NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047707

Metagenome / Metatranscriptome Family F047707

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047707
Family Type Metagenome / Metatranscriptome
Number of Sequences 149
Average Sequence Length 183 residues
Representative Sequence KNFVIAALLGLVTFSQVETAQCEVIGHKARLAILNNLIQIEEGSESDSEEDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPNGALDIALQ
Number of Associated Samples 100
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 87.92 %
% of genes from short scaffolds (< 2000 bps) 99.33 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.658 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(55.034 % of family members)
Environment Ontology (ENVO) Unclassified
(67.114 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.644 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.33%    β-sheet: 8.45%    Coil/Unstructured: 58.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.66 %
UnclassifiedrootN/A1.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006357|Ga0075502_1017499Not Available667Open in IMG/M
3300006374|Ga0075512_1118693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300006383|Ga0075504_1001967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300006401|Ga0075506_1040800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300009265|Ga0103873_1111315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300009436|Ga0115008_10546241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium830Open in IMG/M
3300009543|Ga0115099_10286931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300009599|Ga0115103_1137474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300009608|Ga0115100_10643869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300009732|Ga0123373_119161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300009741|Ga0123361_1118660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300010299|Ga0129342_1145953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium865Open in IMG/M
3300010981|Ga0138316_11380939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300010987|Ga0138324_10466726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300010987|Ga0138324_10473584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300012504|Ga0129347_1295990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300012518|Ga0129349_1085423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300012518|Ga0129349_1132491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300012518|Ga0129349_1397499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium729Open in IMG/M
3300012523|Ga0129350_1030679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300012523|Ga0129350_1304635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300012528|Ga0129352_10815366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300012954|Ga0163111_12217027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300012963|Ga0129340_1023213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300016766|Ga0182091_1015937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300016776|Ga0182046_1579302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300017771|Ga0181425_1109239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium884Open in IMG/M
3300018515|Ga0192960_104676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300018649|Ga0192969_1038214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018692|Ga0192944_1031688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium765Open in IMG/M
3300018692|Ga0192944_1034214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300018692|Ga0192944_1040464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300018739|Ga0192974_1059927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300018741|Ga0193534_1062303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300018742|Ga0193138_1036643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300018742|Ga0193138_1048689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300018762|Ga0192963_1053753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300018763|Ga0192827_1071547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300018765|Ga0193031_1044619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium729Open in IMG/M
3300018765|Ga0193031_1052304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300018766|Ga0193181_1036579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300018791|Ga0192950_1038194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300018800|Ga0193306_1050834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300018811|Ga0193183_1059940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300018812|Ga0192829_1071318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018823|Ga0193053_1062057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018823|Ga0193053_1062421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300018831|Ga0192949_1084774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300018832|Ga0194240_1012088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