NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047930

Metagenome / Metatranscriptome Family F047930

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047930
Family Type Metagenome / Metatranscriptome
Number of Sequences 149
Average Sequence Length 43 residues
Representative Sequence MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIF
Number of Associated Samples 130
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.32 %
% of genes near scaffold ends (potentially truncated) 99.33 %
% of genes from short scaffolds (< 2000 bps) 94.63 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.409 % of family members)
Environment Ontology (ENVO) Unclassified
(29.530 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.295 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.71%    β-sheet: 0.00%    Coil/Unstructured: 44.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF00486Trans_reg_C 93.29
PF13419HAD_2 2.68
PF13186SPASM 1.34
PF05402PqqD 0.67
PF03544TonB_C 0.67
PF07593UnbV_ASPIC 0.67
PF01797Y1_Tnp 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.67
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_144175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis603Open in IMG/M
3300000567|JGI12270J11330_10069095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1766Open in IMG/M
3300000891|JGI10214J12806_10299929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis828Open in IMG/M
3300001686|C688J18823_10124758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1782Open in IMG/M
3300001990|JGI24737J22298_10066772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1077Open in IMG/M
3300004082|Ga0062384_100744834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter679Open in IMG/M
3300004480|Ga0062592_102115045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter559Open in IMG/M
3300005171|Ga0066677_10111640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1460Open in IMG/M
3300005353|Ga0070669_100441068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1072Open in IMG/M
3300005435|Ga0070714_101876009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter585Open in IMG/M
3300005451|Ga0066681_10246169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1083Open in IMG/M
3300005518|Ga0070699_101827383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter556Open in IMG/M
3300005529|Ga0070741_10357391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1353Open in IMG/M
3300005532|Ga0070739_10160318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1184Open in IMG/M
3300005548|Ga0070665_102346221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter536Open in IMG/M
3300005552|Ga0066701_10645940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter640Open in IMG/M
3300005556|Ga0066707_10118199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1649Open in IMG/M
3300005614|Ga0068856_100061884All Organisms → cellular organisms → Bacteria3697Open in IMG/M
3300005614|Ga0068856_100165044All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300005718|Ga0068866_10756386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter672Open in IMG/M
3300005764|Ga0066903_107782253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter551Open in IMG/M
3300005994|Ga0066789_10191991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter862Open in IMG/M
3300006102|Ga0075015_100367973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae805Open in IMG/M
3300006163|Ga0070715_10995112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae522Open in IMG/M
3300006806|Ga0079220_11882279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae530Open in IMG/M
3300006854|Ga0075425_102315928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae597Open in IMG/M
3300006893|Ga0073928_10347402All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300009088|Ga0099830_11469984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300009101|Ga0105247_11697601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300009137|Ga0066709_101161682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1136Open in IMG/M
