| Basic Information | |
|---|---|
| Family ID | F047791 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.04 % |
| % of genes near scaffold ends (potentially truncated) | 22.15 % |
| % of genes from short scaffolds (< 2000 bps) | 71.81 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere (6.711 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.228 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.268 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.19% β-sheet: 0.00% Coil/Unstructured: 84.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF04366 | Ysc84 | 16.78 |
| PF01903 | CbiX | 8.05 |
| PF00970 | FAD_binding_6 | 7.38 |
| PF08241 | Methyltransf_11 | 4.70 |
| PF13649 | Methyltransf_25 | 1.34 |
| PF01507 | PAPS_reduct | 1.34 |
| PF13520 | AA_permease_2 | 1.34 |
| PF00158 | Sigma54_activat | 1.34 |
| PF04191 | PEMT | 1.34 |
| PF12847 | Methyltransf_18 | 1.34 |
| PF00263 | Secretin | 0.67 |
| PF07589 | PEP-CTERM | 0.67 |
| PF01757 | Acyl_transf_3 | 0.67 |
| PF04337 | DUF480 | 0.67 |
| PF12728 | HTH_17 | 0.67 |
| PF02742 | Fe_dep_repr_C | 0.67 |
| PF00486 | Trans_reg_C | 0.67 |
| PF13286 | HD_assoc | 0.67 |
| PF13144 | ChapFlgA | 0.67 |
| PF00892 | EamA | 0.67 |
| PF00107 | ADH_zinc_N | 0.67 |
| PF13561 | adh_short_C2 | 0.67 |
| PF13527 | Acetyltransf_9 | 0.67 |
| PF00190 | Cupin_1 | 0.67 |
| PF00072 | Response_reg | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 16.78 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.67 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.25 % |
| Unclassified | root | N/A | 12.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101702600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 743 | Open in IMG/M |
| 3300001356|JGI12269J14319_10112375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1290 | Open in IMG/M |
| 3300004082|Ga0062384_100322517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 967 | Open in IMG/M |
| 3300004463|Ga0063356_101971390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 882 | Open in IMG/M |
| 3300004479|Ga0062595_101109950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
| 3300004635|Ga0062388_101306638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 724 | Open in IMG/M |
| 3300005183|Ga0068993_10056839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1156 | Open in IMG/M |
| 3300005329|Ga0070683_100078546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3088 | Open in IMG/M |
| 3300005329|Ga0070683_100106341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2645 | Open in IMG/M |
| 3300005330|Ga0070690_100282818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1184 | Open in IMG/M |
| 3300005330|Ga0070690_100498915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 910 | Open in IMG/M |
| 3300005331|Ga0070670_101659607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 588 | Open in IMG/M |
| 3300005334|Ga0068869_100035331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3541 | Open in IMG/M |
| 3300005334|Ga0068869_100439657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1079 | Open in IMG/M |
| 3300005335|Ga0070666_10489761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 891 | Open in IMG/M |
| 3300005340|Ga0070689_100101778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2274 | Open in IMG/M |
| 3300005340|Ga0070689_100264340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1423 | Open in IMG/M |
| 3300005345|Ga0070692_10185849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1207 | Open in IMG/M |
| 3300005353|Ga0070669_100650583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 887 | Open in IMG/M |
| 3300005367|Ga0070667_100384581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1275 | Open in IMG/M |
| 3300005434|Ga0070709_10169668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1524 | Open in IMG/M |
| 3300005435|Ga0070714_100026699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4775 | Open in IMG/M |
| 3300005436|Ga0070713_100228331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1691 | Open in IMG/M |
