Basic Information | |
---|---|
Family ID | F047744 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 46 residues |
Representative Sequence | QVIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP |
Number of Associated Samples | 129 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.01 % |
% of genes near scaffold ends (potentially truncated) | 96.64 % |
% of genes from short scaffolds (< 2000 bps) | 93.29 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.933 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.738 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.215 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.242 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.33% β-sheet: 18.06% Coil/Unstructured: 73.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF00941 | FAD_binding_5 | 14.77 |
PF13561 | adh_short_C2 | 9.40 |
PF13378 | MR_MLE_C | 7.38 |
PF03450 | CO_deh_flav_C | 7.38 |
PF00881 | Nitroreductase | 4.70 |
PF02627 | CMD | 4.03 |
PF00296 | Bac_luciferase | 4.03 |
PF01979 | Amidohydro_1 | 3.36 |
PF02515 | CoA_transf_3 | 2.01 |
PF01799 | Fer2_2 | 1.34 |
PF02746 | MR_MLE_N | 1.34 |
PF00211 | Guanylate_cyc | 1.34 |
PF01315 | Ald_Xan_dh_C | 1.34 |
PF02954 | HTH_8 | 1.34 |
PF01734 | Patatin | 1.34 |
PF06224 | HTH_42 | 1.34 |
PF00496 | SBP_bac_5 | 1.34 |
PF00111 | Fer2 | 1.34 |
PF01464 | SLT | 0.67 |
PF04545 | Sigma70_r4 | 0.67 |
PF01068 | DNA_ligase_A_M | 0.67 |
PF12697 | Abhydrolase_6 | 0.67 |
PF08240 | ADH_N | 0.67 |
PF13531 | SBP_bac_11 | 0.67 |
PF08352 | oligo_HPY | 0.67 |
PF01053 | Cys_Met_Meta_PP | 0.67 |
PF12700 | HlyD_2 | 0.67 |
PF03446 | NAD_binding_2 | 0.67 |
PF01850 | PIN | 0.67 |
PF02668 | TauD | 0.67 |
PF05598 | DUF772 | 0.67 |
PF04392 | ABC_sub_bind | 0.67 |
PF00106 | adh_short | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 4.03 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.03 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 4.03 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 2.68 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.01 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.34 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.34 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 1.34 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.34 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.34 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.67 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.67 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.67 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.67 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.67 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.67 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.67 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.67 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.67 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.67 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.67 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.67 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.93 % |
Unclassified | root | N/A | 10.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_100362186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 613 | Open in IMG/M |
3300000955|JGI1027J12803_104966780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
3300001139|JGI10220J13317_10020859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
3300002557|JGI25381J37097_1061605 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300002909|JGI25388J43891_1048909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300004009|Ga0055437_10285854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
3300004281|Ga0066397_10154603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300004800|Ga0058861_11050012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 515 | Open in IMG/M |
3300005167|Ga0066672_10883116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
3300005176|Ga0066679_10444875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
3300005183|Ga0068993_10194187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 703 | Open in IMG/M |
3300005332|Ga0066388_100043018 | All Organisms → cellular organisms → Bacteria | 4503 | Open in IMG/M |
