| Basic Information | |
|---|---|
| Family ID | F047930 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIF |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.32 % |
| % of genes near scaffold ends (potentially truncated) | 99.33 % |
| % of genes from short scaffolds (< 2000 bps) | 94.63 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.409 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.530 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.295 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 93.29 |
| PF13419 | HAD_2 | 2.68 |
| PF13186 | SPASM | 1.34 |
| PF05402 | PqqD | 0.67 |
| PF03544 | TonB_C | 0.67 |
| PF07593 | UnbV_ASPIC | 0.67 |
| PF01797 | Y1_Tnp | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_144175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 603 | Open in IMG/M |
| 3300000567|JGI12270J11330_10069095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1766 | Open in IMG/M |
| 3300000891|JGI10214J12806_10299929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 828 | Open in IMG/M |
| 3300001686|C688J18823_10124758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1782 | Open in IMG/M |
| 3300001990|JGI24737J22298_10066772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1077 | Open in IMG/M |
| 3300004082|Ga0062384_100744834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 679 | Open in IMG/M |
| 3300004480|Ga0062592_102115045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 559 | Open in IMG/M |
| 3300005171|Ga0066677_10111640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1460 | Open in IMG/M |
| 3300005353|Ga0070669_100441068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1072 | Open in IMG/M |
| 3300005435|Ga0070714_101876009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 585 | Open in IMG/M |
| 3300005451|Ga0066681_10246169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1083 | Open in IMG/M |
| 3300005518|Ga0070699_101827383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 556 | Open in IMG/M |
| 3300005529|Ga0070741_10357391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1353 | Open in IMG/M |
| 3300005532|Ga0070739_10160318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1184 | Open in IMG/M |
| 3300005548|Ga0070665_102346221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 536 | Open in IMG/M |
| 3300005552|Ga0066701_10645940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 640 | Open in IMG/M |
| 3300005556|Ga0066707_10118199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1649 | Open in IMG/M |
| 3300005614|Ga0068856_100061884 | All Organisms → cellular organisms → Bacteria | 3697 | Open in IMG/M |
| 3300005614|Ga0068856_100165044 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300005718|Ga0068866_10756386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 672 | Open in IMG/M |
| 3300005764|Ga0066903_107782253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 551 | Open in IMG/M |
| 3300005994|Ga0066789_10191991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 862 | Open in IMG/M |
| 3300006102|Ga0075015_100367973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 805 | Open in IMG/M |
| 3300006163|Ga0070715_10995112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300006806|Ga0079220_11882279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 530 | Open in IMG/M |
| 3300006854|Ga0075425_102315928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
| 3300006893|Ga0073928_10347402 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300009088|Ga0099830_11469984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300009101|Ga0105247_11697601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300009137|Ga0066709_101161682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300009143|Ga0099792_10387194 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300009520|Ga0116214_1263563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300009522|Ga0116218_1223480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300009525|Ga0116220_10069388 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300009683|Ga0116224_10045258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2153 | Open in IMG/M |
