| Basic Information | |
|---|---|
| Family ID | F047680 |
| Family Type | Metagenome |
| Number of Sequences | 149 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 72.92 % |
| % of genes near scaffold ends (potentially truncated) | 24.16 % |
| % of genes from short scaffolds (< 2000 bps) | 71.81 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (62.416 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.450 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.322 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF04760 | IF2_N | 7.38 |
| PF06067 | DUF932 | 6.04 |
| PF02467 | Whib | 4.03 |
| PF00072 | Response_reg | 0.67 |
| PF00011 | HSP20 | 0.67 |
| PF01551 | Peptidase_M23 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.60 % |
| Unclassified | root | N/A | 9.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000268|M3P_10067980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300000756|JGI12421J11937_10084459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300000756|JGI12421J11937_10145168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300000882|FwDRAFT_10097261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300001282|B570J14230_10169809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300002140|M2t2FKB2_1239710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5499 | Open in IMG/M |
| 3300002144|M2t2BS2_10251544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5636 | Open in IMG/M |
| 3300002144|M2t2BS2_10525582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Egibacterales → Egibacteraceae → Egibacter → Egibacter rhizosphaerae | 570 | Open in IMG/M |
| 3300002351|B570J29582_1022159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300002408|B570J29032_109722004 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300002835|B570J40625_100016269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12958 | Open in IMG/M |
| 3300002835|B570J40625_100089597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3893 | Open in IMG/M |
| 3300002835|B570J40625_100092372 | All Organisms → Viruses → Predicted Viral | 3805 | Open in IMG/M |
| 3300002835|B570J40625_100147736 | All Organisms → Viruses → Predicted Viral | 2695 | Open in IMG/M |
| 3300002835|B570J40625_100326307 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300002835|B570J40625_100913861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300003277|JGI25908J49247_10021465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1916 | Open in IMG/M |
| 3300003411|JGI25911J50253_10167319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300003412|JGI25912J50252_10003460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5373 | Open in IMG/M |
| 3300004112|Ga0065166_10147062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300004240|Ga0007787_10172934 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300005527|Ga0068876_10134079 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300005527|Ga0068876_10202682 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300005527|Ga0068876_10588049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300005805|Ga0079957_1040530 | All Organisms → Viruses → Predicted Viral | 2959 | Open in IMG/M |
| 3300005941|Ga0070743_10141279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300006484|Ga0070744_10003014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5078 | Open in IMG/M |
| 3300006484|Ga0070744_10036199 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300006484|Ga0070744_10133559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300006484|Ga0070744_10244695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300006639|Ga0079301_1017843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2518 | Open in IMG/M |
| 3300007547|Ga0102875_1136927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300007560|Ga0102913_1300889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300007600|Ga0102920_1190603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300007606|Ga0102923_1031392 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
| 3300007629|Ga0102895_1055425 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300007630|Ga0102903_1126580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300007644|Ga0102902_1041906 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300007973|Ga0105746_1213830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300008107|Ga0114340_1159608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300008107|Ga0114340_1261067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300008110|Ga0114343_1032840 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
