NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047939

Metagenome / Metatranscriptome Family F047939

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047939
Family Type Metagenome / Metatranscriptome
Number of Sequences 149
Average Sequence Length 42 residues
Representative Sequence VLAVAAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP
Number of Associated Samples 129
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.38 %
% of genes near scaffold ends (potentially truncated) 92.62 %
% of genes from short scaffolds (< 2000 bps) 89.93 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.812 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.832 % of family members)
Environment Ontology (ENVO) Unclassified
(20.134 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.282 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.76%    β-sheet: 0.00%    Coil/Unstructured: 63.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF09286Pro-kuma_activ 26.85
PF00144Beta-lactamase 12.08
PF13847Methyltransf_31 6.71
PF06445GyrI-like 1.34
PF02781G6PD_C 1.34
PF13520AA_permease_2 1.34
PF03069FmdA_AmdA 1.34
PF00702Hydrolase 0.67
PF00082Peptidase_S8 0.67
PF13751DDE_Tnp_1_6 0.67
PF00583Acetyltransf_1 0.67
PF14492EFG_III 0.67
PF12900Pyridox_ox_2 0.67
PF13535ATP-grasp_4 0.67
PF13977TetR_C_6 0.67
PF03764EFG_IV 0.67
PF13245AAA_19 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 26.85
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 12.08
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 12.08
COG2367Beta-lactamase class ADefense mechanisms [V] 12.08
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 1.34
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 1.34
COG0480Translation elongation factor EF-G, a GTPaseTranslation, ribosomal structure and biogenesis [J] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.81 %
UnclassifiedrootN/A28.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10116094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1072Open in IMG/M
3300004478|Ga0068972_1559894Not Available859Open in IMG/M
3300005177|Ga0066690_10574341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia753Open in IMG/M
3300005332|Ga0066388_108794663Not Available501Open in IMG/M
3300005338|Ga0068868_101098898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300005364|Ga0070673_101440710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766649Open in IMG/M
3300005434|Ga0070709_11510311Not Available546Open in IMG/M
3300005435|Ga0070714_102158073Not Available543Open in IMG/M
3300005436|Ga0070713_100895287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300005437|Ga0070710_11107596Not Available582Open in IMG/M
3300005439|Ga0070711_100825315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300005439|Ga0070711_101932582Not Available518Open in IMG/M
3300005552|Ga0066701_10709530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300005602|Ga0070762_10158202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1360Open in IMG/M
3300005610|Ga0070763_10449424Not Available731Open in IMG/M
3300005618|Ga0068864_101289779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766730Open in IMG/M
3300005718|Ga0068866_10364151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300005921|Ga0070766_10329725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia987Open in IMG/M
3300005952|Ga0080026_10092082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia836Open in IMG/M
3300006028|Ga0070717_11452602Not Available622Open in IMG/M