| 3300005439|Ga0070711_100357677 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300005454|Ga0066687_10809890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
| 3300005471|Ga0070698_100379160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1347 | Open in IMG/M |
| 3300005529|Ga0070741_10002811 | All Organisms → cellular organisms → Bacteria | 45314 | Open in IMG/M |
| 3300005534|Ga0070735_10104861 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300005538|Ga0070731_11173260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 507 | Open in IMG/M |
| 3300005542|Ga0070732_10158115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1350 | Open in IMG/M |
| 3300005543|Ga0070672_100407991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1165 | Open in IMG/M |
| 3300005545|Ga0070695_101828530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
| 3300005548|Ga0070665_100784469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 966 | Open in IMG/M |
| 3300005591|Ga0070761_10413542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 824 | Open in IMG/M |
| 3300005618|Ga0068864_102076299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 575 | Open in IMG/M |
| 3300005718|Ga0068866_10634735 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005836|Ga0074470_11387999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 653 | Open in IMG/M |
| 3300005836|Ga0074470_11681134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2148 | Open in IMG/M |
| 3300006046|Ga0066652_100515975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1113 | Open in IMG/M |
| 3300006059|Ga0075017_100060095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2572 | Open in IMG/M |
| 3300006162|Ga0075030_100031355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4537 | Open in IMG/M |
| 3300006176|Ga0070765_100105223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2447 | Open in IMG/M |
| 3300006176|Ga0070765_100402458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1278 | Open in IMG/M |
| 3300006237|Ga0097621_100028458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4404 | Open in IMG/M |
| 3300006237|Ga0097621_102415200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 503 | Open in IMG/M |
| 3300006854|Ga0075425_101001704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 953 | Open in IMG/M |
| 3300006903|Ga0075426_10196263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1463 | Open in IMG/M |
| 3300006954|Ga0079219_11109062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 672 | Open in IMG/M |
| 3300009093|Ga0105240_10003958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22879 | Open in IMG/M |
| 3300009098|Ga0105245_11313133 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300009101|Ga0105247_10707125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300009101|Ga0105247_10844398 | Not Available | 702 | Open in IMG/M |
| 3300009161|Ga0114966_10143714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1559 | Open in IMG/M |
| 3300009176|Ga0105242_10049468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3421 | Open in IMG/M |
| 3300009176|Ga0105242_10874004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 897 | Open in IMG/M |
| 3300009176|Ga0105242_12183355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 599 | Open in IMG/M |
| 3300009635|Ga0116117_1217419 | Not Available | 509 | Open in IMG/M |
| 3300009645|Ga0116106_1174190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 686 | Open in IMG/M |
| 3300009764|Ga0116134_1032605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2060 | Open in IMG/M |
| 3300010048|Ga0126373_10211562 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300010375|Ga0105239_12747358 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010379|Ga0136449_100712883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1680 | Open in IMG/M |
| 3300010379|Ga0136449_103866754 | Not Available | 562 | Open in IMG/M |
| 3300010399|Ga0134127_10385002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1382 | Open in IMG/M |
| 3300010401|Ga0134121_10896163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 861 | Open in IMG/M |