3300005332|Ga0066388_103266402 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005332|Ga0066388_107289301 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005338|Ga0068868_101033643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 753 | Open in IMG/M |
3300005345|Ga0070692_10567610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 746 | Open in IMG/M |
3300005446|Ga0066686_10798156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
3300005518|Ga0070699_101205010 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005536|Ga0070697_100196536 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
3300005546|Ga0070696_100158150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1668 | Open in IMG/M |
3300005549|Ga0070704_100626244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 948 | Open in IMG/M |
3300005569|Ga0066705_10055777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2235 | Open in IMG/M |
3300005569|Ga0066705_10146312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1448 | Open in IMG/M |
3300005574|Ga0066694_10480525 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300005615|Ga0070702_101583191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300005713|Ga0066905_100305474 | Not Available | 1251 | Open in IMG/M |
3300005713|Ga0066905_100496098 | Not Available | 1014 | Open in IMG/M |
3300005713|Ga0066905_100703578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 867 | Open in IMG/M |
3300005718|Ga0068866_11127881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 563 | Open in IMG/M |
3300005764|Ga0066903_107772477 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300006237|Ga0097621_100437542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
3300006358|Ga0068871_100352003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
3300006800|Ga0066660_10609657 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300006804|Ga0079221_10604660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 740 | Open in IMG/M |
3300006845|Ga0075421_100730443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
3300006845|Ga0075421_101889750 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300006847|Ga0075431_100876744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 868 | Open in IMG/M |
3300006852|Ga0075433_10440189 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300006865|Ga0073934_10725587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300006880|Ga0075429_100983611 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300006881|Ga0068865_100820228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
3300006881|Ga0068865_101911872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 537 | Open in IMG/M |
3300006904|Ga0075424_100125011 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
3300006918|Ga0079216_11644172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300006969|Ga0075419_11138039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 573 | Open in IMG/M |
3300007004|Ga0079218_12285447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300007265|Ga0099794_10451165 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300009012|Ga0066710_100104588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3801 | Open in IMG/M |
3300009012|Ga0066710_100521403 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
3300009078|Ga0105106_10319619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 1123 | Open in IMG/M |
3300009089|Ga0099828_10504771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1091 | Open in IMG/M |
3300009090|Ga0099827_10365872 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300009090|Ga0099827_10652332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 909 | Open in IMG/M |
3300009100|Ga0075418_11141769 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 844 | Open in IMG/M |
3300009101|Ga0105247_10200890 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300009148|Ga0105243_11171725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 780 | Open in IMG/M |
3300009148|Ga0105243_12422859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