3300006028|Ga0070717_11487507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766614Open in IMG/M
3300006163|Ga0070715_10500335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300006174|Ga0075014_100230392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales948Open in IMG/M
3300006175|Ga0070712_100558217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300006176|Ga0070765_100206384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1785Open in IMG/M
3300006796|Ga0066665_10202545Not Available1541Open in IMG/M
3300006804|Ga0079221_11065775Not Available614Open in IMG/M
3300006806|Ga0079220_10167089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1233Open in IMG/M
3300006871|Ga0075434_101325447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766730Open in IMG/M
3300006914|Ga0075436_100157990Not Available1597Open in IMG/M
3300006914|Ga0075436_100346765All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300006954|Ga0079219_10278936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300006954|Ga0079219_10531636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria835Open in IMG/M
3300007076|Ga0075435_101423533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces608Open in IMG/M
3300009521|Ga0116222_1031501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2351Open in IMG/M
3300009522|Ga0116218_1327631Not Available684Open in IMG/M
3300009553|Ga0105249_11507725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300009764|Ga0116134_1167583Not Available771Open in IMG/M
3300010373|Ga0134128_10454004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1430Open in IMG/M
3300010375|Ga0105239_11019346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300010376|Ga0126381_101973901Not Available841Open in IMG/M
3300010403|Ga0134123_10352576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1329Open in IMG/M
3300010867|Ga0126347_1338376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1470Open in IMG/M
3300010876|Ga0126361_10845508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300012089|Ga0153924_1026804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1142Open in IMG/M
3300012189|Ga0137388_10029379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4260Open in IMG/M
3300012199|Ga0137383_10084733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2293Open in IMG/M
3300012199|Ga0137383_10340961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1098Open in IMG/M
3300012351|Ga0137386_10058468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2674Open in IMG/M
3300012357|Ga0137384_10607711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300012986|Ga0164304_10283731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1126Open in IMG/M
3300014150|Ga0134081_10383598Not Available523Open in IMG/M
3300014838|Ga0182030_10066305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5434Open in IMG/M
3300015372|Ga0132256_102371538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766633Open in IMG/M
3300015373|Ga0132257_100643846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300016294|Ga0182041_10634732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia941Open in IMG/M
3300016445|Ga0182038_11660222All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300017926|Ga0187807_1099656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia913Open in IMG/M
3300017926|Ga0187807_1329246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300017932|Ga0187814_10415574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300017933|Ga0187801_10136021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia951Open in IMG/M