| 3300010401|Ga0134121_12589022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 551 | Open in IMG/M |
| 3300010938|Ga0137716_10260763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 965 | Open in IMG/M |
| 3300011120|Ga0150983_12754378 | Not Available | 528 | Open in IMG/M |
| 3300011428|Ga0137456_1110258 | Not Available | 718 | Open in IMG/M |
| 3300012951|Ga0164300_10829953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300013102|Ga0157371_10400219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1005 | Open in IMG/M |
| 3300013308|Ga0157375_10482971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1404 | Open in IMG/M |
| 3300014200|Ga0181526_10463074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300014297|Ga0075306_1110197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300014492|Ga0182013_10088663 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300014501|Ga0182024_10000713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 86358 | Open in IMG/M |
| 3300014501|Ga0182024_10000929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 75756 | Open in IMG/M |
| 3300014838|Ga0182030_11069718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300014969|Ga0157376_11403188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 730 | Open in IMG/M |
| 3300014969|Ga0157376_12187088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300017955|Ga0187817_10017827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4182 | Open in IMG/M |
| 3300018088|Ga0187771_10004674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 9647 | Open in IMG/M |
| 3300021178|Ga0210408_10374745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1134 | Open in IMG/M |
| 3300021178|Ga0210408_11190973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 582 | Open in IMG/M |
| 3300021181|Ga0210388_10044474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3689 | Open in IMG/M |
| 3300021388|Ga0213875_10409370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300021420|Ga0210394_10120853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2268 | Open in IMG/M |
| 3300021559|Ga0210409_11207219 | Not Available | 632 | Open in IMG/M |
| 3300022213|Ga0224500_10061037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| 3300025324|Ga0209640_10469076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1030 | Open in IMG/M |
| 3300025899|Ga0207642_10362761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 858 | Open in IMG/M |
| 3300025903|Ga0207680_10616996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300025907|Ga0207645_10708885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300025908|Ga0207643_10378398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300025913|Ga0207695_10555438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300025927|Ga0207687_10273500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1351 | Open in IMG/M |
| 3300025927|Ga0207687_10540079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 977 | Open in IMG/M |
| 3300025927|Ga0207687_11471709 | Not Available | 585 | Open in IMG/M |
| 3300025927|Ga0207687_11542757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 570 | Open in IMG/M |
| 3300025934|Ga0207686_10035288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3000 | Open in IMG/M |
| 3300025935|Ga0207709_11464527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300025936|Ga0207670_10151796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1720 | Open in IMG/M |
| 3300025936|Ga0207670_10622495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 888 | Open in IMG/M |
| 3300025942|Ga0207689_10021343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5445 | Open in IMG/M |
| 3300025944|Ga0207661_10128221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2169 | Open in IMG/M |
| 3300026023|Ga0207677_10271188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1388 | Open in IMG/M |
| 3300026035|Ga0207703_11529388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 642 | Open in IMG/M |
| 3300026089|Ga0207648_10094205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2618 | Open in IMG/M |