3300009162|Ga0075423_12221234 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300009551|Ga0105238_12759428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 528 | Open in IMG/M |
3300010043|Ga0126380_10551128 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300010043|Ga0126380_11947199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 536 | Open in IMG/M |
3300010046|Ga0126384_10456465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1092 | Open in IMG/M |
3300010046|Ga0126384_11641949 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300010301|Ga0134070_10355356 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300010359|Ga0126376_10404760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1231 | Open in IMG/M |
3300010361|Ga0126378_10645519 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300010362|Ga0126377_10236360 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300010366|Ga0126379_10832830 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300010398|Ga0126383_11002859 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300010398|Ga0126383_12729595 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300011271|Ga0137393_10515817 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300011442|Ga0137437_1278755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300012202|Ga0137363_11258505 | Not Available | 627 | Open in IMG/M |
3300012225|Ga0137434_1053744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 617 | Open in IMG/M |
3300012226|Ga0137447_1092770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 595 | Open in IMG/M |
3300012349|Ga0137387_10382469 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300012349|Ga0137387_11259549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 519 | Open in IMG/M |
3300012361|Ga0137360_10789035 | Not Available | 817 | Open in IMG/M |
3300012362|Ga0137361_10340146 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300012882|Ga0157304_1076420 | Not Available | 568 | Open in IMG/M |
3300012918|Ga0137396_10084900 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
3300012918|Ga0137396_11196341 | Not Available | 536 | Open in IMG/M |
3300012925|Ga0137419_10006668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5925 | Open in IMG/M |
3300012929|Ga0137404_12210172 | Not Available | 514 | Open in IMG/M |
3300012944|Ga0137410_10104869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2101 | Open in IMG/M |
3300012972|Ga0134077_10433106 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300012989|Ga0164305_11124952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 676 | Open in IMG/M |
3300014154|Ga0134075_10258685 | Not Available | 754 | Open in IMG/M |
3300014326|Ga0157380_11118103 | Not Available | 828 | Open in IMG/M |
3300015259|Ga0180085_1022466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1756 | Open in IMG/M |
3300015372|Ga0132256_102434275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 626 | Open in IMG/M |
3300017657|Ga0134074_1262128 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300017930|Ga0187825_10053690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1366 | Open in IMG/M |
3300018056|Ga0184623_10090958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1407 | Open in IMG/M |
3300018074|Ga0184640_10383732 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300018084|Ga0184629_10036552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2162 | Open in IMG/M |
3300019889|Ga0193743_1106326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 1042 | Open in IMG/M |
3300019997|Ga0193711_1013070 | Not Available | 1044 | Open in IMG/M |
3300020004|Ga0193755_1057054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1270 | Open in IMG/M |
3300022525|Ga0242656_1029599 | Not Available | 868 | Open in IMG/M |
3300022694|Ga0222623_10205922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 763 | Open in IMG/M |
3300025310|Ga0209172_10485825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300025535|Ga0207423_1067715 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300025904|Ga0207647_10146962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1379 | Open in IMG/M |