3300009143|Ga0099792_10387194All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300009520|Ga0116214_1263563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300009522|Ga0116218_1223480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300009525|Ga0116220_10069388All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300009683|Ga0116224_10045258All Organisms → cellular organisms → Bacteria → Acidobacteria2153Open in IMG/M
3300010043|Ga0126380_10091522All Organisms → cellular organisms → Bacteria1796Open in IMG/M
3300010361|Ga0126378_13047081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300010379|Ga0136449_100125471All Organisms → cellular organisms → Bacteria → Acidobacteria5135Open in IMG/M
3300010379|Ga0136449_101036529All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300010379|Ga0136449_103254816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300011270|Ga0137391_10855881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300012189|Ga0137388_10181214All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300012206|Ga0137380_11136222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300012207|Ga0137381_10462448All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300012207|Ga0137381_11282269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300012207|Ga0137381_11765443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300012211|Ga0137377_10626166All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300012350|Ga0137372_10842134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300012351|Ga0137386_10691006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300012363|Ga0137390_10770948All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300012917|Ga0137395_10289847All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300012925|Ga0137419_10810603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae766Open in IMG/M
3300012929|Ga0137404_10775749All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300012957|Ga0164303_11569588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300012960|Ga0164301_10315755All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300012984|Ga0164309_11104599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300013307|Ga0157372_11991940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis667Open in IMG/M
3300014969|Ga0157376_10474126All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300015241|Ga0137418_10548035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis916Open in IMG/M
3300015372|Ga0132256_102110683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300016270|Ga0182036_10344949All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300017943|Ga0187819_10410536All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300017972|Ga0187781_10275827All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300018001|Ga0187815_10424986All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300018035|Ga0187875_10088441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1771Open in IMG/M
3300018043|Ga0187887_10368370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300018054|Ga0184621_10267976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300018064|Ga0187773_10863263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300018064|Ga0187773_11067932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis534Open in IMG/M
3300018085|Ga0187772_11042206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis598Open in IMG/M
3300018089|Ga0187774_10969117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300018090|Ga0187770_10067668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2610Open in IMG/M
3300019885|Ga0193747_1104110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae685Open in IMG/M
3300019890|Ga0193728_1047426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2095Open in IMG/M
3300020006|Ga0193735_1052956All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300020080|Ga0206350_10162494All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300020081|Ga0206354_11173195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300020579|Ga0210407_10678655All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300020581|Ga0210399_10156859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1883Open in IMG/M