| 3300026095|Ga0207676_10763967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 941 | Open in IMG/M |
| 3300027754|Ga0209596_1087838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1497 | Open in IMG/M |
| 3300027775|Ga0209177_10334817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300027842|Ga0209580_10384132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 700 | Open in IMG/M |
| 3300027869|Ga0209579_10788890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 513 | Open in IMG/M |
| 3300027911|Ga0209698_10105528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2354 | Open in IMG/M |
| 3300027986|Ga0209168_10014078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4663 | Open in IMG/M |
| 3300028906|Ga0308309_10115948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2101 | Open in IMG/M |
| 3300029636|Ga0222749_10196962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1005 | Open in IMG/M |
| 3300029987|Ga0311334_11701099 | Not Available | 537 | Open in IMG/M |
| 3300029999|Ga0311339_10326212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1637 | Open in IMG/M |
| 3300030007|Ga0311338_10935818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 848 | Open in IMG/M |
| 3300030019|Ga0311348_11218021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 560 | Open in IMG/M |
| 3300031232|Ga0302323_100921847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 967 | Open in IMG/M |
| 3300031232|Ga0302323_101083847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 892 | Open in IMG/M |
| 3300031236|Ga0302324_100734423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300031261|Ga0302140_10377383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1156 | Open in IMG/M |
| 3300031595|Ga0265313_10080809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1477 | Open in IMG/M |
| 3300031708|Ga0310686_108252843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1579 | Open in IMG/M |
| 3300031708|Ga0310686_111645869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 742 | Open in IMG/M |
| 3300031708|Ga0310686_111713302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 813 | Open in IMG/M |
| 3300031708|Ga0310686_114019144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300031720|Ga0307469_11959251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
| 3300031912|Ga0306921_10749891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1119 | Open in IMG/M |
| 3300032160|Ga0311301_10157773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4071 | Open in IMG/M |
| 3300032421|Ga0310812_10479507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
| 3300032893|Ga0335069_10025138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8163 | Open in IMG/M |
| 3300032954|Ga0335083_11349349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 547 | Open in IMG/M |
| 3300033134|Ga0335073_11400233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 683 | Open in IMG/M |
| 3300033412|Ga0310810_10008109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 12057 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.68% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.01% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.01% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.01% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.01% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.01% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.01% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.34% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.34% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.34% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.34% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.34% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.67% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.67% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.67% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014297 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1017026002 | 3300000364 | Soil | MPRTDLYLKVELDLDSNESPERVAAEICRLVCRVYGVRKAEVSSMVERDGS* |