018832|Ga0194240_1012089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018846|Ga0193253_1090477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018846|Ga0193253_1105825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018848|Ga0192970_1072694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018861|Ga0193072_1098632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300018870|Ga0193533_1095426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018874|Ga0192977_1081951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018885|Ga0193311_10044104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018885|Ga0193311_10051165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018899|Ga0193090_1103657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300018905|Ga0193028_1080010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300018926|Ga0192989_10107481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018926|Ga0192989_10154047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300018967|Ga0193178_10061534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018976|Ga0193254_10104724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018979|Ga0193540_10138918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300018980|Ga0192961_10145241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300018980|Ga0192961_10146105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300018982|Ga0192947_10171459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300018982|Ga0192947_10173891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018982|Ga0192947_10180994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018989|Ga0193030_10156624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300018989|Ga0193030_10160852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300018989|Ga0193030_10168708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300018989|Ga0193030_10169727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300018989|Ga0193030_10169873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300018989|Ga0193030_10187023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300018989|Ga0193030_10187600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018989|Ga0193030_10187662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018989|Ga0193030_10190395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018989|Ga0193030_10272444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300019017|Ga0193569_10306036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300019021|Ga0192982_10182153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300019022|Ga0192951_10294543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300019032|Ga0192869_10500799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300019036|Ga0192945_10143559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium767Open in IMG/M
3300019036|Ga0192945_10148360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium754Open in IMG/M
3300019036|Ga0192945_10175762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300019048|Ga0192981_10249675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300019050|Ga0192966_10197878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium718Open in IMG/M
3300019051|Ga0192826_10198212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300019051|Ga0192826_10211606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300019051|Ga0192826_10215448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300019051|Ga0192826_10240651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300019051|Ga0192826_10295550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300019051|Ga0192826_10314081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300019051|Ga0192826_10320398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300019095|Ga0188866_1025506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300019097|Ga0193153_1020822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300019102|Ga0194243_1003993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300019102|Ga0194243_1006733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300019108|Ga0192972_1069602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300019117|Ga0193054_1075956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300019123|Ga0192980_1070403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300019129|Ga0193436_1059953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019149|Ga0188870_10104156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300019150|Ga0194244_10036299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300019150|Ga0194244_10036611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium750Open in IMG/M