3300017942|Ga0187808_10431653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300018001|Ga0187815_10416734Not Available572Open in IMG/M
3300018007|Ga0187805_10477561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium583Open in IMG/M
3300018034|Ga0187863_10174044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1200Open in IMG/M
3300018037|Ga0187883_10100856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1500Open in IMG/M
3300018058|Ga0187766_11001651Not Available595Open in IMG/M
3300018062|Ga0187784_11049551Not Available647Open in IMG/M
3300018062|Ga0187784_11313870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300019787|Ga0182031_1469217Not Available2287Open in IMG/M
3300020581|Ga0210399_10789559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia776Open in IMG/M
3300020582|Ga0210395_10041854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium3353Open in IMG/M
3300020582|Ga0210395_10441659Not Available979Open in IMG/M
3300021170|Ga0210400_11424314Not Available552Open in IMG/M
3300021384|Ga0213876_10463551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300021404|Ga0210389_10063839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2824Open in IMG/M
3300021405|Ga0210387_10412222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1197Open in IMG/M
3300021406|Ga0210386_11325809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300021407|Ga0210383_10857671Not Available775Open in IMG/M
3300021477|Ga0210398_11180140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300021559|Ga0210409_11577675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300025625|Ga0208219_1141209Not Available528Open in IMG/M
3300025898|Ga0207692_10971255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300025899|Ga0207642_10111519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1393Open in IMG/M
3300025910|Ga0207684_11594531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 5-10529Open in IMG/M
3300025915|Ga0207693_10461677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria992Open in IMG/M
3300025928|Ga0207700_10312738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1359Open in IMG/M
3300025928|Ga0207700_11153041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300025944|Ga0207661_10114467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2287Open in IMG/M
3300026217|Ga0209871_1007357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2087Open in IMG/M
3300026374|Ga0257146_1040583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300027096|Ga0208099_1047007Not Available618Open in IMG/M
3300027110|Ga0208488_1056231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae672Open in IMG/M
3300027497|Ga0208199_1003722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4162Open in IMG/M
3300027568|Ga0208042_1115287Not Available678Open in IMG/M
3300027662|Ga0208565_1210332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300027775|Ga0209177_10098619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300027905|Ga0209415_10830006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300028742|Ga0302220_10121055Not Available1013Open in IMG/M
3300028906|Ga0308309_11226242Not Available646Open in IMG/M
3300029943|Ga0311340_10147911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2465Open in IMG/M
3300029944|Ga0311352_10033559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae4827Open in IMG/M
3300029999|Ga0311339_10593714Not Available1104Open in IMG/M
3300030058|Ga0302179_10245776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia789Open in IMG/M