| 3300008110|Ga0114343_1065469 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300008111|Ga0114344_1006370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12672 | Open in IMG/M |
| 3300008113|Ga0114346_1046642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
| 3300008113|Ga0114346_1248187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300008261|Ga0114336_1082118 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300008262|Ga0114337_1350026 | Not Available | 503 | Open in IMG/M |
| 3300009059|Ga0102830_1088981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300009152|Ga0114980_10300197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300009155|Ga0114968_10177296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
| 3300009165|Ga0105102_10254422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300009419|Ga0114982_1013858 | All Organisms → Viruses → Predicted Viral | 2787 | Open in IMG/M |
| 3300009419|Ga0114982_1022231 | All Organisms → Viruses → Predicted Viral | 2102 | Open in IMG/M |
| 3300009419|Ga0114982_1151038 | Not Available | 717 | Open in IMG/M |
| 3300012663|Ga0157203_1001038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7118 | Open in IMG/M |
| 3300012663|Ga0157203_1005741 | All Organisms → Viruses → Predicted Viral | 2339 | Open in IMG/M |
| 3300012663|Ga0157203_1007602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1922 | Open in IMG/M |
| 3300012663|Ga0157203_1011899 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300012663|Ga0157203_1022590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300013004|Ga0164293_10566912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300013004|Ga0164293_10940379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300014962|Ga0134315_1023443 | Not Available | 958 | Open in IMG/M |
| 3300017723|Ga0181362_1015456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
| 3300017723|Ga0181362_1024026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
| 3300017723|Ga0181362_1025315 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300017736|Ga0181365_1124577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300020141|Ga0211732_1059744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4514 | Open in IMG/M |
| 3300020141|Ga0211732_1151451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300020141|Ga0211732_1330720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| 3300020141|Ga0211732_1370027 | All Organisms → Viruses → Predicted Viral | 2283 | Open in IMG/M |
| 3300020141|Ga0211732_1373359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8113 | Open in IMG/M |
| 3300020151|Ga0211736_11000731 | All Organisms → Viruses → Predicted Viral | 4547 | Open in IMG/M |
| 3300020160|Ga0211733_10684109 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300020161|Ga0211726_10138163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300020162|Ga0211735_10333694 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300020172|Ga0211729_10234608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300020489|Ga0207910_102946 | All Organisms → Viruses → Predicted Viral | 1980 | Open in IMG/M |
| 3300020506|Ga0208091_1013938 | Not Available | 970 | Open in IMG/M |
| 3300020527|Ga0208232_1008388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1640 | Open in IMG/M |
| 3300020530|Ga0208235_1012403 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300020549|Ga0207942_1041977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300020560|Ga0208852_1000766 | Not Available | 8662 | Open in IMG/M |
| 3300020571|Ga0208723_1032436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300021952|Ga0213921_1001278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6705 | Open in IMG/M |
| 3300021960|Ga0222715_10619027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300021961|Ga0222714_10035101 | All Organisms → Viruses → Predicted Viral | 3670 | Open in IMG/M |
| 3300021961|Ga0222714_10042275 | All Organisms → Viruses → Predicted Viral | 3250 | Open in IMG/M |
| 3300021962|Ga0222713_10308020 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300021963|Ga0222712_10671452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300021963|Ga0222712_10734373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300022407|Ga0181351_1133272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300024343|Ga0244777_10013091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5237 | Open in IMG/M |