| 3300010043|Ga0126380_10091522 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300010361|Ga0126378_13047081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300010379|Ga0136449_100125471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5135 | Open in IMG/M |
| 3300010379|Ga0136449_101036529 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300010379|Ga0136449_103254816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300011270|Ga0137391_10855881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300012189|Ga0137388_10181214 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300012206|Ga0137380_11136222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012207|Ga0137381_10462448 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300012207|Ga0137381_11282269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012207|Ga0137381_11765443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300012211|Ga0137377_10626166 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300012350|Ga0137372_10842134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300012351|Ga0137386_10691006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300012363|Ga0137390_10770948 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012917|Ga0137395_10289847 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300012925|Ga0137419_10810603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 766 | Open in IMG/M |
| 3300012929|Ga0137404_10775749 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012957|Ga0164303_11569588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300012960|Ga0164301_10315755 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012984|Ga0164309_11104599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300013307|Ga0157372_11991940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 667 | Open in IMG/M |
| 3300014969|Ga0157376_10474126 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300015241|Ga0137418_10548035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 916 | Open in IMG/M |
| 3300015372|Ga0132256_102110683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300016270|Ga0182036_10344949 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300017943|Ga0187819_10410536 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300017972|Ga0187781_10275827 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300018001|Ga0187815_10424986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300018035|Ga0187875_10088441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1771 | Open in IMG/M |
| 3300018043|Ga0187887_10368370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300018054|Ga0184621_10267976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300018064|Ga0187773_10863263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300018064|Ga0187773_11067932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 534 | Open in IMG/M |
| 3300018085|Ga0187772_11042206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 598 | Open in IMG/M |
| 3300018089|Ga0187774_10969117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300018090|Ga0187770_10067668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2610 | Open in IMG/M |
| 3300019885|Ga0193747_1104110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300019890|Ga0193728_1047426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2095 | Open in IMG/M |
| 3300020006|Ga0193735_1052956 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300020080|Ga0206350_10162494 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300020081|Ga0206354_11173195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300020579|Ga0210407_10678655 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300020581|Ga0210399_10156859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1883 | Open in IMG/M |
| 3300020583|Ga0210401_11451718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300021086|Ga0179596_10474620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300021088|Ga0210404_10804051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300021181|Ga0210388_10349370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1300 | Open in IMG/M |
| 3300021344|Ga0193719_10083835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1386 | Open in IMG/M |
| 3300021404|Ga0210389_10056852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2999 | Open in IMG/M |