3300030503|Ga0311370_10171223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2962Open in IMG/M
3300030524|Ga0311357_11083578Not Available699Open in IMG/M
3300030706|Ga0310039_10235112Not Available710Open in IMG/M
3300030739|Ga0302311_10939483Not Available551Open in IMG/M
3300030743|Ga0265461_10104318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1396Open in IMG/M
3300031234|Ga0302325_10807158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae1323Open in IMG/M
3300031525|Ga0302326_11634516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300031681|Ga0318572_10595911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300031682|Ga0318560_10612855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala589Open in IMG/M
3300031682|Ga0318560_10622395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300031708|Ga0310686_103349533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia784Open in IMG/M
3300031708|Ga0310686_107424294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia690Open in IMG/M
3300031708|Ga0310686_111814885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia723Open in IMG/M
3300031718|Ga0307474_11419786Not Available547Open in IMG/M
3300031768|Ga0318509_10692341All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031770|Ga0318521_10076374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1797Open in IMG/M
3300031805|Ga0318497_10076480Not Available1768Open in IMG/M
3300031831|Ga0318564_10378977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300031859|Ga0318527_10403757Not Available583Open in IMG/M
3300031860|Ga0318495_10089841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 287661378Open in IMG/M
3300031880|Ga0318544_10150512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300031893|Ga0318536_10252056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia897Open in IMG/M
3300031896|Ga0318551_10128646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1370Open in IMG/M
3300031896|Ga0318551_10262041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300031896|Ga0318551_10891150Not Available519Open in IMG/M
3300032008|Ga0318562_10162812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1287Open in IMG/M
3300032008|Ga0318562_10230636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1074Open in IMG/M
3300032009|Ga0318563_10244134Not Available970Open in IMG/M
3300032039|Ga0318559_10289507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300032054|Ga0318570_10362870Not Available660Open in IMG/M
3300032055|Ga0318575_10442734Not Available660Open in IMG/M
3300032068|Ga0318553_10713106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300032089|Ga0318525_10255720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300032089|Ga0318525_10510565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300032089|Ga0318525_10551186Not Available589Open in IMG/M
3300032091|Ga0318577_10181072Not Available1007Open in IMG/M
3300032160|Ga0311301_10724456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HCCB100431390Open in IMG/M
3300032174|Ga0307470_10120701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1547Open in IMG/M
3300032261|Ga0306920_102467947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300032261|Ga0306920_103292496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300032261|Ga0306920_103859058Not Available547Open in IMG/M
3300032770|Ga0335085_10093514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3908Open in IMG/M
3300032770|Ga0335085_10437428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300033158|Ga0335077_10960093Not Available856Open in IMG/M