3300019150|Ga0194244_10062169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300020014|Ga0182044_1448986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300021169|Ga0206687_1556860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300021334|Ga0206696_1355262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300021350|Ga0206692_1321570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300021872|Ga0063132_107938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300021872|Ga0063132_132191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300021892|Ga0063137_1061514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300021896|Ga0063136_1015193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300021908|Ga0063135_1009550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300021908|Ga0063135_1011773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300021908|Ga0063135_1027129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300021912|Ga0063133_1016249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300021912|Ga0063133_1024046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300021934|Ga0063139_1033846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300026420|Ga0247581_1077975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300026443|Ga0247559_1076682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300026443|Ga0247559_1109179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300026458|Ga0247578_1082677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300026458|Ga0247578_1120429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300026461|Ga0247600_1071516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300026468|Ga0247603_1075360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300026468|Ga0247603_1102243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300026470|Ga0247599_1088112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300026470|Ga0247599_1097438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300026495|Ga0247571_1088471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300028110|Ga0247584_1145205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300028137|Ga0256412_1220788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300028137|Ga0256412_1247457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300028137|Ga0256412_1304678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300028233|Ga0256417_1155872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300028233|Ga0256417_1202012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300028282|Ga0256413_1279664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300028282|Ga0256413_1366375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300028290|Ga0247572_1086209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium769Open in IMG/M
3300028575|Ga0304731_10680382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300030699|Ga0307398_10544904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300031032|Ga0073980_11080656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300031725|Ga0307381_10265126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300031743|Ga0307382_10583361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300032732|Ga0314711_10615527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine55.03%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.77%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater13.42%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.05%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.01%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.01%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.34%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.67%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.67%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.67%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.67%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075502_101749913300006357AqueousFVIAAILGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIDLQ*
Ga0075512_111869313300006374AqueousKNFVIAAILGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIDLQ*
Ga0075504_100196713300006383AqueousKMKNFVIAAILGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIDLQ*
Ga0075506_104080013300006401AqueousINKMKNFVIAAILGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIDLQ*
Ga0103873_111131513300009265Surface Ocean WaterVIGHKKRLAILNNLIQIDEGSDSDSDDELVQTQKCSDCYGEVPAYMDKSDSAGGYKREMPARFDEERDDRLMNSVIGNYAREIKVNGALTGVMMLNQDDACALAAEVKRTHKKMGYAENEDKSCKDVFNHFDVNHDGLIEAERAPQFLRYLFPNGALDIDLQ*
Ga0115008_1054624123300009436MarineMKFVIAALLGLAAASQVETTNEVIGHKKRLAILNNLIQLDEGSDSDSEDELVQTKKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVVGAYAREIKVNGSLTGVMMLNVNDACALASEVIRTHKGMGYAQNEQMSCADAFNHFDVNKDGLIEAERAPQYLRYMLPNSALDIDLQ*
Ga0115099_1028693113300009543MarineMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ*
Ga0115103_113747413300009599MarineVNKMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ*
Ga0115100_1064386913300009608MarineKFVIAALLGLVAASQVESTNEVIGHKKRLAILNNLIQLDEGSDSDSDDELVQTEKCKDCYGEVPAYMDGSDSAGGYERVIPARFEEERDDRLMNSVHENYAREIKVNGKLTGVMMMNVDDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLFEAERAPQYIRYMFPNGALDIDLQ*
Ga0123373_11916113300009732MarineFVIAALLGLVAASQVEATSELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRFMNSVIGNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLIEAERAAQYIRYMFPNGALDIDLQ*