| 3300021404|Ga0210389_10840425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300021411|Ga0193709_1118275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021478|Ga0210402_10926528 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300022717|Ga0242661_1169534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 500 | Open in IMG/M |
| 3300022724|Ga0242665_10309249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 555 | Open in IMG/M |
| 3300023030|Ga0224561_1008119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300025898|Ga0207692_10100778 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300025898|Ga0207692_10365276 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300025898|Ga0207692_10634656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300025905|Ga0207685_10578756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300025911|Ga0207654_10104612 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300025915|Ga0207693_11461410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300025916|Ga0207663_11054555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300025921|Ga0207652_10314698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1413 | Open in IMG/M |
| 3300025921|Ga0207652_11327239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300025921|Ga0207652_11791061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300025922|Ga0207646_10835806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 819 | Open in IMG/M |
| 3300025928|Ga0207700_10177698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1780 | Open in IMG/M |
| 3300025939|Ga0207665_11360999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300025949|Ga0207667_11237281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300026078|Ga0207702_11744512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300026297|Ga0209237_1199836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300026301|Ga0209238_1239855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300026309|Ga0209055_1187500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300026312|Ga0209153_1268433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300026312|Ga0209153_1270085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300026333|Ga0209158_1230974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300026446|Ga0257178_1039760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300026469|Ga0257169_1017546 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300026538|Ga0209056_10635855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300026552|Ga0209577_10506455 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300026552|Ga0209577_10522919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300027565|Ga0209219_1143576 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300027583|Ga0209527_1129787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300027641|Ga0208827_1142931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300027775|Ga0209177_10111930 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027853|Ga0209274_10191135 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300027898|Ga0209067_10710241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300027898|Ga0209067_10777454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027908|Ga0209006_10860833 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300027910|Ga0209583_10677528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300028379|Ga0268266_10811302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 904 | Open in IMG/M |
| 3300028828|Ga0307312_11069090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300029989|Ga0311365_10752114 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300030339|Ga0311360_10217933 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300031057|Ga0170834_113820091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1018 | Open in IMG/M |
| 3300031231|Ga0170824_112542985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 503 | Open in IMG/M |
| 3300031718|Ga0307474_10229825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1417 | Open in IMG/M |