3300034163|Ga0370515_0168648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.40%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.01%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.01%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.01%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.01%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.01%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.34%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.34%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.34%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.34%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.34%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.67%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.67%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.67%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012089Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1011609433300003505Forest SoilHAPETVARLAIALVDGMGIPLALADPDVTAPGAVQDVLAALRELLRPDG*
Ga0068972_155989413300004478Peatlands SoilVAVLAVAAADGLGIPLSLGDPEITGPGAVQDVLAALAELLHP*
Ga0066690_1057434113300005177SoilLAVAAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP*
Ga0066388_10879466323300005332Tropical Forest SoilAIGAADGMGIPLSLADPAIAPADAVRHVLTALRELLRPGGPGH*
Ga0068868_10109889823300005338Miscanthus RhizosphereLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0070673_10144071023300005364Switchgrass RhizosphereVLAVAAADGMGIPLSLGDPEITGRGAVHDVLAALRELLRL*
Ga0070709_1151031113300005434Corn, Switchgrass And Miscanthus RhizosphereAVLAVAAADGMGIPLSLGDPDITAASAVRNVMATLRELLRN*
Ga0070714_10215807313300005435Agricultural SoilVAVLAVAAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP*
Ga0070713_10089528723300005436Corn, Switchgrass And Miscanthus RhizosphereYDADMVAVLAVAAADGMGIPLSLGDPDITADSAVRSVMDTLRELLHN*
Ga0070710_1110759613300005437Corn, Switchgrass And Miscanthus RhizosphereAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLSPDGPGR*
Ga0070711_10082531513300005439Corn, Switchgrass And Miscanthus RhizospherePDTVAVLAVAAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP*
Ga0070711_10193258223300005439Corn, Switchgrass And Miscanthus RhizosphereMVAVLAVAAADGMGIPLSLGDPDITAASAVRSVMATLRELLRN*
Ga0066701_1070953013300005552SoilAADGMGIPLSLGDPVITAAGAVQDVLAALREFLRP*
Ga0070762_1015820223300005602SoilPDKIAVLTIAAVDGMGIPLSLADPQITPAGAAQDVMTALRDMLSPATAR*
Ga0070763_1044942423300005610SoilIALVDGMGIPLALGDPEITGPSAVRDVLTALTELLHP*
Ga0068864_10128977923300005618Switchgrass RhizosphereVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0068866_1036415113300005718Miscanthus RhizosphereADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0070766_1032972513300005921SoilVLTIAAADGLGIPLSLADPDITPASAVQDVMAVLRALLRPES*
Ga0080026_1009208223300005952Permafrost SoilVLAIALVDGLGIPLALGDPDITAAGAIEDVLAALAGLLGLERA*
Ga0070717_1145260223300006028Corn, Switchgrass And Miscanthus RhizosphereVAVLAVAAADGMGIPLSLGDPDITAASAVRSVMATLRELLRN*
Ga0070717_1148750713300006028Corn, Switchgrass And Miscanthus RhizosphereAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRP*
Ga0070715_1050033523300006163Corn, Switchgrass And Miscanthus RhizosphereVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0075014_10023039213300006174WatershedsVDGMGIPLALGDPEITGSGAVQDVLAALAELLRP*
Ga0070712_10055821713300006175Corn, Switchgrass And Miscanthus RhizosphereTVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRP*
Ga0070765_10020638413300006176SoilSPEQVAVLAIAMVDGAGLPLALGDPALTVASATADVLAAIAALLHAEVPGS*