| 3300024346|Ga0244775_10274268 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
| 3300024346|Ga0244775_11019826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300024348|Ga0244776_10305343 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300024348|Ga0244776_10398702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
| 3300027114|Ga0208009_1011058 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
| 3300027387|Ga0208311_1116453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300027571|Ga0208897_1135393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300027608|Ga0208974_1005724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4254 | Open in IMG/M |
| 3300027608|Ga0208974_1169628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027659|Ga0208975_1035218 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
| 3300027679|Ga0209769_1173885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300027710|Ga0209599_10003639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5850 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1327894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027797|Ga0209107_10041189 | All Organisms → Viruses → Predicted Viral | 2631 | Open in IMG/M |
| 3300027804|Ga0209358_10095772 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300027808|Ga0209354_10401724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300028025|Ga0247723_1016312 | All Organisms → Viruses → Predicted Viral | 2632 | Open in IMG/M |
| 3300028025|Ga0247723_1037439 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300028025|Ga0247723_1043457 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300028025|Ga0247723_1092184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300028027|Ga0247722_10196339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300028027|Ga0247722_10204230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1192862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300028394|Ga0304730_1160945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300031787|Ga0315900_10765861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300031787|Ga0315900_11133080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300031963|Ga0315901_10513597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300031963|Ga0315901_11134220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300032050|Ga0315906_10726234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300032093|Ga0315902_10966226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300033992|Ga0334992_0021519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3988 | Open in IMG/M |
| 3300033992|Ga0334992_0104629 | Not Available | 1508 | Open in IMG/M |
| 3300033993|Ga0334994_0063802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2254 | Open in IMG/M |
| 3300033993|Ga0334994_0141328 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300033993|Ga0334994_0311936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300033994|Ga0334996_0002935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11686 | Open in IMG/M |
| 3300033994|Ga0334996_0007796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7202 | Open in IMG/M |
| 3300033995|Ga0335003_0319186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300033996|Ga0334979_0010987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6216 | Open in IMG/M |
| 3300033996|Ga0334979_0442346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300033996|Ga0334979_0564639 | Not Available | 608 | Open in IMG/M |
| 3300034018|Ga0334985_0122474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1807 | Open in IMG/M |
| 3300034018|Ga0334985_0447775 | Not Available | 759 | Open in IMG/M |
| 3300034022|Ga0335005_0162254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
| 3300034062|Ga0334995_0485123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300034082|Ga0335020_0495026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300034102|Ga0335029_0293959 | Not Available | 1028 | Open in IMG/M |
| 3300034104|Ga0335031_0007271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8183 | Open in IMG/M |
