ga0257156_10949792 | 3300026498 | Soil | MKKLFLAVALVVAFAAPALAHEFPNYYATSSDTMHQ |
| Ga0208043_10136803 | 3300027570 | Peatlands Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATNSGAMGR |
| Ga0208696_10215873 | 3300027696 | Peatlands Soil | MKKLFLAVALVVAFAAPAMAEQFPNNYATNSDAMGR |
| Ga0207862_11358802 | 3300027703 | Tropical Forest Soil | MKKLFLAVALVVAFAAPAMAGHQFPNPYATSVDAMDH |
| Ga0209068_102813022 | 3300027894 | Watersheds | MKKLFLAVALVVAFAAPAMAGQFPNAYATNSNAMGH |
| Ga0209526_100992971 | 3300028047 | Forest Soil | ATEGESSMKKLFLAVALVVAFAAPALAHEFPNNYATDSNAMGR |
| Ga0307503_102774452 | 3300028802 | Soil | MKKLFLAVALVVAFAAPAMAQNFVNPYSASCDACR |
| Ga0316363_102349461 | 3300030659 | Peatlands Soil | MKKVFLAVALIVAFAAPAMAGQFPNAYATNSDAMRH |
| Ga0170834_1105605573 | 3300031057 | Forest Soil | MKKLFLAVALVVAFAAPAMAEQFHNNYATDSDAMSR |
| Ga0318541_105933472 | 3300031545 | Soil | MNKLFLAVALVVAFAAPAMAAAGHRFPNPHATNSDAMD |
| Ga0310915_101405451 | 3300031573 | Soil | MKKLFLAVALVVAFAAPAMAGHQFPNPYASNSDAMDH |
| Ga0310915_102868922 | 3300031573 | Soil | MKKLFFAVALVFAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0310915_105829932 | 3300031573 | Soil | MKKIVLAVALVLSFAAPAMAGQFPNLYATNADARTQ |
| Ga0307469_108890122 | 3300031720 | Hardwood Forest Soil | MKKLFLAAALVVACAAPALAHEFPNYYATDSDAMSR |
| Ga0306918_111202942 | 3300031744 | Soil | MKKIMLAVALVLSFAAPAMAGQFPNLYATSADARTQ |
| Ga0315297_1000563012 | 3300031873 | Sediment | MKKLFLAVALVVAFAAPAMAQNFVNPYSAACDACR |
| Ga0306919_105082941 | 3300031879 | Soil | MKKLFLAVALVVAFAAPAMAAAGHQFPNPYATNSDAMDH |
| Ga0306923_113270262 | 3300031910 | Soil | SMKKLVLAVALVVAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0306921_120206511 | 3300031912 | Soil | MKSLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0310912_107249161 | 3300031941 | Soil | MKKLLIAIALVVAFAAPALAQPFPNYYATNSDAISH |
| Ga0310909_106433101 | 3300031947 | Soil | LSMKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0310909_109599042 | 3300031947 | Soil | MKKIVLAVALVLSFAAPAMAGQFPNLYATSADARTQ |
| Ga0306926_102737702 | 3300031954 | Soil | MKKLFLAVALVVAFAAPAMAEPFPNYYATNSDAMSR |
| Ga0310906_105118581 | 3300032013 | Soil | MKKLFLAAALVVAFAAPSLAHEFPNYYATDSGAMSR |
| Ga0306924_112518992 | 3300032076 | Soil | MKKLLIAIALVVTFAAPALAQPFPNYYATNSDAISH |
| Ga0306920_1014265992 | 3300032261 | Soil | MNKLFLAVALVVAFAAPAMAAAGHQFPNPYATNSDAMDH |
| Ga0306920_1017660672 | 3300032261 | Soil | MKKLFLAVALVVAFAAPAMAEPFPNYYATNFDAMSR |
| Ga0335081_109242411 | 3300032892 | Soil | MKKLFLAVALVVAFGAPAMADQFPNSYATASDAMSH |
| ⦗Top⦘ |