| JGI12269J14319_101123753 | 3300001356 | Peatlands Soil | MSRTDVYLKLELVLDEKESPERVAAEICRQVRKLHGVRQAEVSNMVEREG* |
| Ga0062384_1003225172 | 3300004082 | Bog Forest Soil | MRRTDVYLKLELVLDEKESAERVAAEICRQVRKLHGVRQAEVSNTVEREG* |
| Ga0063356_1019713902 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VPRTDLYLKVELDLDKKESPERVAAEICRMIRRVYGVHKAEVSSMVERDDS* |
| Ga0062595_1011099501 | 3300004479 | Soil | MIKSVPRTDLYLKVELDLDQKESPERVAAEICRVIRRVYGVRKAEVSSMVERDES* |
| Ga0062388_1013066381 | 3300004635 | Bog Forest Soil | MRRTDVYLKLELVLDEKESAERVAAEICRQVRKLHGVRQAE |
| Ga0068993_100568393 | 3300005183 | Natural And Restored Wetlands | LTAPHTSYDQKVPRSDLYLKVELDLDVKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0070683_1000785463 | 3300005329 | Corn Rhizosphere | MPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0070683_1001063412 | 3300005329 | Corn Rhizosphere | MPRTDLYLKVELDLDSNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0070690_1002828183 | 3300005330 | Switchgrass Rhizosphere | MPRTDVYIKVELDRDPKESAERLAAEICRMIRKVYSVRQAEVSSIVEREPS* |
| Ga0070690_1004989152 | 3300005330 | Switchgrass Rhizosphere | VPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0070670_1016596071 | 3300005331 | Switchgrass Rhizosphere | MPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVER |
| Ga0068869_1000353312 | 3300005334 | Miscanthus Rhizosphere | MPRTDLYLKVELDLDSSESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0068869_1004396572 | 3300005334 | Miscanthus Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEICRMLRKLYSVRQVEVSSIMEREPS* |
| Ga0070666_104897612 | 3300005335 | Switchgrass Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEICRLIRKLYSVRNAEVSSIMEREQS* |
| Ga0070689_1001017783 | 3300005340 | Switchgrass Rhizosphere | VPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDEP* |
| Ga0070689_1002643404 | 3300005340 | Switchgrass Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEIIRMIRKLYSVRQAEVSSIIEREPS* |
| Ga0070692_101858491 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LPSSYHRKMPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0070669_1006505831 | 3300005353 | Switchgrass Rhizosphere | MPRTDLYLKVELDIDERESPERLAAEIFRQIRKIYGVRAAKVSNVVERES* |
| Ga0070667_1003845813 | 3300005367 | Switchgrass Rhizosphere | MARTHVYLKVELDLPESQKDKERPERVAAEICRLIRRVYGVRSAEVSS |
| Ga0070709_101696683 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRNVPRTDLHLKVELDLDQKESPERVAAEICRMIRRIYGVRKAEVSSMVERDES* |
| Ga0070714_1000266993 | 3300005435 | Agricultural Soil | MPRTDLYLKVEIDLEDKESPERVAAEICRLIRRVYGVRKAEVSSMVERDQS* |
| Ga0070713_1002283313 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVEIDLEDKESPERVAAEICRLIRRVYGVRKAEVSSMVERDQS* |
| Ga0070713_1007465492 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MARIDLYVKVELVLPDTERPEKLAAEICRQLQKIYGVRAAEVQNMVSVE* |
| Ga0070711_1003576772 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRTDLYLKVELDLDDKESLERVAAEICRNIRRVYGVRKTEVSSMVERDES* |
| Ga0066687_108098902 | 3300005454 | Soil | MPRTDLYLKVELDLDDKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0070698_1003791601 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRTDLYLKVELDIDAKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0070741_1000281126 | 3300005529 | Surface Soil | LKVELDLDPKETPERVAAEICRVIRRVYGVRKAEVSSMVEREES* |
| Ga0070741_102273262 | 3300005529 | Surface Soil | MARTDLYLKIELDLPDTEQPDKLATEICRQVSKIYGVRSAEVQNMVERA* |
| Ga0070739_103365981 | 3300005532 | Surface Soil | MRFDLYVKIELDLPESEQPDKLAAEICRQLQKIYGVRNAEVQNTVRVE* |
| Ga0070735_101048612 | 3300005534 | Surface Soil | MDLYLKVELDLDEKEAPDRLAAEICRQIRKIYGVRAAEVSNIVARE* |
| Ga0070731_111732602 | 3300005538 | Surface Soil | MLRTDVYLKLELVLDDKESPERVAAEICRQVRKLHGVRQAEVSNMVDRDG* |
| Ga0070732_101581152 | 3300005542 | Surface Soil | VPRTDLYLKVELDLDQKESPERVAAEICRIVRRVYGVRKAEVSSMVEREEL* |
| Ga0070672_1004079911 | 3300005543 | Miscanthus Rhizosphere | RIASYHQKVPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0070695_1018285302 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SYLHRIASYHQKVPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0070665_1007844691 | 3300005548 | Switchgrass Rhizosphere | MPRTDLYLKVELDLDSNESPERVAAEICRLVRRVYGVRKAE |