| 3300031740|Ga0307468_100911114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300031740|Ga0307468_101047501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300031833|Ga0310917_10182000 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300031946|Ga0310910_11148556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300031962|Ga0307479_10498014 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300031962|Ga0307479_11049980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300032160|Ga0311301_12109811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 652 | Open in IMG/M |
| 3300032180|Ga0307471_101330953 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300032205|Ga0307472_100016787 | All Organisms → cellular organisms → Bacteria | 3882 | Open in IMG/M |
| 3300032205|Ga0307472_100429617 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300032782|Ga0335082_10540258 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300032783|Ga0335079_10379986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1527 | Open in IMG/M |
| 3300032783|Ga0335079_11203867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300032783|Ga0335079_11938686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 569 | Open in IMG/M |
| 3300032828|Ga0335080_10742281 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300032892|Ga0335081_10665019 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.01% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.34% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.34% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02637920 | 2199352024 | Soil | MVRIRLQTKFLLSMILITSGLTSLSLLLVRQSVQSEAKQEIVSDLRNSV |
| JGI12270J11330_100690953 | 3300000567 | Peatlands Soil | MKLRMRTKFLLSMLVISAGLTWTSLWLVRHSVQQQVRKSIF |
| JGI10214J12806_102999291 | 3300000891 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRR |
| C688J18823_101247583 | 3300001686 | Soil | MVTIRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSQVRQE |
| JGI24737J22298_100667721 | 3300001990 | Corn Rhizosphere | MVRVRLRTKFLLSMVLVSAGLTSISLLLVRHTIQSKVVN |
| Ga0062384_1007448342 | 3300004082 | Bog Forest Soil | MKLRMRTKFLLSMLVISAGLTWTSLWLVRHSVQEQVRKSIFADLHNSVGTFQN |
| Ga0062592_1021150451 | 3300004480 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSV |
| Ga0066677_101116401 | 3300005171 | Soil | MAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKRGIFADLHNSVGT |
| Ga0070669_1004410681 | 3300005353 | Switchgrass Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLR |
| Ga0070714_1018760092 | 3300005435 | Agricultural Soil | MVRVRLRTKFLLSMVLVTAGLTSLSLLLVRRTMQSQVVNVIYLDLQNSVTTFQ |
| Ga0066681_102461691 | 3300005451 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSFLLVRHSVTKQVKRGIF |
| Ga0070699_1018273831 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VARIRLRTKFLLSMLLISSGLTCTSLLLVRHSIQKQVRNEIFADL |
| Ga0070741_103573913 | 3300005529 | Surface Soil | MVRVRLRTKFLLSMILVTAGLTSLSLLLVRRTMQS |
| Ga0070739_101603181 | 3300005532 | Surface Soil | MVTIRLRTKFLLSMVLISAGLTCLSLLLVRQSLQSQVRDDIFT |
| Ga0070665_1023462212 | 3300005548 | Switchgrass Rhizosphere | MLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRREIFADLRNSVST |
| Ga0066701_106459401 | 3300005552 | Soil | MAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKKGIFADL |
| Ga0066707_101181993 | 3300005556 | Soil | MVKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQS |
| Ga0068856_1000618845 | 3300005614 | Corn Rhizosphere | MVRFRLRTKFLLSMVLISAGLTSLSLLLVRQNVQSQ |
| Ga0068856_1001650441 | 3300005614 | Corn Rhizosphere | MVRVRLRTKFLLSMVLVTAGLTSLSLLLVRRTMQSQVLDGIY |
| Ga0068866_107563862 | 3300005718 | Miscanthus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTWTSLLLVRHSVQKQVRREI |
| Ga0066903_1077822531 | 3300005764 | Tropical Forest Soil | MTKLRMRTKFLLSMLLISASLTTTSLLVVRHSVQSQ |
| Ga0066789_101919911 | 3300005994 | Soil | MVKLRLRTKFLLSMLLISAGLTCTSLLLVRRTVQHQVKNEISADL |
| Ga0075015_1003679731 | 3300006102 | Watersheds | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSAS |
| Ga0070715_109951122 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRSVQAQVKKSIFADLHNS |
| Ga0079220_118822792 | 3300006806 | Agricultural Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRKEIFA |
| Ga0075425_1023159282 | 3300006854 | Populus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRSSVQSQIRKGLFGDLENS |
| Ga0073928_103474021 | 3300006893 | Iron-Sulfur Acid Spring | MANLRMRTKFLLSLLLITTGLTCTSLLLVRHILQAQVKQEIFTD |