Ga0066665_1020254513300006796SoilVLAVAAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP*
Ga0079221_1106577523300006804Agricultural SoilAVAAADGMGIPLPLGDPDITSGSAVRRVMATLREILCN*
Ga0079220_1016708923300006806Agricultural SoilVAAADGMGIPLSLGDPEITARDAVHDVLAALRELLRL*
Ga0075434_10132544723300006871Populus RhizosphereDPDTVAVLAVAAADGMGIPLSLGDPEITGRGAVHDVLAALRELLRL*
Ga0075436_10015799013300006914Populus RhizosphereADGMGIPLSLGDPVITAAGAVQDVLAALREFLRP*
Ga0075436_10034676513300006914Populus RhizosphereVAVLAVAAADGMGIPLSLGDPEITARGAVLHVLAALRELLSPGGPGR*
Ga0079219_1027893613300006954Agricultural SoilDTVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0079219_1053163623300006954Agricultural SoilALAVAAADGMGIPLSLGDPDITAASAVRSVMATLRELLRN*
Ga0075435_10142353313300007076Populus RhizosphereAAADGMGIPLSLGDPVITAAGAVQDVLAALREFLRP*
Ga0116222_103150133300009521Peatlands SoilVLAIAMVDGMGISLALGDPEISGPGAVQDVLAALAELLHP*
Ga0116218_132763123300009522Peatlands SoilVLAIAMVDGMGIPLALGDPEITGPGAVQEVLAALAELLRP*
Ga0105249_1150772513300009553Switchgrass RhizosphereDPDQVAVLAVAAADGMGIPLSLGDPEITAPGAVHDVLAALRELLRL*
Ga0116134_116758313300009764PeatlandLVQPEKVAVLAIAMVDGMGIALALGDPEITGPGAVQDVLAALAELLRP*
Ga0134128_1045400413300010373Terrestrial SoilPDTVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0105239_1101934613300010375Corn RhizosphereVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRR*
Ga0126381_10197390123300010376Tropical Forest SoilVAVLAVAAADGMGIPLSLGDPEITTRGAVHDVLAAVRELLRP*
Ga0134123_1035257623300010403Terrestrial SoilAADGMGIPLSLGDPEITARGAVHDVMAALRELLRP*
Ga0126347_133837613300010867Boreal Forest SoilKIAVLTIAAVDGMGITLSLADPQITPASAAQDVMTALRDMLSPATGR*
Ga0126361_1084550823300010876Boreal Forest SoilAVDGMGIPLSLADPQITPAGAAQDVMTALRDMLSPASG*
Ga0153924_102680423300012089Attine Ant Fungus GardensADGMGIPLSLADPEITPASAAQDVMAALRDMLRPA*
Ga0137388_1002937923300012189Vadose Zone SoilVLAVAAADGLGIPLSLGDPQITAPGAVQDVLAAVRELLRPGG*
Ga0137383_1008473313300012199Vadose Zone SoilVLAVAAADGMGIPLSLGDPGITAPGAVQDVLAALRELLGR*
Ga0137383_1034096133300012199Vadose Zone SoilADGMGIPLSLGDSEITASGAVQTVLAALREFLRP*
Ga0137386_1005846813300012351Vadose Zone SoilADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP*
Ga0137384_1060771123300012357Vadose Zone SoilVLAAADGMGIPLSLGDPDITAASAVHHVMATLREPRRN*
Ga0164304_1028373113300012986SoilHDPDTVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL*
Ga0134081_1038359813300014150Grasslands SoilRTEAGKVAVLAVAVAGGMGIPLTPGDPGITAASTVHDAMATLRDLLHD*
Ga0182030_1006630563300014838BogMLAIALVDGMGIPLALGDPDLTAPGAVRDVLDALRALMRMDG*
Ga0132256_10237153823300015372Arabidopsis RhizosphereDPDNVAVLAVAAADGMGIPLSLGDPEITARDAVHDVLAALRELLRP*
Ga0132257_10064384613300015373Arabidopsis RhizosphereVAAADGMGIPLSLGDPEITARGAVHDVLAALRGLLRR*
Ga0182041_1063473213300016294SoilVLTIAAADGMGIPLSLADPEITPASAAHDVMAALRELLWPDG
Ga0182038_1166022213300016445SoilIAVLTIAAVDGMGIPLSLADPEITPASAAQDVMAALRDMLRPPSG
Ga0187807_109965633300017926Freshwater SedimentVLTIAAVDGMGIPLSLADPQITPASAAQDVMAALRDMLRPA
Ga0187807_132924613300017926Freshwater SedimentIAAADGMGIPLSLADPDITAASAVHDVMAALRELFRPDR
Ga0187814_1041557413300017932Freshwater SedimentIAAADGMGIPLSLADPDITAASAVHDVMAALRELLRPDR
Ga0187801_1013602113300017933Freshwater SedimentTIAAADGMGIPLSLADPDITPASAAQDVMAALRDMLRPDRG
Ga0187808_1043165323300017942Freshwater SedimentYDPDKIAVLTIAAADGMGIPLSLADPEITPASAAQDVMAALRDMLRPGGG
Ga0187815_1041673413300018001Freshwater SedimentVQPEKVAVLAIAMVDGMGIPLALGDAEITGPGAVQEVLAALAELLRP
Ga0187805_1047756113300018007Freshwater SedimentDPDQVAVLTIAAADGMGIPLSLADPDITAASAVHDVMAALRELLRPDR