3300020583|Ga0210401_11451718All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300021086|Ga0179596_10474620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300021088|Ga0210404_10804051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300021181|Ga0210388_10349370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1300Open in IMG/M
3300021344|Ga0193719_10083835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1386Open in IMG/M
3300021404|Ga0210389_10056852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2999Open in IMG/M
3300021404|Ga0210389_10840425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300021411|Ga0193709_1118275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300021478|Ga0210402_10926528All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300022717|Ga0242661_1169534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis500Open in IMG/M
3300022724|Ga0242665_10309249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis555Open in IMG/M
3300023030|Ga0224561_1008119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300025898|Ga0207692_10100778All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300025898|Ga0207692_10365276All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300025898|Ga0207692_10634656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300025905|Ga0207685_10578756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300025911|Ga0207654_10104612All Organisms → cellular organisms → Bacteria1750Open in IMG/M
3300025915|Ga0207693_11461410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300025916|Ga0207663_11054555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300025921|Ga0207652_10314698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1413Open in IMG/M
3300025921|Ga0207652_11327239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300025921|Ga0207652_11791061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300025922|Ga0207646_10835806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis819Open in IMG/M
3300025928|Ga0207700_10177698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1780Open in IMG/M
3300025939|Ga0207665_11360999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025949|Ga0207667_11237281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300026078|Ga0207702_11744512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300026297|Ga0209237_1199836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300026301|Ga0209238_1239855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300026309|Ga0209055_1187500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300026312|Ga0209153_1268433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300026312|Ga0209153_1270085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300026333|Ga0209158_1230974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300026446|Ga0257178_1039760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300026469|Ga0257169_1017546All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300026538|Ga0209056_10635855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300026552|Ga0209577_10506455All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300026552|Ga0209577_10522919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300027565|Ga0209219_1143576All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300027583|Ga0209527_1129787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300027641|Ga0208827_1142931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300027775|Ga0209177_10111930All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300027853|Ga0209274_10191135All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300027898|Ga0209067_10710241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300027898|Ga0209067_10777454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300027908|Ga0209006_10860833All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300027910|Ga0209583_10677528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300028379|Ga0268266_10811302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis904Open in IMG/M
3300028828|Ga0307312_11069090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300029989|Ga0311365_10752114All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300030339|Ga0311360_10217933All Organisms → cellular organisms → Bacteria1556Open in IMG/M