3300025910|Ga0207684_10904062 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300025921|Ga0207652_11612569 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300025935|Ga0207709_10293812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
3300025938|Ga0207704_10936179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 730 | Open in IMG/M |
3300025940|Ga0207691_10470410 | Not Available | 1069 | Open in IMG/M |
3300025961|Ga0207712_10636167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 926 | Open in IMG/M |
3300025961|Ga0207712_11421659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300025981|Ga0207640_11558941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 594 | Open in IMG/M |
3300026285|Ga0209438_1000522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11896 | Open in IMG/M |
3300026297|Ga0209237_1065804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1729 | Open in IMG/M |
3300026300|Ga0209027_1064667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1363 | Open in IMG/M |
3300026312|Ga0209153_1183326 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300027388|Ga0208995_1085041 | Not Available | 552 | Open in IMG/M |
3300027875|Ga0209283_10736308 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300028381|Ga0268264_10571392 | Not Available | 1111 | Open in IMG/M |
3300028812|Ga0247825_11366864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300031538|Ga0310888_10805318 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300031720|Ga0307469_10627651 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300031720|Ga0307469_12045456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300031731|Ga0307405_11742866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300031740|Ga0307468_101134015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
3300031771|Ga0318546_11169084 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031798|Ga0318523_10540939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
3300031820|Ga0307473_10586186 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
3300031846|Ga0318512_10504884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
3300031910|Ga0306923_11835691 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300031944|Ga0310884_10826865 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
3300032009|Ga0318563_10183473 | Not Available | 1127 | Open in IMG/M |
3300032010|Ga0318569_10503334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300032013|Ga0310906_10085452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
3300032042|Ga0318545_10280317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
3300032060|Ga0318505_10079491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1458 | Open in IMG/M |
3300032163|Ga0315281_10958173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 871 | Open in IMG/M |
3300032180|Ga0307471_102130210 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300032205|Ga0307472_100208058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1494 | Open in IMG/M |
3300032205|Ga0307472_100228922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1439 | Open in IMG/M |
3300032205|Ga0307472_100277324 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300032205|Ga0307472_102206718 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300032829|Ga0335070_10066672 | All Organisms → cellular organisms → Bacteria | 3882 | Open in IMG/M |
3300033233|Ga0334722_10694522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 723 | Open in IMG/M |
3300033486|Ga0316624_11049732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 736 | Open in IMG/M |
3300033502|Ga0326731_1070089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 813 | Open in IMG/M |
3300034354|Ga0364943_0360457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
3300034817|Ga0373948_0007232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1861 | Open in IMG/M |