Ga0187863_1017404413300018034PeatlandMGIPLALADPDLTGPGAVQDVLAVQDVLAALRELLRLDG
Ga0187883_1010085613300018037PeatlandKVAVLAVAAADGMGIPLSLGDPDITASGAAQDVMATLRELLGR
Ga0187766_1100165123300018058Tropical PeatlandAADGMGIPLSLADPEITPASAVQDVLAALRELLRP
Ga0187784_1104955113300018062Tropical PeatlandPDKVAVLTIAAADGMGIPLSLADPEITPAGAVQDVLTALRELLRP
Ga0187784_1131387013300018062Tropical PeatlandAADGLGIPLSLADPDITPASAVQDVMAVLRALLRPAADPT
Ga0182031_146921743300019787BogMLAIALVDGMGIPLALGDPDLTAPGAVRDVLDALRALMRMDG
Ga0210399_1078955923300020581SoilVLTIAAADGLGIPLSLADPGITPAGAVQDVMAVLRALLRPES
Ga0210395_1004185413300020582SoilAAVDGMGIPLSLADPQITPAGATQDVMTALRDMLSPGRG
Ga0210395_1044165913300020582SoilAAVDGMGIPLSLGDPDITPSGAAADVLAALRELLRPERP
Ga0210400_1142431423300021170SoilYDPDKVAVLTIAAVDGMGIPLSLGDPGITPAGAAADVLAALRELLRPERP
Ga0213876_1046355113300021384Plant RootsADGLGIPLSLADPDITPASAVEDVMAVLRALLRPET
Ga0210389_1006383933300021404SoilYAPDTVAVLAVAAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP
Ga0210387_1041222223300021405SoilDPDKIAVLTIAAADGMGIPLSLADPQITPAGAAQDVMTALRDMLSPRS
Ga0210386_1132580913300021406SoilIAAVDGMGIPLSLADPQITPAGATQDVMTALRDMLSPGRG
Ga0210383_1085767113300021407SoilVDGMGIPLSLADPEITPASAAQDVMAALRELLRPDRRR
Ga0210398_1118014013300021477SoilDPDKIAVLTIAAVDGMGIPLSLADPQITPAGAAQDVMTALRDMLSPASA
Ga0210409_1157767513300021559SoilGMGIPLSLADPQITPAGAAQDVMTALRDMLSPASA
Ga0208219_114120913300025625Arctic Peat SoilPETVAMLAIALVDGIGIPLALADPEVTVNGAIQDVLAALRDLLRPDS
Ga0207692_1097125523300025898Corn, Switchgrass And Miscanthus RhizosphereAADGMGIPLSLGDPEITAAGAVQDVLAALREFLRP
Ga0207642_1011151933300025899Miscanthus RhizosphereDTVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL
Ga0207684_1159453123300025910Corn, Switchgrass And Miscanthus RhizosphereLAVAAADGMGIPLSLGDPQITAVGAVQDVLAALREFLRP
Ga0207693_1046167723300025915Corn, Switchgrass And Miscanthus RhizosphereAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL
Ga0207700_1031273823300025928Corn, Switchgrass And Miscanthus RhizosphereAAADGMGIPLSLGDPEITGRGAVHDVLAALRELLRL
Ga0207700_1115304123300025928Corn, Switchgrass And Miscanthus RhizosphereVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL
Ga0207661_1011446723300025944Corn RhizosphereTVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLAALRELLRL
Ga0209871_100735723300026217Permafrost SoilVLAIALVDGLGIPLALGDPDITAAGAIEDVLAALAGLLGLERA
Ga0257146_104058323300026374SoilDKVAVLAVAAADGMGIPLSLGDPEITARGAVHDVLDALRELLRL
Ga0208099_104700713300027096Forest SoilAATDGMGIPLSLADPEITPASGAQDVMAALRDMLRPDR
Ga0208488_105623123300027110Forest SoilDGMGIPLALADPDLTGPGAVQDVLAALRELLRPDG
Ga0208199_100372243300027497Peatlands SoilVLTIAAVDGMGIPLSLADPQITPASAAQDVMAALRDMLRPAASRAT
Ga0208042_111528723300027568Peatlands SoilVLAIAMVDGMGIPLALGDPEITGPGAVQEVLAALAELLRP
Ga0208565_121033223300027662Peatlands SoilAVLTIAAVDGMGIPLSLADPQITPASAAQDVMAALRDMLRPAR
Ga0209177_1009861923300027775Agricultural SoilPDKVAVLAVAAADGMGIPLSLGDPEITARDAVHDVLAALRELLRL
Ga0209415_1083000613300027905Peatlands SoilYDPDKVAVLTIAAADGLGIPLSLADPDITPAGAVQDVMAVLRALLRPAG
Ga0302220_1012105513300028742PalsaHPPETVARLAIALVDGMGIPLALADPDLTGPGAVQDVLATLRELLRPGG
Ga0308309_1122624223300028906SoilIAAVDGMGIPLSLGDPDITPSGAAQDVLAALRELLRSEHP
Ga0311340_1014791163300029943PalsaGHSPETVARLAIALVDGMGIPLALADPDLTGPGAVQDVLAALRELLRPGG
Ga0311352_1003355913300029944PalsaIAVLTIAAVDGMGIPLSLADPQITAASAAQDVMTALRDMLSPDRGAGLG
Ga0311339_1059371413300029999PalsaPETVARLAIALVDGMGIPLALADPDLTGPGAVQDVLAALRELLHPDG
Ga0302179_1024577613300030058PalsaRFGAEHAPETVARLAIALVDGMGIPLALADPDVTAPGAVQDVLAALRELLRPDG
Ga0311370_1017122313300030503PalsaHRPQTVALLAIALVDGMGIPLALSDPEVTATSAVQDVLAALRGILGPGS