| 3300034104|Ga0335031_0158154 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300034122|Ga0335060_0299515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300034356|Ga0335048_0187237 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.07% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.38% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.04% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.37% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.03% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.03% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.68% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.01% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 2.01% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.67% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.67% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.67% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.67% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.67% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002140 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f) | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002351 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020489 | Freshwater microbial communities from Lake Mendota, WI - 21JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_100679802 | 3300000268 | Lotic | MKGHTHTMAKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL* |
| JGI12421J11937_100844594 | 3300000756 | Freshwater And Sediment | MAQMKTIEMILMEAHPSGIFNEQDVWEAIAEATGMDYSEIADGDLTEWL* |
| JGI12421J11937_101451681 | 3300000756 | Freshwater And Sediment | MSKMKDLYGILTEWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLAEYL* |
| FwDRAFT_100972611 | 3300000882 | Freshwater And Marine | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLTEWL* |
| B570J14230_101698091 | 3300001282 | Freshwater | LYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL* |
| M2t2FKB2_12397104 | 3300002140 | Marine | MSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNEREYYEDGDLAEWL* |
| M2t2BS2_1025154416 | 3300002144 | Marine | MSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNEREYYEDGDLTNWL* |
| M2t2BS2_105255821 | 3300002144 | Marine | MSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNEREYYEDGDLSEWL* |
| B570J29582_10221591 | 3300002351 | Freshwater | MSKMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIAD |
| B570J29032_1097220041 | 3300002408 | Freshwater | GILTEWYPDGNYTEEQLWEAIAESQGMDYAEIADGDLAEWL* |
| B570J40625_1000162692 | 3300002835 | Freshwater | MSKMKDLYGILTEWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| B570J40625_1000895972 | 3300002835 | Freshwater | MSKMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL* |
| B570J40625_1000923727 | 3300002835 | Freshwater | MAMMKTIEMILMENHPDGIYNEDDVWEAIAEANGMDYSEIADGDLTEWL* |
| B570J40625_1001477362 | 3300002835 | Freshwater | MAKMKTVEIVLMENHPDGVYTEADVWEAIAEAHGLDYSEIADGDLAEWL* |
| B570J40625_1003263076 | 3300002835 | Freshwater | MSQMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYAEIADGDLAEWL* |
| B570J40625_1009138612 | 3300002835 | Freshwater | MAKIKTVEIVLMENHPDGVYTEDDVWEAIAEAHGLDYSEIADGDLAEWL* |
| JGI25908J49247_100214653 | 3300003277 | Freshwater Lake | MAKMKTLDMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLTEWL* |
| JGI25911J50253_101673192 | 3300003411 | Freshwater Lake | MSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNERDYYEDGDLAEWL* |
| JGI25912J50252_100034601 | 3300003412 | Freshwater Lake | MAKMKTLEMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLTEWL* |
| Ga0065166_101470622 | 3300004112 | Freshwater Lake | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL* |
| Ga0007787_101729343 | 3300004240 | Freshwater Lake | MGKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL* |
| Ga0068876_101340794 | 3300005527 | Freshwater Lake | MAKMKTIEMILMENHPNGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL* |
| Ga0068876_102026824 | 3300005527 | Freshwater Lake | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0068876_105880491 | 3300005527 | Freshwater Lake | MKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL* |
| Ga0049080_101622202 | 3300005582 | Freshwater Lentic | MKGHTHTMAKMKTIEMILMENHPDGNFNEQDLWEAIAEADGYQRDYYEDGDLAEWL* |
| Ga0079957_10405302 | 3300005805 | Lake | MSKMKDLYGILTEWYPDGVYTEEQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0070743_101412794 | 3300005941 | Estuarine | MSKMKDLYGILTEWFPDGVYNEEQLWEAIAESQGMDYSEIADGDLAEYL* |
| Ga0070744_100030143 | 3300006484 | Estuarine | MSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNEREYYEDGDLTEWL* |
| Ga0070744_100361993 | 3300006484 | Estuarine | MAKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL* |
| Ga0070744_101335592 | 3300006484 | Estuarine | MAKMKTIEMILMENHPNGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL*NYLKRNQK* |
| Ga0070744_102446952 | 3300006484 | Estuarine | MAKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLTEWL* |
| Ga0079301_10178434 | 3300006639 | Deep Subsurface | MAMMKTIEMILMENHPNGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL* |
| Ga0079301_11821872 | 3300006639 | Deep Subsurface | MKGHTHTMAKMKTIEMILMENHPDGIFNEQDLWEAIAEADGNKLDYYEDGDITEWL* |
| Ga0102875_11369274 | 3300007547 | Estuarine | MSKMKDLYGILTEWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLTEWL* |
| Ga0102913_13008893 | 3300007560 | Estuarine | MSQMKDLYGILTEWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLTEWL* |
| Ga0102920_11906033 | 3300007600 | Estuarine | WKGICIMSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLTEWL* |
| Ga0102923_10313921 | 3300007606 | Estuarine | DLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLTEWL* |
| Ga0102895_10554251 | 3300007629 | Estuarine | KDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLTEWL* |
| Ga0102903_11265801 | 3300007630 | Estuarine | KMKDLYGILTEWFPDGVYNEQQLWEAIAESQGMDYAEIADGDLTEWL* |
| Ga0102902_10419065 | 3300007644 | Estuarine | VMAKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLTEWL* |
| Ga0105746_12138302 | 3300007973 | Estuary Water | MAKMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0114340_11596084 | 3300008107 | Freshwater, Plankton | MSKMKDLYGILTEWYPDGNYNEQQLWEAIGEANGMDYSEIADGDLAEWL* |
| Ga0114340_12610671 | 3300008107 | Freshwater, Plankton | FILWKGICIMSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0114343_10328401 | 3300008110 | Freshwater, Plankton | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIA |
| Ga0114343_10654693 | 3300008110 | Freshwater, Plankton | MAKMKTIEMILMENHPNGIYNEDDVWEAIAEANGMDYSEIADGDLTEWL* |
| Ga0114344_100637022 | 3300008111 | Freshwater, Plankton | MAKMKDLYGILTEWFPDGNYTEEQLWEAIAESQGMDYAEIADGDLAEWL* |
| Ga0114346_10466427 | 3300008113 | Freshwater, Plankton | MAKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL* |
| Ga0114346_12481872 | 3300008113 | Freshwater, Plankton | MAKMKDLYGILTEWFPDGVYTEEQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0114336_10821183 | 3300008261 | Freshwater, Plankton | MSKMKDLYGILTEWFPDGVYNEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0114337_13500262 | 3300008262 | Freshwater, Plankton | MSKMKDLYGILTEWYPDGNYKEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0102829_11515894 | 3300009026 | Estuarine | VWRCVCIMAKMKSIEVILMENHPDGNYNEQDLWEAIAEADGYQREYYADGDLAEWL* |
| Ga0102830_10889812 | 3300009059 | Estuarine | MSKMKDLYGILTEWFPDGVYNEEQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0114980_103001972 | 3300009152 | Freshwater Lake | MQNEKDLYSILTEWFPDGNYNEQQLWDAIAESQGMDYAEIADGDLAEWL* |
| Ga0114968_101772962 | 3300009155 | Freshwater Lake | MSKMKDLYGILTEWYPYGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0105102_102544223 | 3300009165 | Freshwater Sediment | MAKMKTIEMILMENHPSGIYNEDDVWEAIAEATGMDYSEIADGDLAEWL* |
| Ga0114982_10138588 | 3300009419 | Deep Subsurface | MAKMKTVEIVLMENHPDGVYTEDDVWEAIAEAHGLDYSEIADGDLAEWL* |
| Ga0114982_10222314 | 3300009419 | Deep Subsurface | MGKMKTVEMILSEWHPDGIYNEQDVWEAIAEANGMDYSEIADGDLAEWL* |
| Ga0114982_11510382 | 3300009419 | Deep Subsurface | VSNTKRHLEEILSEWYPDGNYNEDDVWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0157203_10010388 | 3300012663 | Freshwater | MAQMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL* |
| Ga0157203_10057415 | 3300012663 | Freshwater | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLTEWL* |
| Ga0157203_10076028 | 3300012663 | Freshwater | MAKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLTEWL* |
| Ga0157203_10118991 | 3300012663 | Freshwater | YGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL* |
| Ga0157203_10225903 | 3300012663 | Freshwater | MAKMKTVEIVLMENHPDGIYTEADVWEAIAEAHGLDYSEIADGDLAEWL* |
| Ga0164293_105669121 | 3300013004 | Freshwater | EWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLAEWL* |
| Ga0164293_109403792 | 3300013004 | Freshwater | MAKMKTVEMVLMENHPDGVYTEDDVWEAIAEAHGLDYSEIADGDLAEWL* |
| Ga0177922_107933794 | 3300013372 | Freshwater | MAMMKTIEMILIENHPDGIFNEQDLWEAIAEADGHQRDYYEDGDITEWL* |
| Ga0134315_10234431 | 3300014962 | Surface Water | KPMNYWDILKEWGIENPTEEDVWEAIAEARGVDYSDIADGDLGEWL* |