| Ga0070761_104135421 | 3300005591 | Soil | MRRTDVYLKVELVLEEKESAERVAAEICRQVRKLHGVRQAEVSN |
| Ga0068864_1020762992 | 3300005618 | Switchgrass Rhizosphere | LPSSYHRKMPRTDLYLKVELDIDAKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0068866_106347352 | 3300005718 | Miscanthus Rhizosphere | TDLYLKVELDIDERESPERLAAEICRQIGKIYGVRAAEVSNVVERES* |
| Ga0074470_113879992 | 3300005836 | Sediment (Intertidal) | VPRTDLYLKVELDLDPKESPERVAAEICRTIRRVYGVRKVEVSSMVERDES* |
| Ga0074470_116811343 | 3300005836 | Sediment (Intertidal) | VPRSDLYLKVELDLDVKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0066652_1005159751 | 3300006046 | Soil | DLYLKVELDLDDKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0075017_1000600952 | 3300006059 | Watersheds | VPRTDLYLKVELDLDPKESPERLASEISRAIRRVYGVRKVEVSSIIEREES* |
| Ga0075030_1000313554 | 3300006162 | Watersheds | MTRTDVFLKVELDHDDRERPERLAQEICRMIRRVYGVRNVEVQNILEKEK* |
| Ga0070765_1001052232 | 3300006176 | Soil | VPRTDLYLKIELDLDQKESPERVAAEICRIIRRVYGVRKAEVSSMVERDES* |
| Ga0070765_1004024583 | 3300006176 | Soil | MPRTDLYVKVELDLDEKEKPDRIANEICRMIRKIYGVRGAEVSSMVDKEP* |
| Ga0097621_1000284583 | 3300006237 | Miscanthus Rhizosphere | MYLHRNASYHQKVPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0097621_1024152002 | 3300006237 | Miscanthus Rhizosphere | TDLYIKVEVSLDTTETPERLAAEICRLIYRVHGVRSAELSSAVEKD* |
| Ga0075425_1010017042 | 3300006854 | Populus Rhizosphere | VPRTDLYLKVELDLDQKESPERVAAEICRIVRKIYGVRKAEVSSMVERDSPG* |
| Ga0075426_101962631 | 3300006903 | Populus Rhizosphere | MPRTDLYLKVELDLDEKESAERVAAEICRMIRRVYGVRQAEVSNMVERESR |
| Ga0079219_111090622 | 3300006954 | Agricultural Soil | MPRTDLYLKVELDLEDKESPERVAAEICRVIRRVYGVRKAEVSSMIERESHGEL* |
| Ga0105240_1000395811 | 3300009093 | Corn Rhizosphere | MPRTDVYIKVELDHDQDEKVAALAAEICRNLRKLYNVRAAEVQSIHPRSEE* |
| Ga0105245_113131332 | 3300009098 | Miscanthus Rhizosphere | GLPSSYHRKMPRTDLYLKVELDLDSNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0105247_107071252 | 3300009101 | Switchgrass Rhizosphere | VSYLHPIASYHQKVPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0105247_108443981 | 3300009101 | Switchgrass Rhizosphere | PSSYHRKMPRTDLYLKVELDLDSNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0114966_101437142 | 3300009161 | Freshwater Lake | MLRTDVYLKVELDLDPKESAERVAAEICRLISRVYSVRKAEVSSIMPREMS* |
| Ga0105242_100494684 | 3300009176 | Miscanthus Rhizosphere | MPRTDLYLKVELDLDDKESPERVAAEICRLVRRVYGVRKAEVSSMVEREGS* |
| Ga0105242_108740042 | 3300009176 | Miscanthus Rhizosphere | VARTDLYLKVELDLDPKESPERVAAEICRVIRRVYGVRKAEVSSMVERDDS* |
| Ga0105242_121833552 | 3300009176 | Miscanthus Rhizosphere | MPRTDVYIKVELDRDPKESTERLAAEICRMIRKVYSVRQAEVSSIVEREPS* |
| Ga0116221_14837152 | 3300009523 | Peatlands Soil | MARIDLYLKVELDLPDTERPDKLAAEICRQLKKIYGVRAAEVQNMVSVE* |
| Ga0116117_12174191 | 3300009635 | Peatland | MKRTDLYVKVELDYDDEEKVERLASEICRVIRRVYGVRKAEVSSMIERET* |
| Ga0116106_11741902 | 3300009645 | Peatland | MVRTDLYLKVELDLDEKEKPDRLASEICRLIRKRYGVRSAEVSSMVEKEG* |
| Ga0116134_10326054 | 3300009764 | Peatland | MVRTDVYLKVEVVLDEKEPVERVAAEICRQVRKLHGVRQAEVLSTVDRD* |
| Ga0126373_102115623 | 3300010048 | Tropical Forest Soil | MPRTDVYLKIELDVDEKEKPERLATEICRQIRKIYGVRAAEVTNMVDREAS* |
| Ga0105239_127473582 | 3300010375 | Corn Rhizosphere | VPRTDLYLKVELDLDPKESPERVASEICRMIRRIYGVRKAEVSSMVERDES* |
| Ga0136449_1007128832 | 3300010379 | Peatlands Soil | MSRTDVYLKLELVLDEKESPERVAAEICRQVRKLHGVHQAEVSNMVEREG* |
| Ga0136449_1029164161 | 3300010379 | Peatlands Soil | MARIDLYLKIKLDIPDTERPDKLAAEICRQVKKIYGVRAAE |
| Ga0136449_1038667541 | 3300010379 | Peatlands Soil | MVRIDLYLKVELNFDEKENAERLASEICRLIGKVYGVRRAEVSSMVEKEG* |
| Ga0134127_103850023 | 3300010399 | Terrestrial Soil | MARTHVYLKVELDLPESQKDKERPERVAAEICRLIRRVYGVRSAEVSSNMERET* |
| Ga0134121_108961632 | 3300010401 | Terrestrial Soil | MPRTDVYIKVELDRDPKESAERIAAEICRMIRKLYSVRQVEVSSIV* |
| Ga0134121_125890222 | 3300010401 | Terrestrial Soil | VARTNLYLKIELDLDPKESPERVAAEISRAIRRVYGVRKVEVSSMIEREES* |
| Ga0137716_102607632 | 3300010938 | Hot Spring Fe-Si Sediment | MRRTDVYLKVELDLDPAESAERVAAEISRLIRKVYSVRHVEVSSIMPRENS* |