| Ga0099830_114699841 | 3300009088 | Vadose Zone Soil | MVRVRLQTKFLLSMVLISAGLTSLSLLLVRQSVRSEVRQE |
| Ga0105247_116976011 | 3300009101 | Switchgrass Rhizosphere | MVMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHYVQNQVKREL |
| Ga0066709_1011616822 | 3300009137 | Grasslands Soil | MVKIRLRTKFLLSMVLISAGLTTLSLLLVRQSVKSQVKQEIVSDLQN* |
| Ga0099792_103871941 | 3300009143 | Vadose Zone Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRYSVRKQVKKEIFADLRNS |
| Ga0116214_12635631 | 3300009520 | Peatlands Soil | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQ |
| Ga0116218_12234802 | 3300009522 | Peatlands Soil | MRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVTKSIFADLHNSVSTYQNFHR |
| Ga0116220_100693881 | 3300009525 | Peatlands Soil | MMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIF |
| Ga0116224_100452584 | 3300009683 | Peatlands Soil | MKLRMRTKFLLSMLLISAGLTSMSLLLVRHSVQTQIKKEIFADLHDSVS |
| Ga0126380_100915223 | 3300010043 | Tropical Forest Soil | MVKVRLRTKFLLSMVLISGGLTSLSLLFVQRTLSSRDTQEIYSQ |
| Ga0126378_130470812 | 3300010361 | Tropical Forest Soil | MVKVRLRTKFLLSMVLISAGLTSLSLLFVRQTLRSRVRQEIFSQLRNSV |
| Ga0136449_1001254716 | 3300010379 | Peatlands Soil | MMKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQGQIKKEVFA |
| Ga0136449_1010365292 | 3300010379 | Peatlands Soil | MRTKFLLSMLLITAGLTCTSLLLVRRSVQAQVRKGIFADLRNSVSTFQN |
| Ga0136449_1032548161 | 3300010379 | Peatlands Soil | MKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQTQVRNSI |
| Ga0137391_108558811 | 3300011270 | Vadose Zone Soil | MRTKFLLSMLLITACLTSTSLLLVRRSVQAEVKKEIFADLHDS |
| Ga0137388_101812141 | 3300012189 | Vadose Zone Soil | MVRFRLQTKFLLSMVLITAGLTSLSLLLVRQSVRSEVRQEIFSDLQNSVAT |
| Ga0137380_111362222 | 3300012206 | Vadose Zone Soil | MVRIRLRTKFLLSMVLITAGLTSLSLLIVRQSVQSEARQEIFSDLRN |
| Ga0137381_104624481 | 3300012207 | Vadose Zone Soil | MVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVRSEVQREIFSDLRNSV |
| Ga0137381_112822691 | 3300012207 | Vadose Zone Soil | MSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHK |
| Ga0137381_117654432 | 3300012207 | Vadose Zone Soil | MVRIRLRTKFLLSMVLITAGLTSLSLLIVRQSVQSEARQEIFSDLR |
| Ga0137377_106261662 | 3300012211 | Vadose Zone Soil | MAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVK |
| Ga0137372_108421341 | 3300012350 | Vadose Zone Soil | MVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVQS |
| Ga0137386_106910061 | 3300012351 | Vadose Zone Soil | MSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQ |
| Ga0137390_107709482 | 3300012363 | Vadose Zone Soil | MVRVRLRTKFLLSMVLITAGLTSLSLLLIRQSVRSEVQREIFSDLRNSV |
| Ga0137395_102898471 | 3300012917 | Vadose Zone Soil | MVKLRMRTKFLLSMLLISAGLTSTSLLLVRRSVQTQVTKEIFSD |
| Ga0137419_108106031 | 3300012925 | Vadose Zone Soil | MGMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTEVRREIFADLRNS |
| Ga0137404_107757491 | 3300012929 | Vadose Zone Soil | MGMLKLRMRSKFLLSMLLISAGLTCTSLLLVRYSVRKQVRKEI |
| Ga0164303_115695882 | 3300012957 | Soil | MVMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHNVQKQVKRE |
| Ga0164301_103157551 | 3300012960 | Soil | MLQLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIKREI |
| Ga0164309_111045991 | 3300012984 | Soil | MVMLKLRMRTKFLLSMLLISAGLTCTSLLLVRHNVQKQVKRELFAD |
| Ga0157372_119919402 | 3300013307 | Corn Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRNSVQKQVRREIFADLRNSVS |
| Ga0157376_104741262 | 3300014969 | Miscanthus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRNSVQKQVRREIF |
| Ga0137418_105480352 | 3300015241 | Vadose Zone Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTEVRREIFADLRNS |
| Ga0132256_1021106832 | 3300015372 | Arabidopsis Rhizosphere | MVKLRLRTKFLLSMLLITSALSATSLLLVRRSVQKQIKQEIATEL |
| Ga0182036_103449492 | 3300016270 | Soil | MLKLRMRTKFLLSMLLISAGLTCMFLLLVRGSVQKQVK |
| Ga0187819_104105361 | 3300017943 | Freshwater Sediment | MKLRMRTKFLLSMVLITAGLTSTSLLLVRHSVQTQVRK |
| Ga0187781_102758273 | 3300017972 | Tropical Peatland | MMKFRMRTKLLLSMVLISASLTASSFLLVRRSVQRQVRKSIVA |
| Ga0187815_104249862 | 3300018001 | Freshwater Sediment | MKLRMRTKFLLSMVLITAGLTSTSLLLVRHSVQTQV |
| Ga0187875_100884413 | 3300018035 | Peatland | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFAD |
| Ga0187887_103683702 | 3300018043 | Peatland | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFA |
| Ga0184621_102679761 | 3300018054 | Groundwater Sediment | MAKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKRGIF |
| Ga0187773_108632631 | 3300018064 | Tropical Peatland | MKLRMRTKFLLSMLLISAGLTSTSLLLVRHSVQTQVKKEIF |
| Ga0187773_110679321 | 3300018064 | Tropical Peatland | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRRDIFADLR |
| Ga0187772_110422062 | 3300018085 | Tropical Peatland | MIKFRMRTKLLLSMLLISAGLTGSSFLLVRRSVDAQVRKSIVADLRNSVATFQNFQ |
| Ga0187774_109691171 | 3300018089 | Tropical Peatland | MMKFRMRTKFLLSMLLISAGLTCTSLLLVRHSVQGQIRREIFSD |
| Ga0187770_100676684 | 3300018090 | Tropical Peatland | MVKLRMRTKLLLSMLLISAGLTGSSFLLVRHSVQAQVRRSIVADLRNSVT |
| Ga0193747_11041102 | 3300019885 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRKEIFADLRNSV |
| Ga0193728_10474261 | 3300019890 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRK |
| Ga0193735_10529562 | 3300020006 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVRKQVR |
| Ga0206350_101624942 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRVRLRTKFLLSMVLVSAGLTSISLLLVRHTIQSKVVNEIYSD |
| Ga0206354_111731951 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRVRLRTKFLLSMVLVSAGLTSLSLLLVRHTVQAKVVDEIYSDL |
| Ga0210407_106786551 | 3300020579 | Soil | MMKLRMRTKFLLSMLLISAGLTWTSLLLVRRSVQAQVKK |
| Ga0210399_101568593 | 3300020581 | Soil | MMKLRMRTKFLLSMLLITAGLTWTSLLLVRRTVQAQVKK |
| Ga0210401_114517182 | 3300020583 | Soil | MKLRMRTKFLLSMLLISAGLTWTSLLLVRHTVQAQVTK |
| Ga0179596_104746201 | 3300021086 | Vadose Zone Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIRREIFA |
| Ga0210404_108040511 | 3300021088 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLVVRRSVQRQIKREIFA |
| Ga0210388_103493701 | 3300021181 | Soil | MKLRMRTKFLLSMLVISAGLTWTSLWLVRHSVQQQIRKGIFADLHNSVGIFQNFQ |
| Ga0193719_100838353 | 3300021344 | Soil | MVRVRLQTKFLLSMVLITAGLTSLSLLLVRQSVRSEVRQEIFSDL |
| Ga0210389_100568521 | 3300021404 | Soil | MMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFADLNNS |
| Ga0210389_108404251 | 3300021404 | Soil | MLKLRMRTKFLLSMLLISAGLTCMSLLLVRSSVQKQIKKGIFAD |
| Ga0193709_11182752 | 3300021411 | Soil | MMKLRLRTKFLLSMVLISAGLTTTSLLLVRRNVQAQEKKA |
| Ga0210402_109265282 | 3300021478 | Soil | MLKLRMRTKFLLSMLLISAGLTCMSLLLVRSSVQKQIKKGIFADL |
| Ga0242661_11695342 | 3300022717 | Soil | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFADLHNSV |
| Ga0242665_103092492 | 3300022724 | Soil | MKLRMRTKFLLSMLLITAGLTWTSLLLVRRSVQAQVRKSIFADLHNSVSTYQ |
| Ga0224561_10081191 | 3300023030 | Soil | MKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQAQVKKSIF |
| Ga0207692_101007781 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRYSVRKQVKRE |
| Ga0207692_103652761 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRVRLRTKFLLSMVLISAGLSSLSLLVVRQSVQSQARQEIVS |
| Ga0207692_106346562 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRVRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRRE |
| Ga0207685_105787561 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFAD |
| Ga0207654_101046123 | 3300025911 | Corn Rhizosphere | MLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRREIFADL |
| Ga0207693_114614101 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTIRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSQVRQEIVTDL |
| Ga0207663_110545552 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRREIFADLR |
| Ga0207652_103146981 | 3300025921 | Corn Rhizosphere | MVRFRLRTKFLLSMVLISAGLTSLSLLLVRQNVQSQVKKQVSTDLQ |
| Ga0207652_113272391 | 3300025921 | Corn Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQDRREI |
| Ga0207652_117910612 | 3300025921 | Corn Rhizosphere | MVRFRLRTKFLLSMVLISGGLTSLSLLLVRQNVQLQIK |
| Ga0207646_108358061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTQVRREIFADLRN |
| Ga0207700_101776983 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRARLRTKFLLSMVLITAGLTSLSLLLVRHSVQSQITREMFSDLRNSVS |
| Ga0207665_113609992 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQ |
| Ga0207667_112372811 | 3300025949 | Corn Rhizosphere | MVRFRLRTKFLLSMVLISAGLTSLSLLLVRQNVQSQVKKQVS |
| Ga0207702_117445121 | 3300026078 | Corn Rhizosphere | MVRVRLRTKFLLSMVLVTAGLTSLSLLLVRRTMQSQVLDGIYSD |
| Ga0209237_11998362 | 3300026297 | Grasslands Soil | MVKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVK |
| Ga0209238_12398552 | 3300026301 | Grasslands Soil | MSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQVKKEI |
| Ga0209055_11875002 | 3300026309 | Soil | MSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQVK |
| Ga0209153_12684332 | 3300026312 | Soil | MSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHKQV |
| Ga0209153_12700852 | 3300026312 | Soil | MAKLRMRTKFLLSMLLISAGLTSTSLLVVQHSLQKQTRK |
| Ga0209158_12309742 | 3300026333 | Soil | MSRLRLQTKFLLSMLLISAGLTCTSLLLVRRSVHRQVK |
| Ga0257178_10397602 | 3300026446 | Soil | MVRFRLQTKFLLSMVLITAGLTSLSLLLVRQSVRSEVRQEIFSDLQN |
| Ga0257169_10175461 | 3300026469 | Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQTEVRREI |
| Ga0209056_106358552 | 3300026538 | Soil | MVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSRA |
| Ga0209577_105064551 | 3300026552 | Soil | MVRVRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSQARQEIVEGLRN |
| Ga0209577_105229192 | 3300026552 | Soil | MVKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQSQVKRGLFS |
| Ga0209219_11435761 | 3300027565 | Forest Soil | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVRKSIF |
| Ga0209527_11297871 | 3300027583 | Forest Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQMRR |
| Ga0208827_11429311 | 3300027641 | Peatlands Soil | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVTK |
| Ga0209177_101119302 | 3300027775 | Agricultural Soil | MVNLRLRTKFLLSMVAISAGLTATSLLLVRRTIEQQVRSEIRV |
| Ga0209274_101911351 | 3300027853 | Soil | MMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFAD |
| Ga0209067_107102411 | 3300027898 | Watersheds | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIRREIFAD |
| Ga0209067_107774541 | 3300027898 | Watersheds | MMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQA |
| Ga0209006_108608331 | 3300027908 | Forest Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIRL |
| Ga0209583_106775281 | 3300027910 | Watersheds | MKLRMRTKFLLSMLLISAGLTWTSLLLVRRSVQAQVKK |
| Ga0268266_108113022 | 3300028379 | Switchgrass Rhizosphere | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSVS |
| Ga0307312_110690902 | 3300028828 | Soil | MGKEKHVVRVRMRTKFLLSMLLISASLTCTSLLVVRRSIHARVKN |
| Ga0311365_107521142 | 3300029989 | Fen | MREGGTMVKLRLRTKFLLSMIVITAGLTSTSLLFVRRSVQAQVKKGIVADL |
| Ga0311360_102179333 | 3300030339 | Bog | MREGGTMVKLRLRTKFLLSMIVITAGLTSTSLLFVRRSVQAQ |
| Ga0170834_1138200912 | 3300031057 | Forest Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIFADLRNSVNTF |
| Ga0170824_1125429851 | 3300031231 | Forest Soil | MMKLRMRTKFLLSMLLISAGLTWTSLLLVRRTVQAQVKKSIFADLHNS |
| Ga0307474_102298251 | 3300031718 | Hardwood Forest Soil | MKLRLRTKFLLSMLLITAGLTWTSLLLVRRTVQAQVKKSIFADL |
| Ga0307468_1009111141 | 3300031740 | Hardwood Forest Soil | MLRLRMRTKFLLSMLLISAGLTCTSLLLVRYSVQKQIRRE |
| Ga0307468_1010475012 | 3300031740 | Hardwood Forest Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQVRREIF |
| Ga0310917_101820001 | 3300031833 | Soil | MKIRLRTKFLLSMLLISASLTATSLLLVRHTVQSQVKKSLVSDL |
| Ga0310910_111485561 | 3300031946 | Soil | MKIRLRTKFLLSMLLISASLTATSLLLVRHTVQSQVKKSLVSD |
| Ga0307479_104980143 | 3300031962 | Hardwood Forest Soil | MLKLRMRTKFLLSMLLISAGLTCTSLLLVRHSVQKQIKREIF |
| Ga0307479_110499802 | 3300031962 | Hardwood Forest Soil | MVTIRLRTKFLLSMVLISAGLTSLSLLLVRQSVQSAVRQEIFSDLYNS |
| Ga0311301_121098111 | 3300032160 | Peatlands Soil | MTRLRMRTKFLLSMLLITAGLTCTSLLLVRRSVQAQVRKGIFADLRNSVSTFQN |
| Ga0307471_1013309531 | 3300032180 | Hardwood Forest Soil | MVKLRMRTKFLLSMLLISTGLTCTSLLLVRRSVQGQVKKEI |
| Ga0307472_1000167875 | 3300032205 | Hardwood Forest Soil | MPRLRLQTKFLLSMLLISTGLTCTSLLLVRRSVHKQVK |
| Ga0307472_1004296172 | 3300032205 | Hardwood Forest Soil | MLKLRLRTKFLLSMLLISAGLTCTSLLLVRRSVHKQVKKEILSD |
| Ga0335082_105402581 | 3300032782 | Soil | MMKLRMRSKFLLSMLLISAGLTCASLLLVRHSVQTQV |
| Ga0335079_103799861 | 3300032783 | Soil | MVRWRMQTKFLLSMLLISAGLTCTSLLLVRRSVQEQVRKQIVGDLYNSVSTFQTFQ |
| Ga0335079_112038671 | 3300032783 | Soil | MMKLRMRTKFLLSMLLISAGLTCTSLLLVRRSVQAQVKKEILADL |
| Ga0335079_119386861 | 3300032783 | Soil | MKLRMRTKFLLSMLVITAGLTSTSLLLVRHSVQAHVRGEIFADLHNSVSTF |
| Ga0335080_107422811 | 3300032828 | Soil | MLKLRMRGKFLLSMLLISAGLTGISLLLVRHSVQAQVRKN |
| Ga0335081_106650191 | 3300032892 | Soil | MRLRTKILLSMLLILAGLTSTSLLLVRRSVEQHFQTEISADLRSSVLQF |
| ⦗Top⦘ |