3300031057|Ga0170834_113820091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1018Open in IMG/M
3300031231|Ga0170824_112542985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis503Open in IMG/M
3300031718|Ga0307474_10229825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1417Open in IMG/M
3300031740|Ga0307468_100911114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300031740|Ga0307468_101047501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300031833|Ga0310917_10182000All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300031946|Ga0310910_11148556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300031962|Ga0307479_10498014All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300031962|Ga0307479_11049980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300032160|Ga0311301_12109811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis652Open in IMG/M
3300032180|Ga0307471_101330953All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300032205|Ga0307472_100016787All Organisms → cellular organisms → Bacteria3882Open in IMG/M
3300032205|Ga0307472_100429617All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300032782|Ga0335082_10540258All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300032783|Ga0335079_10379986All Organisms → cellular organisms → Bacteria → Acidobacteria1527Open in IMG/M
3300032783|Ga0335079_11203867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300032783|Ga0335079_11938686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis569Open in IMG/M
3300032828|Ga0335080_10742281All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300032892|Ga0335081_10665019All Organisms → cellular organisms → Bacteria1271Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.03%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.36%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.01%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.01%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.01%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.01%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.34%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.34%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.34%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.34%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.34%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.67%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.67%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.67%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023030Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_026379202199352024SoilMVRIRLQTKFLLSMILITSGLTSLSLLLVRQSVQSEAKQEIVSDLRNSV
JGI12270J11330_1006909533300000567Peatlands SoilMKLRMRTKFLLSMLVISAGLTWTSLWLVRHSVQQQVRKSIF
JGI10214J12806_1029992913300000891SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRR
C688J18823_1012475833300001686SoilMVTIRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSQVRQE
JGI24737J22298_1006677213300001990Corn RhizosphereMVRVRLRTKFLLSMVLVSAGLTSISLLLVRHTIQSKVVN
Ga0062384_10074483423300004082Bog Forest SoilMKLRMRTKFLLSMLVISAGLTWTSLWLVRHSVQEQVRKSIFADLHNSVGTFQN
Ga0062592_10211504513300004480SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSV
Ga0066677_1011164013300005171SoilMAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKRGIFADLHNSVGT
Ga0070669_10044106813300005353Switchgrass RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLR
Ga0070714_10187600923300005435Agricultural SoilMVRVRLRTKFLLSMVLVTAGLTSLSLLLVRRTMQSQVVNVIYLDLQNSVTTFQ
Ga0066681_1024616913300005451SoilMLKLRMRTKFLLSMLLISAGLTCTSFLLVRHSVTKQVKRGIF
Ga0070699_10182738313300005518Corn, Switchgrass And Miscanthus RhizosphereVARIRLRTKFLLSMLLISSGLTCTSLLLVRHSIQKQVRNEIFADL
Ga0070741_1035739133300005529Surface SoilMVRVRLRTKFLLSMILVTAGLTSLSLLLVRRTMQS
Ga0070739_1016031813300005532Surface SoilMVTIRLRTKFLLSMVLISAGLTCLSLLLVRQSLQSQVRDDIFT
Ga0070665_10234622123300005548Switchgrass RhizosphereMLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRREIFADLRNSVST
Ga0066701_1064594013300005552SoilMAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKKGIFADL
Ga0066707_1011819933300005556SoilMVKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQS
Ga0068856_10006188453300005614Corn RhizosphereMVRFRLRTKFLLSMVLISAGLTSLSLLLVRQNVQSQ