| Ga0150983_127543781 | 3300011120 | Forest Soil | LYLKVELVLDEKENPERVAAEICRLIAKVYGVRRAEVSNMVEKES* |
| Ga0137456_11102581 | 3300011428 | Soil | FGMARTDVYIKIELDRDPTEPAERLAAEICRMLRKVDSVRKAEVSSIIEREGS* |
| Ga0164300_108299531 | 3300012951 | Soil | LYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0157371_104002191 | 3300013102 | Corn Rhizosphere | PSSYHRKMPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS* |
| Ga0157375_104829712 | 3300013308 | Miscanthus Rhizosphere | MPRTDVYIKIELDRDPKESAERLAAEICRMIRKVYSVRQAEVSSIVEREPS* |
| Ga0181526_104630742 | 3300014200 | Bog | MVRTDVYLKVELALDEKESAERVAAEICRQVRKLHGVRQAEVSNLVDRE* |
| Ga0075306_11101972 | 3300014297 | Natural And Restored Wetlands | MKYMPRTDVYLKVELDLDPKESAERVAAEICRMISRVYSVRKAEVSSIMPRETS* |
| Ga0182013_100886632 | 3300014492 | Bog | MKRTDLYVKVELDYDDEEQVERLAAEICRVIRRVYGVRKVEVSSMIEREN* |
| Ga0182024_1000071376 | 3300014501 | Permafrost | LKVEIDIDVKEQPERLALEICRQIRRVYGVRAAELLNVVDRES* |
| Ga0182024_1000092960 | 3300014501 | Permafrost | MRRTDVYLKVELVLDEKESAERVAAEICRQVRKLHGVRQAEVSSSVDRE* |
| Ga0182030_110697181 | 3300014838 | Bog | MRRTDVYLKLELVLDEKEPPERVAAEICRQVRKLHGVRQAEVTNTVERE* |
| Ga0157376_114031882 | 3300014969 | Miscanthus Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEICRLIRKLYSVRNAEVS |
| Ga0157376_121870881 | 3300014969 | Miscanthus Rhizosphere | DLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES* |
| Ga0187817_100178276 | 3300017955 | Freshwater Sediment | MSRTDVYLKLELVLDEKESPERVAAEICRQVRKLHGVRQAEVSNMVEREG |
| Ga0187771_100046744 | 3300018088 | Tropical Peatland | MARTDLYVKVELDHDDEEDVGRLASEICRLIRRVYGVRNVEVSSVIERET |
| Ga0210408_103747451 | 3300021178 | Soil | RTDLYLKVELDLDEKEKPERLAAEICRVIRKIYGVRSAEVSSMVEKD |
| Ga0210408_111909732 | 3300021178 | Soil | VPRTDVYLKVELDLDPKEKPERVAAEICRTIRRIYGVRKAEV |
| Ga0210388_100444744 | 3300021181 | Soil | MPRTDLYVKVELDLDEKEKPDRIANEICRMIRKIYGVRGAEVSSMVDKEP |
| Ga0213875_104093702 | 3300021388 | Plant Roots | MKRADLYLKVELDLDESEKPERIAAEICRVIQRIYGVRKADVSNIVEREK |
| Ga0210394_101208533 | 3300021420 | Soil | MRRTDVYLKLELVLEEKESAERVAAEICRQVRKLHGVRQAEVSNTVERE |
| Ga0210409_112072191 | 3300021559 | Soil | MRRTDLYLKVELDLDEKESPERVAAEICRIIRRVYGVRKAEVSNMVERKQS |
| Ga0224500_100610371 | 3300022213 | Sediment | MPRTDVYLKVELDLDPKESAERVAAEICRLISRVYSVRKAEVSSIMPRETS |
| Ga0209640_104690761 | 3300025324 | Soil | MPRTDVYIKVELDRDPQESAERIAAEICRLIRKVYSVRHAEVSSIMEREPPK |
| Ga0207642_103627612 | 3300025899 | Miscanthus Rhizosphere | VPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES |
| Ga0207680_106169962 | 3300025903 | Switchgrass Rhizosphere | MPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207645_107088851 | 3300025907 | Miscanthus Rhizosphere | TDLYLKVELDLDSSESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207643_103783982 | 3300025908 | Miscanthus Rhizosphere | VPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDEP |
| Ga0207695_105554382 | 3300025913 | Corn Rhizosphere | MPRTDVYIKVELDHDQDEKVAALAAEICRNLRKLYNVRAAEVQSIHPRSEE |
| Ga0207687_102735001 | 3300025927 | Miscanthus Rhizosphere | MPRTDVYIKVELDRDPKESAERLAAEICRMIRKVYSVRQAEVSSIVEREPS |
| Ga0207687_105400791 | 3300025927 | Miscanthus Rhizosphere | MPRTDLYLKVELDLDEKESPERVAAEICRLVRRVYGVRKAEVS |
| Ga0207687_114717092 | 3300025927 | Miscanthus Rhizosphere | SFGMPLTDVYIKVELDRDPKESAERLAAEICRMIRKVYSVRQAEVSSIVEREPS |
| Ga0207687_115427572 | 3300025927 | Miscanthus Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEICRMLRKLYSVRQVEVSSIMEREPS |
| Ga0207686_100352883 | 3300025934 | Miscanthus Rhizosphere | MPRTDLYLKVELDLDDKESPERVAAEICRLVRRVYGVRKAEVSSMVEREGS |
| Ga0207709_114645272 | 3300025935 | Miscanthus Rhizosphere | DLYLKVELDLDSNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207670_101517962 | 3300025936 | Switchgrass Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEIIRMIRKLYSVRQAEVSSIIEREPS |
| Ga0207670_106224952 | 3300025936 | Switchgrass Rhizosphere | MPRTDVYIKVELDRDPKESAERIAAEICRMIRKLYSVRNAEVSSIMEREPS |