3300034818|Ga0373950_0014141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.04% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.37% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.36% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.01% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.01% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.01% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.01% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.01% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.34% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.34% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.34% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.34% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.67% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.67% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1003621861 | 3300000559 | Soil | APVYHLGFPIGVGPRVDDILATAIPGFYMSPYEDLTLRR* |
JGI1027J12803_1049667802 | 3300000955 | Soil | QLQRVLYEQVTQAPVYHLGFPIGVGPRVDDILATAIPGFYMSPYEDLTLRR* |
JGI10220J13317_100208591 | 3300001139 | Soil | LGFPTGLGPRVEVILVGATPGFYLAPFEDLRLRRP* |
JGI25381J37097_10616051 | 3300002557 | Grasslands Soil | LLHQLQRILHEQVTQAPVYHLGFPTGLGPRVDDILANAIPGFYLSPYEDLRLKRP* |
JGI25388J43891_10489091 | 3300002909 | Grasslands Soil | PVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0055437_102858541 | 3300004009 | Natural And Restored Wetlands | KREALLFQMQRILQEQVTQAPVYHLGFPTGLGPRVEDILANPIPGFYMSPYEDLKLKRP* |
Ga0066397_101546032 | 3300004281 | Tropical Forest Soil | LLHQLQGLLREQVVQAPIYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP* |
Ga0058861_110500121 | 3300004800 | Host-Associated | QAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0066672_108831162 | 3300005167 | Soil | ALLHQLQRILHEQVTQAPVYRLGFPTGLGPRVDDILATAIPGFYLSPYEDPRLKRP* |
Ga0066679_104448751 | 3300005176 | Soil | HEQVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0068993_101941871 | 3300005183 | Natural And Restored Wetlands | TQPPVYHLGFPTGLGPRVEDILATPIPGFYMSPYEDLRLKHR* |
Ga0066388_1000430181 | 3300005332 | Tropical Forest Soil | DQVTQAPIYHLGFPIGLGPRVDDVLATAIPGFYMSPYEDLKLRR* |
Ga0066388_1032664021 | 3300005332 | Tropical Forest Soil | VPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLKKP* |
Ga0066388_1072893013 | 3300005332 | Tropical Forest Soil | QLHQIQRILHDQVTQAPVYHLAFPTGLRPRVEDITTNGISGFYMAPYEDLKLKRP* |
Ga0068868_1010336432 | 3300005338 | Miscanthus Rhizosphere | AEQVIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0070692_105676102 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VTQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR* |
Ga0066686_107981561 | 3300005446 | Soil | QAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0070699_1012050101 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0070697_1001965363 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ILHEQVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0070696_1001581501 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QKILHEQVTQAPIYHLGFPIGVGPRVDDIMSSAIPGFYMSPYEDLKLKRP* |
Ga0070704_1006262442 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PVYHLGFPTGLGPRVEDILTGAIPGFYLAPFEDLRLRRP* |
Ga0066705_100557771 | 3300005569 | Soil | PIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0066705_101463122 | 3300005569 | Soil | VTQAPVYRLGFPTGLGPRVDDILANAIPGFYLSPYEDLRLKRP* |
Ga0066694_104805251 | 3300005574 | Soil | HLGFPIGVGPRVDDIMSSAIPGFYMSPYEDLKLKKP* |
Ga0070702_1015831911 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEQVTQAPVYHLGFPTGLGPRVEDILVGAIPGFYLAPFEDLRLRRP* |
Ga0066905_1003054741 | 3300005713 | Tropical Forest Soil | QVPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRKQ* |
Ga0066905_1004960982 | 3300005713 | Tropical Forest Soil | TILREEVVQAPIYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP* |
Ga0066905_1007035781 | 3300005713 | Tropical Forest Soil | QVPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ* |
Ga0068866_111278811 | 3300005718 | Miscanthus Rhizosphere | YHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR* |
Ga0066903_1077724771 | 3300005764 | Tropical Forest Soil | QAPIYHNGFPIGVGPRVEDMATAIPNFFLPPYEDLKLRRP* |
Ga0097621_1004375423 | 3300006237 | Miscanthus Rhizosphere | QVIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0068871_1003520031 | 3300006358 | Miscanthus Rhizosphere | HLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0066660_106096572 | 3300006800 | Soil | YHLGFPIGLGPRVDDILANAIPGFYVSPYEDLRLMRP* |
Ga0079221_106046601 | 3300006804 | Agricultural Soil | VQRVLHEQVTQAAVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0075421_1007304433 | 3300006845 | Populus Rhizosphere | AIYHLGFPIGVGPRVEDIMVTAIPGFYMSPYEDLRLRRP* |