Ga0068856_10016504413300005614Corn RhizosphereMVRVRLRTKFLLSMVLVTAGLTSLSLLLVRRTMQSQVLDGIY
Ga0068866_1075638623300005718Miscanthus RhizosphereMLKLRMRTKFLLSMLLISAGLTWTSLLLVRHSVQKQVRREI
Ga0066903_10778225313300005764Tropical Forest SoilMTKLRMRTKFLLSMLLISASLTTTSLLVVRHSVQSQ
Ga0066789_1019199113300005994SoilMVKLRLRTKFLLSMLLISAGLTCTSLLLVRRTVQHQVKNEISADL
Ga0075015_10036797313300006102WatershedsMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSAS
Ga0070715_1099511223300006163Corn, Switchgrass And Miscanthus RhizosphereMKLRMRTKFLLSMLLISAGLTWTSLLLVRRSVQAQVKKSIFADLHNS
Ga0079220_1188227923300006806Agricultural SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRKEIFA
Ga0075425_10231592823300006854Populus RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRSSVQSQIRKGLFGDLENS
Ga0073928_1034740213300006893Iron-Sulfur Acid SpringMANLRMRTKFLLSLLLITTGLTCTSLLLVRHILQAQVKQEIFTD
Ga0099830_1146998413300009088Vadose Zone SoilMVRVRLQTKFLLSMVLISAGLTSLSLLLVRQSVRSEVRQE
Ga0105247_1169760113300009101Switchgrass RhizosphereMVMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHYVQNQVKREL
Ga0066709_10116168223300009137Grasslands SoilMVKIRLRTKFLLSMVLISAGLTTLSLLLVRQSVKSQVKQEIVSDLQN*
Ga0099792_1038719413300009143Vadose Zone SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRYSVRKQVKKEIFADLRNS
Ga0116214_126356313300009520Peatlands SoilMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQ
Ga0116218_122348023300009522Peatlands SoilMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVTKSIFADLHNSVSTYQNFHR
Ga0116220_1006938813300009525Peatlands SoilMMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIF
Ga0116224_1004525843300009683Peatlands SoilMKLRMRTKFLLSMLLISAGLTSMSLLLVRHSVQTQIKKEIFADLHDSVS
Ga0126380_1009152233300010043Tropical Forest SoilMVKVRLRTKFLLSMVLISGGLTSLSLLFVQRTLSSRDTQEIYSQ
Ga0126378_1304708123300010361Tropical Forest SoilMVKVRLRTKFLLSMVLISAGLTSLSLLFVRQTLRSRVRQEIFSQLRNSV
Ga0136449_10012547163300010379Peatlands SoilMMKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQGQIKKEVFA
Ga0136449_10103652923300010379Peatlands SoilMRTKFLLSMLLITAGLTCTSLLLVRRSVQAQVRKGIFADLRNSVSTFQN
Ga0136449_10325481613300010379Peatlands SoilMKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQTQVRNSI
Ga0137391_1085588113300011270Vadose Zone SoilMRTKFLLSMLLITACLTSTSLLLVRRSVQAEVKKEIFADLHDS
Ga0137388_1018121413300012189Vadose Zone SoilMVRFRLQTKFLLSMVLITAGLTSLSLLLVRQSVRSEVRQEIFSDLQNSVAT
Ga0137380_1113622223300012206Vadose Zone SoilMVRIRLRTKFLLSMVLITAGLTSLSLLIVRQSVQSEARQEIFSDLRN
Ga0137381_1046244813300012207Vadose Zone SoilMVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVRSEVQREIFSDLRNSV
Ga0137381_1128226913300012207Vadose Zone SoilMSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHK
Ga0137381_1176544323300012207Vadose Zone SoilMVRIRLRTKFLLSMVLITAGLTSLSLLIVRQSVQSEARQEIFSDLR
Ga0137377_1062616623300012211Vadose Zone SoilMAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVK
Ga0137372_1084213413300012350Vadose Zone SoilMVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVQS
Ga0137386_1069100613300012351Vadose Zone SoilMSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQ
Ga0137390_1077094823300012363Vadose Zone SoilMVRVRLRTKFLLSMVLITAGLTSLSLLLIRQSVRSEVQREIFSDLRNSV
Ga0137395_1028984713300012917Vadose Zone SoilMVKLRMRTKFLLSMLLISAGLTSTSLLLVRRSVQTQVTKEIFSD
Ga0137419_1081060313300012925Vadose Zone SoilMGMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTEVRREIFADLRNS
Ga0137404_1077574913300012929Vadose Zone SoilMGMLKLRMRSKFLLSMLLISAGLTCTSLLLVRYSVRKQVRKEI
Ga0164303_1156958823300012957SoilMVMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHNVQKQVKRE
Ga0164301_1031575513300012960SoilMLQLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIKREI
Ga0164309_1110459913300012984SoilMVMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHNVQKQVKRELFAD
Ga0157372_1199194023300013307Corn RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRNSVQKQVRREIFADLRNSVS
Ga0157376_1047412623300014969Miscanthus RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRNSVQKQVRREIF
Ga0137418_1054803523300015241Vadose Zone SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTEVRREIFADLRNS
Ga0132256_10211068323300015372Arabidopsis RhizosphereMVKLRLRTKFLLSMLLITSALSATSLLLVRRSVQKQIKQEIATEL