| Ga0207689_100213435 | 3300025942 | Miscanthus Rhizosphere | MPRTDLYLKVELDLDSSESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207661_101282213 | 3300025944 | Corn Rhizosphere | YLKVELDLDSNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207677_102711881 | 3300026023 | Miscanthus Rhizosphere | PSSYHRKMPRTDLYLKVELDLDSNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207703_115293881 | 3300026035 | Switchgrass Rhizosphere | VPRSDLYLKVELDLDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES |
| Ga0207648_100942053 | 3300026089 | Miscanthus Rhizosphere | MPRTDLYLKVELDLDRNESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0207676_107639671 | 3300026095 | Switchgrass Rhizosphere | MSHLHRIVCTASYHRNVPRTDVYLKVELDLDPKEKPERVAAEICRTIRRIYGVRKAEDRTGTGP |
| Ga0209596_10878382 | 3300027754 | Freshwater Lake | MLRTDVYLKVELDLDPKESAERVAAEICRLISRVYSVRKAEVSSIMPREMS |
| Ga0209810_12329551 | 3300027773 | Surface Soil | MRFDLYVKIELDLPESEQPDKLAAEICRQLQKIYGVRNAEVQNTVRVE |
| Ga0209177_103348171 | 3300027775 | Agricultural Soil | YYQKVPRTDLYLKVELDLDPKETPDRVAAEICRVIRRVYGVRKAEVSSMVEREES |
| Ga0209580_103841322 | 3300027842 | Surface Soil | VPRTDLYLKVELDLDQKESPERVAAEICRIVRRVYGVRKAEVSSMVEREEL |
| Ga0209517_102717552 | 3300027854 | Peatlands Soil | MARIDLYLKVELDLPDTERPDKLAAEICRQLKKIYGVRAAEVQNMVSVE |
| Ga0209579_107888901 | 3300027869 | Surface Soil | MLRTDVYLKLELVLDDKESPERVAAEICRQVRKLHGVRQAEVSNMVDRDG |
| Ga0209698_101055282 | 3300027911 | Watersheds | LKVELDHDDRERPERLAQEICRMIRRVYGVRNVEVQNILEKEK |
| Ga0209168_100140783 | 3300027986 | Surface Soil | MDLYLKVELDLDEKEAPDRLAAEICRQIRKIYGVRAAEVSNIVARE |
| Ga0308309_101159482 | 3300028906 | Soil | VPRTDLYLKIELDLDQKESPERVAAEICRIIRRVYGVRKAEVSSMVERDES |
| Ga0222749_101969622 | 3300029636 | Soil | VPRTDLYLKVELDLDQKESPERVAAEICRIIRRVYGVRKAEISSMVERDES |
| Ga0311334_117010992 | 3300029987 | Fen | MKRTDLYVKVELDYDDEEKAERLAAEICRVIRRVYGVRKAEVSSMIDRDN |
| Ga0311339_103262122 | 3300029999 | Palsa | MRRTDVYLKLELVLEEKESAERVAAEICRQVRKLHGVRQAEVSNTVEREG |
| Ga0311338_109358182 | 3300030007 | Palsa | MARTDVFLKVELDLDEKEPPDRVASEICRLIRRLYGVRAVEVSNMVAKDA |
| Ga0311348_112180212 | 3300030019 | Fen | MKYMPRTDVYLKVELDLDPKESADRVAAEICRLISRVYSVRKAEVSSIMPR |
| Ga0302323_1009218472 | 3300031232 | Fen | MKRTDLYVKVELDYNDEEKAERLAAEICRVIRRVYGVRKAEVSSMIDRDN |
| Ga0302323_1010838472 | 3300031232 | Fen | MPRTDVYLKVELDLDPKESAERVAAEICRMISRVYSVRKAEVSSIMPRETS |
| Ga0302324_1007344232 | 3300031236 | Palsa | MVRTDVYLKVELVLDEKESAERVAAEICRQVRKFHGVRKAEVSSTIERD |
| Ga0302140_103773833 | 3300031261 | Bog | MKRTDLYVKVELDYDDEEQVERLAAEICRVIRRVYGVRKVEVSSMIEREN |
| Ga0265313_100808092 | 3300031595 | Rhizosphere | MARTDLYLKVELDLDEKERPERIASEICRLIRKQYGVRGAEVSSMVEKDT |
| Ga0310686_1082528432 | 3300031708 | Soil | MRRTDLYVKVELDYDDEEKVERLASEICRVIRRVYGVRKAEVSSMIEREN |
| Ga0310686_1116458691 | 3300031708 | Soil | MRRTDVYLKVELVLDEKESAERVAAEICRQVRKLHGVRQAEVSSSVDRE |
| Ga0310686_1117133022 | 3300031708 | Soil | MVRTDVYLKVEVVLDEKEPVERVAAEICRQVRKLHGVRQAEVLSTVDRD |
| Ga0310686_1140191442 | 3300031708 | Soil | MLRTAVYLKLELILDDKESPERVAAEICRQVRKLHGVRQAEVSNMVDREG |
| Ga0307469_119592512 | 3300031720 | Hardwood Forest Soil | MPRTDLYLKVELDIDAKESPERVAAEICRLVRRVYGVRKAEVSSMVERDGS |
| Ga0306921_107498913 | 3300031912 | Soil | MARFDLYLKVEIDVDEREKPDRVAAEICRLIGRVYGVRHAEVSNIVEREK |
| Ga0315292_115914281 | 3300032143 | Sediment | MARFDLYLKVEVDVDGNEDPDKLAAEICRLIRKIYGVRAA |
| Ga0311301_101577734 | 3300032160 | Peatlands Soil | MRRTDLYVKVELDYDDEEKVERLAAEICRVIRRVYGVRKAEVSSMIERET |
| Ga0311301_120411481 | 3300032160 | Peatlands Soil | MARIDLYLKIKLDIPDTERPDKLAAEICRQVKKIYGVRA |
| Ga0310812_104795072 | 3300032421 | Soil | MPRTDLYLKVELDLDSKESPERVAAEICRVIRRVYGVRKAEVSSMVERDES |
| Ga0335081_112456142 | 3300032892 | Soil | MHRIDLYLKVELDLPEAEKPDKLAAEICRQLQKIYGVRSAEVQNMVRVE |
| Ga0335069_1002513812 | 3300032893 | Soil | MRRTDVYVKVEVVVDENEPVERIAAEICRQIRKLHGVRQAEVSNMVERD |
| Ga0335072_104140392 | 3300032898 | Soil | MARTDLYLKIQLDLPDTEQPEKLAAEICRQVSKIYGVRTAEVQNMVERA |
| Ga0335083_113493491 | 3300032954 | Soil | MARTDLYVKVELDYDGEEKVERLAAEICRMVRRVYGVRHVEVSSIIEKEK |
| Ga0335073_114002331 | 3300033134 | Soil | MVRTDVYIKVEVALDEKESAERVAAEICRMIRKMHGVRHAEVSNLVEKD |
| Ga0310810_1000810910 | 3300033412 | Soil | VSYLHRIASYHQKVPRSDLYLKVELDVDAKESPERVAAEICRMIRRVYGVRKAEVSSMVERDES |
| ⦗Top⦘ |