Ga0075421_1018897502 | 3300006845 | Populus Rhizosphere | HQLQSILREQVVQAPIYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRPQ* |
Ga0075431_1008767441 | 3300006847 | Populus Rhizosphere | HLGFPIGMSPRVEDIVANAIPGFYMAPYEDLKLKAR* |
Ga0075433_104401892 | 3300006852 | Populus Rhizosphere | HEQVVQAPIYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP* |
Ga0073934_107255871 | 3300006865 | Hot Spring Sediment | QYLVTPVYHLGFPMGLSPKMEDVLVGIAPGFYMAPYEDLKFKAR* |
Ga0075429_1009836111 | 3300006880 | Populus Rhizosphere | APVYHLGFPTGLGPRVDDILATAIPGFYMSPYEDLKLRRP* |
Ga0068865_1008202281 | 3300006881 | Miscanthus Rhizosphere | LLHQMQRILNEQVTQAPVYHLGFPTGLGPRVEDILVGAIPGFYLAPFEDLRLRRP* |
Ga0068865_1019118721 | 3300006881 | Miscanthus Rhizosphere | VYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR* |
Ga0075424_1001250114 | 3300006904 | Populus Rhizosphere | TQAAIYHLGFPIGVGPRVEDIMVTAIPGFYMSPYEDLRLRRP* |
Ga0079216_116441722 | 3300006918 | Agricultural Soil | LGFPTGLGPRVEDILIGAIPGFYMAPFEDLRLRRP* |
Ga0075419_111380391 | 3300006969 | Populus Rhizosphere | IQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0079218_122854472 | 3300007004 | Agricultural Soil | HQLQRILDEQVTQAAVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRQ* |
Ga0099794_104511652 | 3300007265 | Vadose Zone Soil | QRILNEQTTQAPVYHLGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP* |
Ga0066710_1001045881 | 3300009012 | Grasslands Soil | QAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP |
Ga0066710_1005214031 | 3300009012 | Grasslands Soil | RVIHDQVVFVPIYHLGFPMGLGPRVEDPVAHGIPGFYMAPYEDLKLKAR |
Ga0105106_103196192 | 3300009078 | Freshwater Sediment | LHQIQRILHEHVTQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR* |
Ga0099828_105047712 | 3300009089 | Vadose Zone Soil | QRILHDQVTQAPVYHLGFPTGVGPRVDDILATAIPGFYLSPFEDLKLKRP* |
Ga0099827_103658721 | 3300009090 | Vadose Zone Soil | KRETLLFQMQRILNEQTTQAPVYHLGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP* |
Ga0099827_106523322 | 3300009090 | Vadose Zone Soil | ALLFQMQRMLLEQATQAPIYHLGFPTGVGPRVEDVLATPIPGFYMSPYEDLKLKRP* |
Ga0075418_111417692 | 3300009100 | Populus Rhizosphere | ILHEQVTQAPVYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLRLRKQ* |
Ga0105247_102008901 | 3300009101 | Switchgrass Rhizosphere | MQRILSEQVTQAPIYHLGFPTGVGPRVDDIMATAIPGFYLSPYEDL |
Ga0105243_111717251 | 3300009148 | Miscanthus Rhizosphere | APVYHLGFPTGLGPRVEDILVGAIPGFYLAPFEDLRLRRP* |
Ga0105243_124228592 | 3300009148 | Miscanthus Rhizosphere | QAPVYHLGFPIGVGPRVEDILANAIPGFYLSPYEDLKLKKP* |
Ga0075423_122212342 | 3300009162 | Populus Rhizosphere | MQRILNEQTTQAPVYHLGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP* |
Ga0105238_127594282 | 3300009551 | Corn Rhizosphere | GFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0126380_105511283 | 3300010043 | Tropical Forest Soil | VQAPIYHNGFPIGVGPRVEDMATAIPNFFLPPYEDLKLRRP* |
Ga0126380_119471991 | 3300010043 | Tropical Forest Soil | PVYHLGFPIGVGPRVDDILATAIPGFYMSPYEDLTLRR* |
Ga0126384_104564652 | 3300010046 | Tropical Forest Soil | LQEQVTQAPVYHLGFPTGVGPRVDDILANGIPGFYLSPYEDLKLKKA* |
Ga0126384_116419491 | 3300010046 | Tropical Forest Soil | TQVPVYHLGFPTGVGPRVDDILATSIPGFYLSPYEDLKLKKP* |
Ga0134070_103553561 | 3300010301 | Grasslands Soil | LLFQMQRILNEQATQAPVYHLGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP* |
Ga0126376_104047603 | 3300010359 | Tropical Forest Soil | HLMQRVLHEQVTQAAVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0126378_106455193 | 3300010361 | Tropical Forest Soil | PIYHLGFPIGVGRRVEDIMTTAIPGFYMSPYEDLKLRP* |
Ga0126377_102363601 | 3300010362 | Tropical Forest Soil | QTILHDQVVQAPIYHLGFPIGVGPRVEDIMATGIPGFYMSPYEDLKLKRP* |
Ga0126379_108328301 | 3300010366 | Tropical Forest Soil | EVVQAPIYHNGFPIGVGPRVEDMATAIPNFFLPPYEDLKLRRP* |
Ga0126383_110028591 | 3300010398 | Tropical Forest Soil | QVVQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0126383_127295952 | 3300010398 | Tropical Forest Soil | QVVQAPIYHLGFPIGVGPRVEDIMASAIPGFYMSPYEDLKLRRP* |
Ga0137393_105158172 | 3300011271 | Vadose Zone Soil | GFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP* |