Ga0182036_1034494923300016270SoilMLKLRMRTKFLLSMLLISAGLTCMFLLLVRGSVQKQVK
Ga0187819_1041053613300017943Freshwater SedimentMKLRMRTKFLLSMVLITAGLTSTSLLLVRHSVQTQVRK
Ga0187781_1027582733300017972Tropical PeatlandMMKFRMRTKLLLSMVLISASLTASSFLLVRRSVQRQVRKSIVA
Ga0187815_1042498623300018001Freshwater SedimentMKLRMRTKFLLSMVLITAGLTSTSLLLVRHSVQTQV
Ga0187875_1008844133300018035PeatlandMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFAD
Ga0187887_1036837023300018043PeatlandMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFA
Ga0184621_1026797613300018054Groundwater SedimentMAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKRGIF
Ga0187773_1086326313300018064Tropical PeatlandMKLRMRTKFLLSMLLISAGLTSTSLLLVRHSVQTQVKKEIF
Ga0187773_1106793213300018064Tropical PeatlandMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRRDIFADLR
Ga0187772_1104220623300018085Tropical PeatlandMIKFRMRTKLLLSMLLISAGLTGSSFLLVRRSVDAQVRKSIVADLRNSVATFQNFQ
Ga0187774_1096911713300018089Tropical PeatlandMMKFRMRTKFLLSMLLISAGLTCTSLLLVRHSVQGQIRREIFSD
Ga0187770_1006766843300018090Tropical PeatlandMVKLRMRTKLLLSMLLISAGLTGSSFLLVRHSVQAQVRRSIVADLRNSVT
Ga0193747_110411023300019885SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRKEIFADLRNSV
Ga0193728_104742613300019890SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRK
Ga0193735_105295623300020006SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVRKQVR
Ga0206350_1016249423300020080Corn, Switchgrass And Miscanthus RhizosphereMVRVRLRTKFLLSMVLVSAGLTSISLLLVRHTIQSKVVNEIYSD
Ga0206354_1117319513300020081Corn, Switchgrass And Miscanthus RhizosphereMVRVRLRTKFLLSMVLVSAGLTSLSLLLVRHTVQAKVVDEIYSDL
Ga0210407_1067865513300020579SoilMMKLRMRTKFLLSMLLISAGLTWTSLLLVRRSVQAQVKK
Ga0210399_1015685933300020581SoilMMKLRMRTKFLLSMLLITAGLTWTSLLLVRRTVQAQVKK
Ga0210401_1145171823300020583SoilMKLRMRTKFLLSMLLISAGLTWTSLLLVRHTVQAQVTK
Ga0179596_1047462013300021086Vadose Zone SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIRREIFA
Ga0210404_1080405113300021088SoilMLKLRMRTKFLLSMLLISAGLTCTSLLVVRRSVQRQIKREIFA
Ga0210388_1034937013300021181SoilMKLRMRTKFLLSMLVISAGLTWTSLWLVRHSVQQQIRKGIFADLHNSVGIFQNFQ
Ga0193719_1008383533300021344SoilMVRVRLQTKFLLSMVLITAGLTSLSLLLVRQSVRSEVRQEIFSDL
Ga0210389_1005685213300021404SoilMMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFADLNNS
Ga0210389_1084042513300021404SoilMLKLRMRTKFLLSMLLISAGLTCMSLLLVRSSVQKQIKKGIFAD
Ga0193709_111827523300021411SoilMMKLRLRTKFLLSMVLISAGLTTTSLLLVRRNVQAQEKKA
Ga0210402_1092652823300021478SoilMLKLRMRTKFLLSMLLISAGLTCMSLLLVRSSVQKQIKKGIFADL
Ga0242661_116953423300022717SoilMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFADLHNSV
Ga0242665_1030924923300022724SoilMKLRMRTKFLLSMLLITAGLTWTSLLLVRRSVQAQVRKSIFADLHNSVSTYQ
Ga0224561_100811913300023030SoilMKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQAQVKKSIF
Ga0207692_1010077813300025898Corn, Switchgrass And Miscanthus RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRYSVRKQVKRE
Ga0207692_1036527613300025898Corn, Switchgrass And Miscanthus RhizosphereMVRVRLRTKFLLSMVLISAGLSSLSLLVVRQSVQSQARQEIVS
Ga0207692_1063465623300025898Corn, Switchgrass And Miscanthus RhizosphereMLRVRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRRE
Ga0207685_1057875613300025905Corn, Switchgrass And Miscanthus RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFAD
Ga0207654_1010461233300025911Corn RhizosphereMLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRREIFADL
Ga0207693_1146141013300025915Corn, Switchgrass And Miscanthus RhizosphereMVTIRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSQVRQEIVTDL
Ga0207663_1105455523300025916Corn, Switchgrass And Miscanthus RhizosphereMLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRREIFADLR
Ga0207652_1031469813300025921Corn RhizosphereMVRFRLRTKFLLSMVLISAGLTSLSLLLVRQNVQSQVKKQVSTDLQ
Ga0207652_1132723913300025921Corn RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQDRREI
Ga0207652_1179106123300025921Corn RhizosphereMVRFRLRTKFLLSMVLISGGLTSLSLLLVRQNVQLQIK
Ga0207646_1083580613300025922Corn, Switchgrass And Miscanthus RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTQVRREIFADLRN
Ga0207700_1017769833300025928Corn, Switchgrass And Miscanthus RhizosphereMVRARLRTKFLLSMVLITAGLTSLSLLLVRHSVQSQITREMFSDLRNSVS
Ga0207665_1136099923300025939Corn, Switchgrass And Miscanthus RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQ
Ga0207667_1123728113300025949Corn RhizosphereMVRFRLRTKFLLSMVLISAGLTSLSLLLVRQNVQSQVKKQVS
Ga0207702_1174451213300026078Corn RhizosphereMVRVRLRTKFLLSMVLVTAGLTSLSLLLVRRTMQSQVLDGIYSD
Ga0209237_119983623300026297Grasslands SoilMVKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVK
Ga0209238_123985523300026301Grasslands SoilMSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQVKKEI
Ga0209055_118750023300026309SoilMSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQVK
Ga0209153_126843323300026312SoilMSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQV
Ga0209153_127008523300026312SoilMAKLRMRTKFLLSMLLISAGLTSTSLLVVQHSLQKQTRK
Ga0209158_123097423300026333SoilMSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHRQVK
Ga0257178_103976023300026446SoilMVRFRLQTKFLLSMVLITAGLTSLSLLLVRQSVRSEVRQEIFSDLQN
Ga0257169_101754613300026469SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTEVRREI
Ga0209056_1063585523300026538SoilMVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSRA
Ga0209577_1050645513300026552SoilMVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSQARQEIVEGLRN
Ga0209577_1052291923300026552SoilMVKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKRGLFS
Ga0209219_114357613300027565Forest SoilMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVRKSIF
Ga0209527_112978713300027583Forest SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQMRR
Ga0208827_114293113300027641Peatlands SoilMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVTK
Ga0209177_1011193023300027775Agricultural SoilMVNLRLRTKFLLSMVAISAGLTATSLLLVRRTIEQQVRSEIRV
Ga0209274_1019113513300027853SoilMMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFAD
Ga0209067_1071024113300027898WatershedsMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIRREIFAD
Ga0209067_1077745413300027898WatershedsMMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQA
Ga0209006_1086083313300027908Forest SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIRL
Ga0209583_1067752813300027910WatershedsMKLRMRTKFLLSMLLISAGLTWTSLLLVRRSVQAQVKK
Ga0268266_1081130223300028379Switchgrass RhizosphereMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSVS
Ga0307312_1106909023300028828SoilMGKEKHVVRVRMRTKFLLSMLLISASLTCTSLLVVRRSIHARVKN
Ga0311365_1075211423300029989FenMREGGTMVKLRLRTKFLLSMIVITAGLTSTSLLFVRRSVQAQVKKGIVADL
Ga0311360_1021793333300030339BogMREGGTMVKLRLRTKFLLSMIVITAGLTSTSLLFVRRSVQAQ
Ga0170834_11382009123300031057Forest SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSVNTF
Ga0170824_11254298513300031231Forest SoilMMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFADLHNS
Ga0307474_1022982513300031718Hardwood Forest SoilMKLRLRTKFLLSMLLITAGLTWTSLLLVRRTVQAQVKKSIFADL
Ga0307468_10091111413300031740Hardwood Forest SoilMLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRRE
Ga0307468_10104750123300031740Hardwood Forest SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIF
Ga0310917_1018200013300031833SoilMKIRLRTKFLLSMLLISASLTATSLLLVRHTVQSQVKKSLVSDL
Ga0310910_1114855613300031946SoilMKIRLRTKFLLSMLLISASLTATSLLLVRHTVQSQVKKSLVSD
Ga0307479_1049801433300031962Hardwood Forest SoilMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIKREIF
Ga0307479_1104998023300031962Hardwood Forest SoilMVTIRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSAVRQEIFSDLYNS
Ga0311301_1210981113300032160Peatlands SoilMTRLRMRTKFLLSMLLITAGLTCTSLLLVRRSVQAQVRKGIFADLRNSVSTFQN
Ga0307471_10133095313300032180Hardwood Forest SoilMVKLRMRTKFLLSMLLISTGLTCTSLLLVRRSVQGQVKKEI
Ga0307472_10001678753300032205Hardwood Forest SoilMPRLRLQTKFLLSMLLISTGLTCTSLLLVRRSVHKQVK
Ga0307472_10042961723300032205Hardwood Forest SoilMLKLRLRTKFLLSMLLISAGLTCTSLLLVRRSVHKQVKKEILSD
Ga0335082_1054025813300032782SoilMMKLRMRSKFLLSMLLISAGLTCASLLLVRHSVQTQV
Ga0335079_1037998613300032783SoilMVRWRMQTKFLLSMLLISAGLTCTSLLLVRRSVQEQVRKQIVGDLYNSVSTFQTFQ
Ga0335079_1120386713300032783SoilMMKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQAQVKKEILADL
Ga0335079_1193868613300032783SoilMKLRMRTKFLLSMLVITAGLTSTSLLLVRHSVQAHVRGEIFADLHNSVSTF
Ga0335080_1074228113300032828SoilMLKLRMRGKFLLSMLLISAGLTGISLLLVRHSVQAQVRKN
Ga0335081_1066501913300032892SoilMRLRTKILLSMLLILAGLTSTSLLLVRRSVEQHFQTEISADLRSSVLQF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.