Ga0123361_111866013300009741MarineVIAALLGLVAASQVEATSELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRFMNSVIGNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLIEAERAAQYIRYMFPNGALDIDLQ*
Ga0129342_114595313300010299Freshwater To Marine Saline GradientMKFVIAALLGLVAASQVEATSELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKRQMPARFDEERDDRFMNSVIRNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLIEAERAAQYIRYMFPNGALDIDLQ*
Ga0138316_1138093913300010981MarineFVIAALLGLVAVSQVESVQCEVIGHKKRLAILNNLIQLGEGSESDSDSEDENVQLRGDDYGEVPAYMDGADTSGGYERKMPARFDEERDDRLMNSIVANYAREIKYKGKLTGVMMLNLDDARALVAEVNRTHKGYGYGVNPEQMSVEDAFNHFDVNHDGLIEAERTPQFLRYLNPNGALDIDLQ*
Ga0138324_1046672613300010987MarineMANGAADRKLGLVAFNQVESVQCEFIGHKKREAILNNLIQIEESDSDSDSEEENVQLAKNDYGEVPAYMDESDAAGGYKREMPARFDEERDDRLMNSIIGNYAREIKVKGKLTGVMMLNLDDARALADEVKRTHKGMGYAQQADAMGCADAFNHFDVNHDGLIEAERGPQFLRYLY
Ga0138324_1047358413300010987MarineFVIAALLGLVAVSQVESVQCEVIGHKKRLAILNNLIQIGEGSESDSDSEDENVQLRGDDYGEVPAYMDGADTSGGYERKMPARFDEERDDRLMNSIVANYAREIKYKGKLTGVMMLNLDDARALVAEVNRTHKGYGYGVNPEQMSVEDAFNHFDVNHDGLIEAERTPQFLRYLNPNGALDIDLQ*
Ga0138324_1051551513300010987MarineVIAAFLGLVSTIEVESTHELIGHKKRLAILDNLIQMEEGSESDSDSEDENVQLKGDDYGEVPAYMDGADTTGGYSREVPDRFSEERDDRLMNSVLKNYSHEVKLDGVLTGHNFSDKNDALGLYNEVKRTHCARWGTCKGADHVGFEDAFNHFDVNGDGLIEAERMPQFVRYVFGGALDQDLQ*
Ga0129347_129599013300012504AqueousNKMKFVIAALLGLVAASQVEATSELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRFMNSVIGNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLIEAERAAQYIRYMFPNGALDIDLQ*
Ga0129349_108542313300012518AqueousKNLAIAAILGLVTFTQVESVQCEEFIGHKKRLAILDNLIQIEEGSESDSDSEEENVQLGAAPTYGEVPAYMDGADTSGGYERLVPGRFSEERDDRLMNSIVSKYAREIKVAGKLTGVMMLNLEDATALAAEVRSTHKGMGYDAQNGMSVADAFNHFDVNHDGLIEAERTPQFLRYLFPNGALDIDLQ*
Ga0129349_113249113300012518AqueousKMKNFVIAALLGGLPSSQKETAKDQVIGHRARLAILNNLIQIEEGSDSESDEEENVQLKGDDYAEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVEGKLTGVMMLNLEDAKALAAEVRSTHKDMGYYKQVDGMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ*
Ga0129349_139749923300012518AqueousKNFVIAALLGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSESDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVVPDRFSEERDDQLMESVIEKYAREIKVQGKLTGVMMLNLEDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIDLQ*
Ga0129350_103067913300012523AqueousLLGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSESDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVVPDRFSEERDDQLMESVIEKYAREIKVQGKLTGVMMLNLEDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYP
Ga0129350_130463513300012523AqueousKMKFVIAALLGLVAASQVEATSELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRFMNSVIGNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLIEAERAAQYIRYMFPNGALDIDLQ*
Ga0129352_1081536613300012528AqueousSQVEAAKDQVIGHRARLAILNNLIQIEEGSDSESDEEENVQLKGDDYAEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVEGKLTGVMMLNLEDAKALAAEVRSTHKDMGYYKQVDGMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ*
Ga0163111_1221702713300012954Surface SeawaterKNKMKFVIAALLGLVAASQVETSTEMIGHKKRLAILNNLIQIEEGSDSDSEDETDAQNVQLGKCKDCYGEVPAYMDKSDAAGGYKRVVDYKFTEERDDQLMNSVLSNYAREIKVNGALTGVMMLNQGDACALAAEVARTHNGKMGYSQNEGMSCADAFNHFDVNKDGLIEAERAPQYLRYMFPNG
Ga0129340_102321313300012963AqueousNKMKFVIAALLGLVAASQVEATSELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRFMNSVIGNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAQNEGMSCADAFNHFDVNKDGLIEAERAAQYIRYMFPNGAL
Ga0182091_101593713300016766Salt MarshLGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNG
Ga0182046_157930213300016776Salt MarshNFVIAAILGLVTFSQVESVQCEFVGHKKRLAILNNLIQLEEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIDL
Ga0181425_110923923300017771SeawaterMKNLAIAAILGLVTFTQVESVQCEEFIGHKKRLAILDNLIQIEEGSESDSDSEEENVQLGAAPTYGEVPAYMDGADTAGGYERLVPGRFTEERDDRLMNSIVSKYAREIKVAGKLTGVMMLNLEDATALAAEVTRTHKGMGYDAQVGMSVADAFNHFDVNHDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0192960_10467613300018515MarineTWGNIRLINKMKYFAIAALLGLVSSAQVDATHETIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAYMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192969_103821413300018649MarineHGENIRLINKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192944_103168813300018692MarineMKNLVIAALFGLVTFSQVESVQCEEHVGHKKRLAILNNLIQIEEGSESDSDDESDEDIQLKGDYGEVPAYMDEADTAGGYKRDMPERFTEERDDRLMNSVIGKYAREIKVKGKLTGVMMLNAEDASALADEVRRTHKGMGYAMQADGMSAADAFNHFDVNHDGLVEAERMPQYLRYLFPNGALDIDLQXAKS
Ga0192944_103421413300018692MarineHGENIRLINKMKYFAIAALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192944_104046413300018692MarineMKNLVIAALFGLVTYSQVESVQCEEHVGHKKRLAILNNLIQIEEGSESDSDDESDEDVQLKGDYGEVPAYMDKADTAGGYARDMPDRFTEERDDRLMNSVIGNYAREIKIKGKLTGVMMLNVEDASALANEVRRTHKGMGYANQADGMSAADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDLQXAKS
Ga0192974_105992713300018739MarineALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193534_106230313300018741MarineRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0193138_103664313300018742MarineKNFVIAALLGLVSSSQVEAQHELIGHRARLAILNNLIQIEEGSDSESSDEDENVMLRGDDYAEVPAYMDKSEAAGGYKRVVPDRFSEERDDLLMESIIKKYAREIKVEGKLTGTMMLNLEDAKALAAEVLGSHKSMGYSQQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0193138_104868913300018742MarineKNFAIAALLGLVAFSQVESVQCEEFIGHKKRLAILDNLIQIEEGSESDSDSEEEQVQLKGDYGEVPAYMDGADTAGGYERVVPGRFTEERDDRLMNSIIGKYAREIKVKGSLTGVMMLNLADATALAAEVRSTHKGMGYESQNGMSVADAFNHFDVNKDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0192963_105375313300018762MarineKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192827_107154713300018763MarineHGVQCEFIGHKKRLAILDNLIQIEEDSESDSESDQENVQLKGDYGEVPAYMDEADCHGGYDRVVPDRFTEERDDRLMNSIIKNYAREIKVKGKLTGVMMLNLSDAEALAAEVRRTHKGMGYEAQVGMSVADAFNHFDVNKDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0193031_104461913300018765MarineTWEILDLKNKMKNFVIAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0193031_105230413300018765MarineMGNIILINKMKNLVIAALFGLVTYSQVESVQCEEFIGHKKRWAILNNLIQIGEGSESDSDESDSEDVQLSKNDYGEVPAYMDEADTAGGYTRVVPDRFTEERDDRLMNSVIGKYAREIKVKGNLTGVMMLNLEDATALANEVRSTHKGMGYAMQADGMSTADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDL
Ga0193181_103657913300018766MarineNKMKNFVIAALLGLVASSQVEAAKDQIIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYAEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVRSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ
Ga0192950_103819413300018791MarineMGIIRLINKMKYFAIAALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193306_105083413300018800MarineKNFVIAALLGLVTFSQVETAQCEVIGHRARLAILNNLIQIEEGSESDSDDDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLFPNGALDIALQ
Ga0193183_105994013300018811MarineTWGNIRLKNKMKNFVIAALLGLVASSQVEAAKDQIIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYAEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVRSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ
Ga0192829_107131813300018812MarineMKNFVIAALLGLVASSQVEAAKDQIIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYAEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVRSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ
Ga0193053_106205713300018823MarineKNFVIAALFGLVSCAQVEAAQNEVIGHRARLAILNNLIQIEEGSESESSDDEAENVQLRKCDDCYGEVPAYMDKSDAAGGYKRVVPDRFTEERDDQLMESVIEKYAREIKINGKLTGTMMLNLEDAKALAAEVKSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDIALQ
Ga0193053_106242113300018823MarineKNFVIAAFLGLVASSQVEVAKEQVIGHRARLAILNNLIQIEEGSDSESDEDENVQLKGDDYEEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVEGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDGMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIALQ
Ga0192949_108477413300018831MarineFAIAALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0194240_101208813300018832MarineGLINKMKNFVIAALLGLVSSSQVEAQHELIGHRARLAILNNLIQIEEGSDSESSDDDENVQLRGDDYAEVPAYMDKSEAAGGYKRVVPDRFSEERDDLLMESVIKKYAREIKVEGKLTGTMMLNLEDAKALAAEVLGSHKSMGYSQQVDMMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0194240_101208913300018832MarineGLINKMKNFVIAALLGLVASSQVEVAKDQVIGHRARLAILNNLIQIEEGSDSESDEDENVQLRGDDYAEVPAYMDKSDAAGGYKRVVPDRFTEERDDQLMESVIKKYAREIKVEGKLTGVMMLNLEDAKALAAEVLGSHKEMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0193253_109047713300018846MarineNKMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLDESESESDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKGMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0193253_110582513300018846MarineNKMKNFVIAALLGLVASSQVEVAKQQVIGHRARLAILNNLIQIEEGSDSESDSEENVQLKGDDDYSEVPAFMNKSDAHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVRSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0192970_107269413300018848MarineAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193072_109863213300018861MarineLKMKNFVIAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALD
Ga0193533_109542613300018870MarineKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0192977_108195113300018874MarineMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193311_1004410413300018885MarineDNKMKNFVIAALLGLVTFSQVETAQCEVIGHRARLAILNNLIQIEEGSESDSDDDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLFPNGALDIALQ
Ga0193311_1005116513300018885MarineDLVSCAQVEAAQNEVIGHRARLAILNNLIQIEEGSESESSDDEAENVQLRKCDDCYGEVPAYMDKSDAAGGYKRVVPERFTEERDDQLMESVIEKYAREIKVNGKLTGTMMLNLEDAKALAAEVMSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLFPNGALDIALQ
Ga0193090_110365713300018899MarineKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193028_108001013300018905MarineKMKNFVIAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0192989_1010748113300018926MarineINKMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLDESESESDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKGMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0192989_1015404713300018926MarineEVAKQQVIGHRARLAILNNLIQIEEGSDSESDSEENVQLKGDDDYSEVPAFMNKSDAHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVRSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0193178_1006153413300018967MarineAKDQVIGHRARLAILNNLIQIEEGSDSESDEEENVQLKGDDYAEVPAYMDKSDAAGGYKRVVPERFTEERDDQLMESVIKKYAREIKVEGKLTGVMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ
Ga0193254_1010472413300018976MarineLGLVTFSQVESAQCEFVGHKKRLAILNNLIQLDESESESDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKGMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0193540_1013891813300018979MarineMKNFVIAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0192961_1014524113300018980MarineHGENIRLINKMKYFAIAALLGLVSSAQVDATHETIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAYMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192961_1014610513300018980MarineMGVEINKMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLENSESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVFGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0192947_1017145913300018982MarineMKNLVIAALFGLVTFSQVESVQCEEHVGHKKRLAILNNLIQIEEGSESDSDDESDEDVQLKGDYGEVPAYMDKADTAGGYARDMPDRFTEERDDRLMNSVIGNYAREIKIKGKLTGVMMLNVEDATALANEVRRTHKGMGYANQADGMSAADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDLQ
Ga0192947_1017389113300018982MarineHGEYIDLKNKMKNFAIAALLGLVAFSQVESVQCEEHIGHKKRLAILDNLIQIEESDSESDSEEENVQLKGDYGEVPAYMDKADAFGGYSRVVPDRFTEERDDRLMNSVVGKYAREIKVKGALTGVMMLNLGDAQALANEVKSTHKGMGYESQVGMSVADAFNHFDVNHDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0192947_1018099413300018982MarineMGNIRLINKMKYFAIAALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193030_1015662413300018989MarineMKNFVIAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQXSISNQNERVHQHTIINI
Ga0193030_1016085213300018989MarineMGNIILINKMKNLVIAALFGLVTYSQVESVQCEEFIGHKKRWAILNNLIQIGEGSESDSDDSDSEDVQLSKNDYGEVPAYMDEADTAGGYTRVVPDRFTEERDDRLMNSVIGKYAREIKVKGNLTGVMMLNLEDATALANEVRSTHKGMGYAMQADGMSTADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDL
Ga0193030_1016870813300018989MarineKGTLFLIKYKMKNFVIAALLGLVAFNQVESVQCEFIGHHKRQAILTNLIQMEEGSESDSDSEEENVQLKGNDYGEVPAYMDGADTTGGYERVIPGRFTEERDDRLMNSVIGNYAREIKVKGALTGVMMLNVDDAKALAAEVKRTHKGMGYSLQGDLMGVEDAFNHFDVNHDGLIEAERAPQFLRYLFPNGALDIDLQ
Ga0193030_1016972713300018989MarineMKNFVIAALLGLVAFNQVESVQCEFIGHHKRQAILTNLIQMEEGSESDSDSEEENVQLRGDDYGEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVIGTYAREIKFKGSLTGVMMLNVDDAKALAAEVKRTHKGMGYSLQGDLMGVEDAFNHFDVNHDGLIEAERAPQFLRYLFPNGALDIDLQ
Ga0193030_1016987313300018989MarineMKSFVIAALLGLVACVQVESMQSEVIGHKKRLAILNNLIQIEESESDSDSDDENVQLAKNDYGEVPAYMDESDAAGGYKREMPARFDEERDDRLMNSIIGTYAREIKVKGKLTGVMMLNLDDAEALAAEVKRTHKGMGYANQADAMSVADAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0193030_1018702313300018989MarineMKNFVIAALLGLVAVSQVESVQCEVIGHKKRLAILNNLIQLGEGSESDSDSEDENVQLRGDDYGEVPAYMDGADTSGGYERKMPARFDEERDDRLMNSIVANYAREIKYKGKLTGVMMLNLDDARALVAEVNRTHKGYGYGVNPEQISVEDAFNHFDVNHDGLIEAERTPQFLRYLNPNGALDIDLQ
Ga0193030_1018760013300018989MarineMGNIRLKNKMKNFVIAALLGLVASSQVEAARDQVIGHKSRLAILNNLIQIEEGSDSESDEDQNLQLKGSDDYAEVPAFMNKSDAAGGYLRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLDDARALAAEVRSTHKEMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0193030_1018766213300018989MarineMKSFVIAALVGLVTFSQVESAQCEVIGHKKRLAILNNLIQIENSESDSDSEEENVQLNKTDYAEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVVGNYAREIKINGSLTGVMMLNVDDACALAAEVKRTHKGMGYAQQADAMSCQDGFNHFDVNHDGLIEAERAPQYLRYINPQGALDIDLQ
Ga0193030_1019039513300018989MarineHGNIILVNKMRQFVIAALLGLVAASHIESVQGEIIGHKKRMAILNNLIQIEESESDSDSEDENVQLNKPEDYGEVPAYMDGADTTGGYERVMPARFDEERDDRLMNSVIGNYAREVKYKGSLTGVMMLNLADAEALAAEVRRTHKGMGYSQQADGMSAADAFNHFDVNHDGLIEAERAPQFLRYLFPNGALDIDLQ
Ga0193030_1027244413300018989MarineLNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0193569_1030603613300019017MarineKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0192982_1018215313300019021MarineTWGINFINIRLINKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192951_1029454313300019022MarineHGKRLAILNNLIQIEEGSESDSDDESDEDIQLKGDYGEVPAYMDEADTAGGYKRDMPERFTEERDDRLMNSVIGKYAREIKVKGKLTGVMMLNAEDASALADEVRRTHKGMGYAMQADGMSAADAFNHFDVNHDGLVEAERMPQYLRYLFPNGALDIDLQXAKS
Ga0192869_1050079913300019032MarineNLIQIEEGSESDSDDESDEDVQLKGDYGEVPAYMDEADTAGGYKRDMPERFTEERDDRLMNSVIGKYAREIKIKGKLTGVMMLNLEDATALADEVRRTHKGMGYANQADGMSTADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDLQ
Ga0192945_1014355923300019036MarineEYMGNFDKNKMKNLVIAALFGLVTFSQVESVQCEEHVGHKKRLAILNNLIQIEEGSESDSDDESDEDIQLKGDYGEVPAYMDEADTAGGYKRDMPERFTEERDDRLMNSVIGKYAREIKVKGKLTGVMMLNAEDASALADEVRRTHKGMGYAKQADGMSAADAFNHFDVNHDGLVEAERMPQYLRYLFPNGALDIDLQXAKS
Ga0192945_1014836013300019036MarineTWGNIRLINKMKYFAIAALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192945_1017576213300019036MarineTWGYIDLKNKMKNFAIAALLGLVAFSQVESVQCEEHIGHKKRLAILDNLIQIEESDSESDSEEENVQLKGDYGEVPAYMDKADAFGGYSRVVPDRFTEERDDRLMNSIVGKYAREIKVKGALTGVMMLNLGDAQALANEVKSTHKGMGYESQVGMSVADAFNHFDVNHDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0192981_1024967523300019048MarineTWENIRLINKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192966_1019787813300019050MarineMGIRLINKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0192826_1019821213300019051MarineINKMKNLVIAALFGLVTYSQVESVQCEEYIGHKKRWAILNNLIQIEEGSESDSDDSDSENVQLAKNDYGEVPAYMDEADTAGGYTRVIPDRFTEERDDRLMNSVIGKYAREIKIKGKLTGVMMLNLEDATALANEVKSTHKSMGYAQQADAMSVADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDL
Ga0192826_1021160613300019051MarineMKTFAIAALLGIVTFSQVESVQCEFIGHKKRLAILDNLIQIEEDSESDSESDQENVQLKGDYGEVPAYMDEADCHGGYDRVVPDRFTEERDDRLMNSIIKNYAREIKVKGKLTGVMMLNLSDAEALAAEVRRTHKGMGYEAQVGMSVADAFNHFDVNKDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0192826_1021544813300019051MarineMKTFAIAALLGIVTFSQVESVQCEFIGHKKRLAILDNLIQIQEGSDDDSESDEENVQLKGDDYGEVPAYMDKADAFGGYERNVPDRFSEERDDRLMNSIISNYAREIKVKGKLTGVMMLNLQDAEALAAEVKRTHNYLMGYQNQVGMSVADAFNHFDVNHDGLIEAERTPQFLRYLFPNGALDLNLQ
Ga0192826_1024065113300019051MarineTWGNIRLINKMKNFVIAALLGLVASSQVEAAKDQVIGHRARLAILNNLIQIEEGSDSESDDDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVEGKLTGTMMLNLEDAKALAAEVKETHKDMGYYKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0192826_1029555013300019051MarineGHKKRLAILDNLIQMEEGSESDSESEDENVQLKGDDYGEVPAYMDGADTTGGYERVIPARFEEERDDRLMNSIIKNYAREIKYKGSLTGVMMLNVDDACSLAAEVKSTHKGMGYAQQADAMSCADAFNHFDVNHDGLIEAERGPQFLRYLYPMGALDIDLQ
Ga0192826_1031408113300019051MarineILDNLIQMEEGSESDSESEDENVQLKGDDYGEVPAYMDGADTTGGYERVIPARFEEERDDRLMNSIIKNYAREIKYKGSLTGVMMLNVDDACSLAAEVKSTHKGMGYAQQADAMSCADAFNHFDVNHDGLIEAERGPQFLRYLYPMGALDIDLQ
Ga0192826_1032039813300019051MarineLNNLIQLGEGSESDSDSEDENVQLGGDYGEVPAYMDGADTSGGYERAMPARFSEERDDRLMNSIIGNYAREIKYKGKLTGVMMLNLDDTRALVAEVNRTHKGFGYGVNPEQISVEDAFNHFDVNHDGLVEAERVPQLLRYLNPNGALDIEL
Ga0188866_102550613300019095Freshwater LakeFVIAALLGLAAASQVETTNEVIGHKKRLAILNNLIQLDEGSDSDSEDELVQTKKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVVGAYAREIKVNGSLTGVMMLNVNDACALASEVIRTHKGMGYAQNEQMSCADAFNHFDVNKDGLIEAERAPQYLRYMLPNSALDIDLQ
Ga0193153_102082213300019097MarineDIRLKNKMKNFVIAALLGLVASSQVEVAKEQIIGHRARLAILNNLIQIEEGSDSESDEDQNIQLKGDDYAEVPAFMNKSDAHGGYKRVVPDRFTEERDDQLMESVIEKYAREIKVEGKLTGTMMLNLEDAKALAAEVLSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDIDLQ
Ga0194243_100399313300019102MarineMKNFVIAALLGLVSSSQVEAQHELIGHRARLAILNNLIQIEEGSDSESSDDDENVQLRGDDYAEVPAYMDKSEAAGGYKRVVPERFSEERDDLLMESVIKKYAREIKVEGKLTGTMMLNLEDAKALAAEVLGSHKSMGYSQQVDAMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIDLQ
Ga0194243_100673313300019102MarineHKARLAILNNLIQIEEGSDSESEEDENLQLKGDDYAEVPAYMDKSDAAGGYKRVVPDRFTEERDDQLMESVIKKYAREIKVEGKLTGVMMLNLEDAKALAAEVLGSHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIDLQ
Ga0192972_106960223300019108MarineKYFAISALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193054_107595613300019117MarineEVIGHRARLAILNNLIQIEEGSESDSEEDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVKSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPNGALDIALQ
Ga0192980_107040313300019123MarineGNIRLINKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0193436_105995313300019129MarineAQHELIGHRARLAILNNLIQIEEGSDSESSDEEENVMLRGDDYAEVPAYMDKSEAAGGYKRVVPERFSEERDDLLMESVIKKYAREIKVEGKLTGTMMLNLEDAKALAAEVLGSHKSMGYSQQVDAMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIDLQ
Ga0188870_1010415613300019149Freshwater LakeMKFVIAALLGLAAASQVETTNEVIGHKKRLAILNNLIQLDEGSDSDSEDELVQTKKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVVGAYAREIKVNGSLTGVMMLNVNDACALASEVIRTHKGMGYAQNEQMSCADAFNHFDVNKDGLIEAERAPQYLRYMLPNSALDIDLQ
Ga0194244_1003629913300019150MarineWGNIRLINKMKNFVIAALLGLVASSQVEVAKDQIIGHKARLAILNNLIQIEEGSDSESEEDENLQLKGDDYAEVPAYMDKSDAAGGYKRVVPDRFTEERDDQLMESVIKKYAREIKVEGKLTGVMMLNLEDAKALAAEVLGSHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIDLQ
Ga0194244_1003661113300019150MarineMKNFVIAALLGLVSSSQVEAQHELIGHRARLAILNNLIQIEEGSDSESSDDDENVQLRGDDYAEVPAYMDKSEAAGGYKRVVPERFSEERDDLLMESVIKKYAREIKVEGKLTGTMMLNLEDAKALAAEVLGSHKSMGYSQQVDMMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIDLQ
Ga0194244_1006216913300019150MarineMKNFVIAALLGLVSSSQVEAQHELIGHRARLAILNNLIQIEEGSDSESSDDDENVQLRGDDYAEVPAYMDKSEAAGGYKRVVPERFSEERDDLLMESVIKKYAREIKVEGKLTGTMMLNLEDAKALAAEVRGSHKSMGYSQQVDGMSVEDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIDLQ
Ga0182044_144898613300020014Salt MarshAILGLVTFSQVESVQCEFVGHKKRLAILNTLIQHAEGSDSDSDSDEHENVMLRGDDYGEVPAYMDGADTAGGYKRVIPDRFSEERDDLLMESVIEKYAREIKVKGKLTGVMMLNLDDAKALAAEVLSTHKSMGYSQQTDAMSVEDAFNHFDVNHDGLIEAERAPQFLRYLYPNGALDI
Ga0206687_155686013300021169SeawaterNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0206696_135526213300021334SeawaterSSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDIFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0206692_132157013300021350SeawaterAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0063132_10793813300021872MarineFVIAALLGLVSSSQVEAQHELIGHRARLAILNNLIQIEEGSDSESSDEDENVQLRGDDYGEVPAYMDKSEAAGGYKRVVPERFSEERDDLLMESVIKKYAREIKVEGKLTGTMMLNLDDAKALAAEVLGSHKSMGYSQQVDRMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0063132_13219113300021872MarineAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQ
Ga0063137_106151413300021892MarineKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDITLQ
Ga0063136_101519313300021896MarineNKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAYMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAHTILEIPLPTGCSRYLSPMST
Ga0063135_100955013300021908MarineDLKNKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0063135_101177313300021908MarineLKMKNFVIAALLGLVASSQVEVAKDQVIGHRSRLAILNNLIQIEEGSDSESEEESNVQLKKCDDCYGEVPAFMNKSDAHGGYLRVVPDRFAEERDDQLMESIIEKYAREIKVNGKLTGTMMLNLDDAKALAAEVFSTHKDMGYYKQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLYPQGALDIDLQ
Ga0063135_102712913300021908MarineSAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAYMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKSMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0063133_101624913300021912MarineLVIAALFGLVTYTQIESVQCEEYIGHKKRWAILNNLIQIGEGSESDSDDSDEENVQISKNDYGEVPAYMDEADTAGGYTRVVPDRFTEERDDRLMNSVIGKYAREIKVKGKLTGVMMLNLEDATALANEVKSTHKGMGYAQQADAMSTADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDL
Ga0063133_102404613300021912MarineCEEHVGHKKRLAILNNLIQIEEGSESDSDDESDEDVQLKGDYGEVPAYMDEADTAGGYKRDMPERFTEERDDRLMNSVIGKYAREIKIKGKLTGVMMLNAEDASALADEVRRTHKGMGYSQQADGMSAADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDLQ
Ga0063139_103384613300021934MarineKNKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAQALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDITLQ
Ga0247581_107797513300026420SeawaterIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0247559_107668213300026443SeawaterNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0247559_110917913300026443SeawaterNKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0247578_108267713300026458SeawaterNFVIAALLGLVTFSQVETAQCEVIGHKARLAILNNLIQIEEGSESDSEEDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPNGALDIALQ
Ga0247578_112042913300026458SeawaterLLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGA
Ga0247600_107151613300026461SeawaterKNKMKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0247603_107536013300026468SeawaterKMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0247603_110224313300026468SeawaterVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0247599_108811213300026470SeawaterKNFVIAALLGLVASSQVEVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0247599_109743813300026470SeawaterKNFVIAALLGLVTFSQVETAQCEVIGHKARLAILNNLIQIEEGSESDSEEDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPNGALDIALQ
Ga0247571_108847113300026495SeawaterKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0247584_114520513300028110SeawaterVAKNQVIGHRARLAILNNLIQIEEGSDSESDEEENLQLKGDDDYSEVPAFMNKSDCHGGYNRVVPDRFAEERDDQLMESVIEKYAREIKVAGKLTGTMMLNLEDAKALAAEVKSTHKDMGYYKQVDAMSVDDAFNHFDVNHDGLIEAERAPQFLRYLYPQGALDISLQ
Ga0256412_122078813300028137SeawaterAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAFMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDL
Ga0256412_124745713300028137SeawaterKNFAIAALLGLVAFSQVESVQCEEFIGHKKRLAILDNLIQIEEGSESDSDSEEENVQLKGDYGEVPAYMDGADTAGGYSRAMPARFTEERDDRLMNSIVGNYAREIKVKGALTGVMMLNLADATALAAEVKRTHKGMGYESQNGMSVADAFNHFDVNKDGLIEAERTPQFLRYLFPNGALDIDLQ
Ga0256412_130467813300028137SeawaterIAALLGLVAASQVESTNEVIGHKKRLAILNNLIQIDEGSDSDSDDELVQTEKCKDCYGEVPAYMDGADTAGGYERVVPDRFTEERDDRLMNSVNANYAREIKVNGKLTGVMMMNVDDACALAAEVRRTHNGKMGYAQNEDMSCQDAFNHFDVNKDGLFEAERAPQYLRYMFPNGALDIDL
Ga0256417_115587213300028233SeawaterIAALLGLVTFSQVETAQCEVIGHKARLAILNNLIQIEEGSESDSEEDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPNGALDIAL
Ga0256417_120201213300028233SeawaterELIGHKKRLAILNNLIQIEEGSESDSDSDNEMVQTQKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVVGNYAREIKVNGKLTGTMMLNLEDACALAAEVRRTHNGKMGYAVNEGMSCADAFNHFDVNHDGLIEAERAPQYVRYMFPNGALDIDLQ
Ga0256413_127966413300028282SeawaterLVAASQVESTNEVIGHKKRLAILNNLIQIDEGSDSDSDDELVQTEKCKDCYGEVPAYMDGADTAGGYERVVPDRFTEERDDRLMNSVNANYAREIKVNGKLTGVMMMNVDDACALAAEVRRTHNGKMGYAQNEDMSCQDAFNHFDVNKDGLFEAERAPQYLRYMFPNGALDIDLQ
Ga0256413_136637513300028282SeawaterVTFSQVETAQCEVIGHKARLAILNNLIQIEEGSESDSEEDENVQLKGDDYAEVPAYMNKSDAHGGYKRVVPERFTEERDDQLMESVIEKYAREIKVQGKLTGTMMLNLEDAKALAAEVRSTHKDMGYDKQVDAMSVEDAFNHFDVNHDGLIEAERCPQFLRYLYPNG
Ga0247572_108620913300028290SeawaterNKMKNFVIAAILGLVTFSQVESAQCEFVGHKKRLAILNNLIQLEESESDSDSEDQKNVQLRGDDYGEVPAYMDGADTAGGYKRVVPERFSEERDDLLMESIIEKYAREIKVQGKLTGVMMLNLDDAKALAAEVLGSHKAMGYSQQTDGMSVEDAFNHFDVNHDGLIEAERTPQFLRYLYPNGALDIDLQ
Ga0304731_1068038213300028575MarineFVIAALLGLVAVSQVESVQCEVIGHKKRLAILNNLIQLGEGSESDSDSEDENVQLRGDDYGEVPAYMDGADTSGGYERKMPARFDEERDDRLMNSIVANYAREIKYKGKLTGVMMLNLDDARALVAEVNRTHKGYGYGVNPEQMSVEDAFNHFDVNHDGLIEAERTPQFLRYLNPNGALDIDLQ
Ga0307398_1054490413300030699MarineNKMKYFAIAALLGLVSSAQVEATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGSDDYAEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIEGKLTGTMMLNLEDAKALAAEVKGSHKAMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0073980_1108065613300031032MarineYSQVESVQCEEFVGHKKRLAILNNLIQIEEGSESDSDEESDEDVQLKGDYGEVPAYMDKADTAGGYKRDMPDRFTEERDDRLMNSVIGNYAREIKIKGKLTGVMMLNLEDATALADEVRRTHKGMGYSQQADGMSVADAFNHFDVNHDGLVEAERMPQFLRYLFPNGALDIDLQ
Ga0307381_1026512613300031725MarineKYFAIAALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFPQGALDIALQ
Ga0307382_1058336113300031743MarineALLGLVSSAQVDATHESIGHKTRLAILNNLIQIEEGSDSESEEETNVQVRGCDDCYGEVPAFMDKSDAAGGYNRVVPDRFVEERDDQLMESVIEKYAREIKIDGKLTGTMMLNLEDAKALAAEVKGSHKSMGYSAQVDGMSVDDAFNHFDVNHDGLIEAERCPQFLRYLFP
Ga0314711_1061552713300032732SeawaterQVETTNEVIGHKKRLAILNNLIQLDEGSDSDSEDELVQTKKCDDCYGEVPAYMDKSDAAGGYKREMPARFDEERDDRLMNSVVGAYAREIKVNGSLTGVMMLNVNDACALASEVIRTHKGMGYAQNEQMSCADAFNHFDVNKDGLIEAERAPQYLRYMLPNSALDIDLQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.