Ga0137437_12787551 | 3300011442 | Soil | ILQEQATQAPVYHLGFPTGIGPRVEDILATGVPGFYMSPYEDLKLKKP* |
Ga0137363_112585051 | 3300012202 | Vadose Zone Soil | LHEQVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0137434_10537441 | 3300012225 | Soil | GFPIGVGPRVDDIMATAPPGFYMSPYEDLKLRAR* |
Ga0137447_10927701 | 3300012226 | Soil | PIYHLGFPIGVGPRVDDIMATAPPGFYMSPYEDLKLRAR* |
Ga0137387_103824692 | 3300012349 | Vadose Zone Soil | MLLRLVHEQVVQAPIYHLGFPIGVGPRLEDIMATAIPGFYMSPYEDLKLRRR* |
Ga0137387_112595491 | 3300012349 | Vadose Zone Soil | IQRILQEQVIQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0137360_107890353 | 3300012361 | Vadose Zone Soil | KILHEQVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP* |
Ga0137361_103401462 | 3300012362 | Vadose Zone Soil | HLGFPTGVGPRVDDVLATAIPGFYLSPFEDLKLKRP* |
Ga0157304_10764201 | 3300012882 | Soil | APIYHLGFPIGVGPRVDDIMSSAIPGFYMSPYEDLKLKKP* |
Ga0137396_100849003 | 3300012918 | Vadose Zone Soil | LGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP* |
Ga0137396_111963411 | 3300012918 | Vadose Zone Soil | QVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYTSPYEDLKLRP* |
Ga0137419_100066681 | 3300012925 | Vadose Zone Soil | QLQRIVYDQVIHAPIYRNGFPTGLGPRVEDIVANGIPGFYLAPYEDLKLKRP* |
Ga0137404_122101722 | 3300012929 | Vadose Zone Soil | YHLGFPIGVGPRVDDIMATAIPGLYMSPYEDLKLRRP* |
Ga0137410_101048691 | 3300012944 | Vadose Zone Soil | ILHQIQRILNEQVTQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR* |
Ga0134077_104331061 | 3300012972 | Grasslands Soil | PVYHLGFPTGVGPRVDDILAAAIPGFYLSPYEDLKLKKP* |
Ga0164305_111249521 | 3300012989 | Soil | QRILAEQVIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0134075_102586852 | 3300014154 | Grasslands Soil | QVTQAPVYHLGFPTGVGPRVDDILAAAIPGFYLSPYEDLKLKKP* |
Ga0157380_111181032 | 3300014326 | Switchgrass Rhizosphere | LGFPIGVGPRVDDIMVTAIPGFYMSPYEDLKLRRQ* |
Ga0180085_10224661 | 3300015259 | Soil | EAILHQIQRVLHEQVTQVPIYHLGFPIGVGPRVDDIMATAPPGFYMSPYEDLKLRTR* |
Ga0132256_1024342752 | 3300015372 | Arabidopsis Rhizosphere | ILAEQVIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP* |
Ga0134074_12621281 | 3300017657 | Grasslands Soil | LLFQMQRILNEQATQAPVYHLGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP |
Ga0187825_100536903 | 3300017930 | Freshwater Sediment | LQEQVTQVPVYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP |
Ga0184623_100909583 | 3300018056 | Groundwater Sediment | VTQVPIYHLGFPIGVGPRVDDIMATAPPGFYMSPYEDLKLRAR |
Ga0184640_103837321 | 3300018074 | Groundwater Sediment | VHEQVVQAPIYHLGLPIGVGPRLEDIMATAIPGFYMSPYEDLKLRRPWTA |
Ga0184629_100365521 | 3300018084 | Groundwater Sediment | AVLFQIQRILQEQVTQAPVYHLGFPTGIGPRVEDILATPISGFYMSLYEDLKLKRP |
Ga0193743_11063262 | 3300019889 | Soil | QVTQVPIYHLGFPIGVGPRVDDIMATAPPGFYMSPYEDLKLRAR |
Ga0193711_10130701 | 3300019997 | Soil | ILNEQVTQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR |
Ga0193755_10570542 | 3300020004 | Soil | VYHLGFPTGLGPRVEDILTGAIPGFYMAPFEDLRLRRP |
Ga0242656_10295992 | 3300022525 | Soil | VYHLGFPIGVGPRVDDIMANAIPGFYMSPYEDLKLRRP |
Ga0222623_102059222 | 3300022694 | Groundwater Sediment | LGFPIGVGPRVDDIMATAPPGFYMSPYEDLKLRAR |
Ga0209172_104858252 | 3300025310 | Hot Spring Sediment | QYLVTPVYHLGFPMGLSPKMEDVLVGIAPGFYMAPYEDLKFKAR |
Ga0207423_10677151 | 3300025535 | Natural And Restored Wetlands | LGFPTGIGPRVEDILATAIPGFYMSPYEDLKLKRP |
Ga0207647_101469622 | 3300025904 | Corn Rhizosphere | LLHQMQRILNEQVTQAPVYHLGFPTGLGPRVEDILVGAIPGFYLAPFEDLRLRRP |
Ga0207684_109040621 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QIQKILHEQVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLKRP |
Ga0207652_116125691 | 3300025921 | Corn Rhizosphere | LGFPIGVGPRVDDIMITAIPGFYMSPYEDLKLRRQ |
Ga0207709_102938121 | 3300025935 | Miscanthus Rhizosphere | IQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP |
Ga0207704_109361792 | 3300025938 | Miscanthus Rhizosphere | HLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP |
Ga0207691_104704102 | 3300025940 | Miscanthus Rhizosphere | PVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR |
Ga0207712_106361672 | 3300025961 | Switchgrass Rhizosphere | QAPVYHLGFPTGLGPRVEDILVGAIPGFYLAPFEDLRLRRP |
Ga0207712_114216591 | 3300025961 | Switchgrass Rhizosphere | RETLLHQLQGILREQVVQAPIYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP |
Ga0207640_115589412 | 3300025981 | Corn Rhizosphere | QVVQAPIYHLGFPIGVGPRVDDIMVTAIPGFYMSPYEDLKLRAR |
Ga0209438_100052215 | 3300026285 | Grasslands Soil | QIQRILNEQVTQAPVYHLGFPIGVGPRVDDILATAIPGFYMSPYEDLKLRAR |
Ga0209237_10658044 | 3300026297 | Grasslands Soil | IQRILHEQAVQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPDEDLKLRRP |
Ga0209027_10646671 | 3300026300 | Grasslands Soil | QKILHEQVTQAPIYHLGFPIGVGPRVDDIMSSAIPGFYMSPYEDLKLKRP |
Ga0209153_11833262 | 3300026312 | Soil | LGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP |
Ga0208995_10850412 | 3300027388 | Forest Soil | SQKILHEQVTQAPIYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP |
Ga0209283_107363082 | 3300027875 | Vadose Zone Soil | NEQTTQAPVYHLGFPTGLGPRVEDILAHAIPGFYMSPYEDLKLKKP |
Ga0268264_105713922 | 3300028381 | Switchgrass Rhizosphere | VTQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRAR |
Ga0247825_113668641 | 3300028812 | Soil | EQVVHAPIYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLKRP |
Ga0310888_108053182 | 3300031538 | Soil | RILHEQVVQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRQ |
Ga0307469_106276514 | 3300031720 | Hardwood Forest Soil | QKILHEQVTQAPIYHLGFPIGVGPRVDDIMASAIPGFYMSPYEDLKLKRP |
Ga0307469_120454562 | 3300031720 | Hardwood Forest Soil | HQLQRILHEQVTQAPVYHLGFPTGLGPRVEDILTGAIPGFYMAPFEDLRLRRP |
Ga0307405_117428661 | 3300031731 | Rhizosphere | LLHQLQRVVHDQVLNVPVYHLGFPTGVGPRMDDIHASIIPAFYFSPYEDLKFKPR |
Ga0307468_1011340151 | 3300031740 | Hardwood Forest Soil | FQIQRILQEQVTQAPVYHLGFPTGVGPRVDDILANAIPGFYLSPYEDLKLKRP |
Ga0318546_111690842 | 3300031771 | Soil | QAPIYHNGFPIGVGPRVEDMPTAIPNFFLPPYEDLKLRRP |
Ga0318523_105409391 | 3300031798 | Soil | QMQRILQEQVTQVPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ |
Ga0307473_105861862 | 3300031820 | Hardwood Forest Soil | EALLFQIQRILQEQVTQAAVYHLGFPTGVGPRVDDILANAIPGFYLSPYEDLKLKKP |
Ga0318512_105048841 | 3300031846 | Soil | VYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ |
Ga0306923_118356912 | 3300031910 | Soil | QVTQAPVYHLAFPTGLGPRVEDITVNGISGFYMAPYEDLKLKRP |
Ga0310884_108268652 | 3300031944 | Soil | QRILHEQVTQAAVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLWKP |
Ga0318563_101834731 | 3300032009 | Soil | LQEQVTQVPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ |
Ga0318569_105033342 | 3300032010 | Soil | MQRILQEQVTQVPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ |
Ga0310906_100854523 | 3300032013 | Soil | QRILHEQVVQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRQ |
Ga0318545_102803171 | 3300032042 | Soil | YHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ |
Ga0318505_100794911 | 3300032060 | Soil | QRILQEQVTQVPVYHLGFPTGVGPRVDDILATAIPGFYLSPYEDLKLRRQ |
Ga0315281_109581732 | 3300032163 | Sediment | LQEQVTQAPVYHLGFPTGIGPRVEDILATSISGFYMSPYEDLKLKKP |
Ga0307471_1021302102 | 3300032180 | Hardwood Forest Soil | HEQVVQAPVYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP |
Ga0307472_1002080583 | 3300032205 | Hardwood Forest Soil | EALLFQIQRILQEQVTQAPVYHLGFPTGVGPRVDDILANAIPGFYLSPYEDLKLKKP |
Ga0307472_1002289221 | 3300032205 | Hardwood Forest Soil | QQQVIQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRRP |
Ga0307472_1002773241 | 3300032205 | Hardwood Forest Soil | QVTQAPIYHLGFPIGVGPRVDDIMASAIPGFYMSPYEDLKLKRP |
Ga0307472_1022067182 | 3300032205 | Hardwood Forest Soil | TILHDQVVQAPIYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP |
Ga0335070_100666724 | 3300032829 | Soil | MQRILHEQVTQAPVYHLGFPTGLGPRVGDILATGLPGFYMSPYEDLKLKKP |
Ga0334722_106945221 | 3300033233 | Sediment | NEQVTQAPVYHLGFPIGVGPRVDDIMATAIPGFYMSPYEDLKLRVR |
Ga0316624_110497321 | 3300033486 | Soil | TQVPVYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP |
Ga0326731_10700892 | 3300033502 | Peat Soil | VLQEQVTQVPVYHLGFPIGVGPRVEDIMATAIPGFYMSPYEDLKLRRP |
Ga0364943_0360457_401_556 | 3300034354 | Sediment | MQRILNEQVTQAPVYHLGFPTGLGPRVEDILTGAIPGFYLAPFEDLRLKRP |
Ga0373948_0007232_2_133 | 3300034817 | Rhizosphere Soil | VIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP |
Ga0373950_0014141_2_172 | 3300034818 | Rhizosphere Soil | ALLHQLQRILAEQVIQAPVYHLGFPIGVGPRVEDILATAIPGFYMSPYEDLKLRRP |
⦗Top⦘ |