Ga0311357_1108357813300030524PalsaTVAKLAIALVDGMGIPLALADPDVSGPGAVQDVLAALRELLRPNG
Ga0310039_1023511213300030706Peatlands SoilGPVQPEKVAVLAIAMVDGMGIPLALGDPEITGPSAVQDVLAALAELLRP
Ga0302311_1093948313300030739PalsaETVARLAIALVDGMGIPLALADPDLSGPGAVQDVLAALRELLRPDG
Ga0265461_1010431813300030743SoilAVLTIAAADGMGIPLSLADPQITPAGAAQDVMAALRDMLSPAR
Ga0302325_1080715813300031234PalsaTVALLAIALVDGMGIPLALSDPEVTATSAVQDVLAALRGILGPGS
Ga0302326_1163451613300031525PalsaTVARLAIALVDGMGIPLALADPDLTGPGAVQDVLAVQDVLAALRELLRLDG
Ga0318572_1059591113300031681SoilSRSAADGMGIPLSLGDPEITGHSAVHDVLAALRELLRP
Ga0318560_1061285513300031682SoilTAYDPDKVAVLTIAAADGLGIPLSLADPGITPASAVQDVMAVLRALLHPEG
Ga0318560_1062239513300031682SoilLTIAAVDGMGIPLSLADPEITPASAAQDVMTALRDMLSPAKSAT
Ga0310686_10334953313300031708SoilLTIAAADGLGIPLSLADPDITPAGAVQDVMAVLRALLRPAG
Ga0310686_10742429413300031708SoilDGMGIPLSLADPQITPAGAAQDVMTALRDMLSAGRG
Ga0310686_11181488513300031708SoilKVAVLTIAAADGLGIPLSLADPDITPASAVQDVMDVLRALLHPES
Ga0307474_1141978623300031718Hardwood Forest SoilVAVLTIAAVDGMGIPLSLGDPDITPSGAAADVLAALRELLRPERP
Ga0318509_1069234113300031768SoilPDKIAVLTIAAVDGMGIPLSLADPEITPASAAQDVMAALRDMLRPPSG
Ga0318521_1007637423300031770SoilMRLVDPDTVAVLAVAAADGMGIPLSLGDPEITGHSAVHDVLAALRELLRP
Ga0318497_1007648013300031805SoilIAAVDGMGIPLSLADPEITPASAAQDVMAALRDMLRPPSG
Ga0318564_1037897713300031831SoilAVLTIAAVDGMGIPLSLADPEITPASAAQDVMAALRDMLRPPSG
Ga0318527_1040375723300031859SoilTYDPDKVAVLTIAAADGMGIPLSLADPDITPAGAVQDVLAALRELLRP
Ga0318495_1008984133300031860SoilAAADGMGIPLSLGDPEITGHSAVHDVLAALHELLRP
Ga0318544_1015051213300031880SoilDKVAVLTIAAADGMGIPLSLADPEITPASAAHDVMAALRELLRPDG
Ga0318536_1025205623300031893SoilTIAATDGMGIPLSLADPEITPASAAQDVMAALRDMLGPDRGPGRWNSAT
Ga0318551_1012864613300031896SoilVAVLTIAAADGMGIPLSLADPDITPASATQDVMAALRALLRPDG
Ga0318551_1026204123300031896SoilAVLAVAAADGMGIPLSLGDPEITGHSAVHDVLAALRELLRP
Ga0318551_1089115023300031896SoilARESGMGIPLSLADPEITPASAAQDVLAALRELLRPVG
Ga0318562_1016281213300032008SoilYDPDTVAVLAVAATDGMGIPLSLGDPEITPGSAVHDVLAALRELLRL
Ga0318562_1023063623300032008SoilADGLGIPLSLADPGITPANAVQDVMAVLRALLRPES
Ga0318563_1024413423300032009SoilDGMGIPLSLADPEITPASAAQDVLAALRELLRPVG
Ga0318559_1028950723300032039SoilVAVLAVAAADGMGIPLSLGDPEITARGAVHEVLAALRELLRL
Ga0318570_1036287023300032054SoilPVKVAVLTIAATDGMGIPLSLADPEITPASAAQDVLAALRELLRPVG
Ga0318575_1044273423300032055SoilPDTVAVLAVAATDGMGIPLSLGDPEITPGSAVHDVLAALRELLRL
Ga0318553_1071310613300032068SoilDGMGIPLSLAGVISGSASAAHDVMAALRELLWPDG
Ga0318525_1025572013300032089SoilKNDPDKVAVLTLAAADGMGIPLSLADPEITPASAAHDVMAALRELLRPDG
Ga0318525_1051056523300032089SoilLTIAAADGMGIPLSLADPDITPASATQDVMAALRALLRPDG
Ga0318525_1055118613300032089SoilYDPDKVAVLTIAATDGMGIPLSLADPDITPASAVQDVLAALRELLRP
Ga0318577_1018107223300032091SoilVLAVAAADGMGIPLSLGDPEITARGAVYDVLAALRELLRP
Ga0311301_1072445613300032160Peatlands SoilPDKVAVLTIAAADGLGIPLSLADPGITPASAVQDVMAVLRALLRPES
Ga0307470_1012070123300032174Hardwood Forest SoilAVAAADGMGIPLSLGDPEITAPGAVHDVLAALRELLRL
Ga0306920_10246794723300032261SoilAADGMGIPLSLGDPEITAGGAVQDVLAALRELLRL
Ga0306920_10329249623300032261SoilAAADGMGIPLSLGDPEITGHSAVHDVLAALRELLRP
Ga0306920_10385905823300032261SoilAVAAADGMGIPMSLGDPEITARSPVQDVLAALRELLRV
Ga0335085_1009351413300032770SoilADMVAVLAVAAADGMGIPLSLGDPDITADSAVRSVMATLRELLRN
Ga0335085_1043742813300032770SoilVLAVAAADGMGIPLSLGDPEITASGAVHDVLAALRELLRP
Ga0335077_1096009313300033158SoilAVLAIAATDGLGIPLSLADPDITPASAAQDVLAALRELLRPDA
Ga0370515_0168648_788_9223300034163Untreated Peat SoilVARLAIALVDGMGIPLALADPDLTGPGAVQDVLAALRELLHPDG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.