| Ga0181362_10154561 | 3300017723 | Freshwater Lake | MSKMKDLYGILAEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL |
| Ga0181362_10240264 | 3300017723 | Freshwater Lake | MAKMKTLDMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLTEWL |
| Ga0181362_10253151 | 3300017723 | Freshwater Lake | MKGHTHTMAKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNERDYYEDGDLAEWL |
| Ga0181365_11245771 | 3300017736 | Freshwater Lake | VRPLPTTMKGHTHTMAKMKTLDMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLTEWL |
| Ga0211732_10597442 | 3300020141 | Freshwater | MAKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL |
| Ga0211732_11514513 | 3300020141 | Freshwater | MSKMKDLYGILTEWYPDGVYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0211732_13307203 | 3300020141 | Freshwater | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0211732_13700279 | 3300020141 | Freshwater | MGKMKTLEMILFECYPDGNYTEDDLWQAIAELNGMDYSEIA |
| Ga0211732_13733598 | 3300020141 | Freshwater | MAKMKTLEMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLAEWL |
| Ga0211736_110007315 | 3300020151 | Freshwater | MSKMKDLYGILTEWFPDGVYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0211733_106841094 | 3300020160 | Freshwater | MGKMKTLEMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLAEWL |
| Ga0211726_101381631 | 3300020161 | Freshwater | MAKMKTLEMILFECYPDGNYTEDDLWQAIAELNGMDYSEIADGDLAEWL |
| Ga0211735_103336944 | 3300020162 | Freshwater | MGKMKTLEMILFECYPDGNYTEDDLWQAIAELNGMDYSEIADGDLAEWL |
| Ga0211729_102346081 | 3300020172 | Freshwater | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMEYSEIADGDLAEWL |
| Ga0207910_1029467 | 3300020489 | Freshwater | MAKMKTVEIVLMENHPDGVYTEADVWEAIAEAHGLDYSEIADGDLAEWL |
| Ga0208091_10139382 | 3300020506 | Freshwater | MSKMKDLYGILTEWYPDGVYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0208232_10083887 | 3300020527 | Freshwater | MSKMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDL |
| Ga0208235_10124034 | 3300020530 | Freshwater | MSKMKDLYGILTEWYPDGNYTEQQLWEAIAKSQGMDYSEIADGDLAEWL |
| Ga0207942_10419771 | 3300020549 | Freshwater | MSKMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYAEIADGDLAEWL |
| Ga0208852_100076622 | 3300020560 | Freshwater | MAMMKTIEMILMENHPDGIYNEDDVWEAIAEANGMDYSEIADGDLTEWL |
| Ga0208723_10324361 | 3300020571 | Freshwater | MSQMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYAEIADGDLAEWL |
| Ga0213921_100127810 | 3300021952 | Freshwater | MSYTKRALEEILMEWYPDGNYTESQLWEAIAEADGWERDYYEDGDLTEWL |
| Ga0222715_106190273 | 3300021960 | Estuarine Water | MAMMKTIEMILMENHPNGIYNEDDVWEAIAEATGMDYSEIADGDLAEWL |
| Ga0222714_100351014 | 3300021961 | Estuarine Water | MSKMKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0222714_100422759 | 3300021961 | Estuarine Water | MAKMKTIEMILMENHPDGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL |
| Ga0222713_103080204 | 3300021962 | Estuarine Water | MGKMKTVEMILSEWFPDGKYNEDDVWEAIAEANGMDYSEIADGDLAEWL |
| Ga0222712_106714522 | 3300021963 | Estuarine Water | TEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0222712_107343732 | 3300021963 | Estuarine Water | MGQMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL |
| Ga0181351_11332722 | 3300022407 | Freshwater Lake | MAKMKTLEMILFESYPDGNYTEDDLWQAIAELNGVDYSEIADGDLTEWL |
| Ga0244777_100130916 | 3300024343 | Estuarine | MAKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLTEWL |
| Ga0244775_102742682 | 3300024346 | Estuarine | MSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNEREYYEDGDLTEWL |
| Ga0244775_110198264 | 3300024346 | Estuarine | MSKMKDLYGILTEWFPDGVYNEEQLWEAIAESQGMDYSEIADGDLAEYL |
| Ga0244776_103053432 | 3300024348 | Estuarine | MSKMKDLYGILTEWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLTEWL |
| Ga0244776_103987022 | 3300024348 | Estuarine | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLTEWL |
| Ga0208009_10110581 | 3300027114 | Deep Subsurface | GNGIMAMMKTIEMILMENHPNGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL |
| Ga0208311_11164531 | 3300027387 | Estuarine | ICIMSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLTEWL |
| Ga0208897_11353934 | 3300027571 | Estuarine | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEYL |
| Ga0208974_100572411 | 3300027608 | Freshwater Lentic | MKGHTHTMAKMKTIEMILMENHPDGNFNEQDLWEAIAEADGYQRDYYEDGDLAEWL |
| Ga0208974_11696281 | 3300027608 | Freshwater Lentic | ILMEAHPSGIFNEQDVWEAIAEATGMDYSEIADGDLTEWL |
| Ga0208975_10352184 | 3300027659 | Freshwater Lentic | MSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL |
| Ga0209769_11738851 | 3300027679 | Freshwater Lake | LLQRGTSIMSKMKDLYGILAEWYPDGVYTEQQLWEAIAEADGNERDYYEDGDLAEWL |
| Ga0209599_100036398 | 3300027710 | Deep Subsurface | MGKMKTVEMILSEWHPDGIYNEQDVWEAIAEANGMDYSEIADGDLAEWL |
| (restricted) Ga0247836_13278942 | 3300027728 | Freshwater | MGKMKTIEMILMENHPDGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL |
| Ga0209107_100411895 | 3300027797 | Freshwater And Sediment | MAQMKTIEMILMEAHPSGIFNEQDVWEAIAEATGMDYSEIADGDLTEWL |
| Ga0209358_100957723 | 3300027804 | Freshwater Lake | MGKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL |
| Ga0209354_104017241 | 3300027808 | Freshwater Lake | MAKMKTLEMILFESYPDGNYTEDDLWQAIAELNGMDYSEIADGDLAEWL |
| Ga0247723_10163126 | 3300028025 | Deep Subsurface Sediment | MAKMKDLYGILTEWFPDGVYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0247723_10374393 | 3300028025 | Deep Subsurface Sediment | MAKMKTIEMILMENHPDGIFNEDDVWEAIAEATGMDYSEIADGDLAEWL |
| Ga0247723_10434571 | 3300028025 | Deep Subsurface Sediment | MAKMKTVQMILSEWFPDGKYNEDDVWEAIAEANGMDYSEIADGDLSEWL |
| Ga0247723_10921843 | 3300028025 | Deep Subsurface Sediment | MAKMKDLYGILTEWFPDGVYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0247722_101963391 | 3300028027 | Deep Subsurface Sediment | VMSKMKDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0247722_102042302 | 3300028027 | Deep Subsurface Sediment | MGKMKSIEMILSEWYPDGNYNEDQLWEAIAEANGMDYSEIADGDLAEWL |
| (restricted) Ga0247835_11928621 | 3300028114 | Freshwater | GVMGKMKTIEMILMENHPDGIYNEDDVWEAIAEANGMDYSEIADGDLAEWL |
| Ga0304730_11609454 | 3300028394 | Freshwater Lake | MSKMKDLYGILTEWYPYGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0315900_107658611 | 3300031787 | Freshwater | IMAKMKTLEMILFECYPDGNYTEDDLWQAIAELNGMDYSEIADGDLAEWL |
| Ga0315900_111330803 | 3300031787 | Freshwater | AKMKTLEMILFECYPDGNYTEDDLWQAIAELNGMDYSEIADGDLAEWL |
| Ga0315901_105135971 | 3300031963 | Freshwater | ILFECYPDGNYTEDDLWQAIAELNGMDYSEIADGDLAEWL |
| Ga0315901_111342201 | 3300031963 | Freshwater | MSKMKDLYGILTEWFPDGVYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0315906_107262344 | 3300032050 | Freshwater | GILTEWFPDGVYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0315902_109662264 | 3300032093 | Freshwater | KDLYGILTEWYPDGNYNEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0334992_0021519_2655_2804 | 3300033992 | Freshwater | MAKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLTEWL |
| Ga0334992_0104629_688_837 | 3300033992 | Freshwater | MAKMKTIEMILMENHPDGIFNEQDLWEAIAEADGNKLDYYEDGDITEWL |
| Ga0334994_0063802_1139_1279 | 3300033993 | Freshwater | MKDLYGILTEWYPDGNYTEQQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0334994_0141328_1255_1365 | 3300033993 | Freshwater | WYPDGNYNEQQLWEAIAESQGMDYAEIADGDLAEWL |
| Ga0334994_0311936_124_264 | 3300033993 | Freshwater | MKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0334996_0002935_5635_5784 | 3300033994 | Freshwater | MAQMKTIEMVLMENHPDGIYNEQDVWEAIAESQGLDYSEIADGDLAEWL |
| Ga0334996_0007796_6382_6522 | 3300033994 | Freshwater | MKSVEQVLIEWYPNGVYNEEQLWEAIAEANGMDYSEIADGDLAEWI |
| Ga0335003_0319186_1_129 | 3300033995 | Freshwater | YGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0334979_0010987_1318_1467 | 3300033996 | Freshwater | MAKMKTVEIVLMENHPDGIYTEADVWEAIAEAHGLDYSEIADGDLAEWL |
| Ga0334979_0442346_587_703 | 3300033996 | Freshwater | MENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLTEWL |
| Ga0334979_0564639_34_183 | 3300033996 | Freshwater | MGKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLTEWL |
| Ga0334985_0122474_571_711 | 3300034018 | Freshwater | MKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADEDLAEWL |
| Ga0334985_0447775_244_393 | 3300034018 | Freshwater | MGKMKTIEMVLMENHPDGIYNEQDLWEAIAEADGHKLDYYEDGDLAEWL |
| Ga0335005_0162254_2_145 | 3300034022 | Freshwater | MAKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGDLTEW |
| Ga0334995_0485123_617_748 | 3300034062 | Freshwater | LYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLAEWL |
| Ga0335020_0495026_438_578 | 3300034082 | Freshwater | MKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEIADGDLTEWL |
| Ga0335029_0293959_544_693 | 3300034102 | Freshwater | MGQMKTIEMILMENHPNGIYNEDDVWEAIAEATGMDYSEIADGDLAEWL |
| Ga0335031_0007271_870_1019 | 3300034104 | Freshwater | MAKMKTIEMVLMENHPDGIYNEQDVWEAIAESQGLDYSEIADGDLAEWL |
| Ga0335031_0158154_1102_1251 | 3300034104 | Freshwater | MAQMKTIEMILMESHPNGIFNEQDVWEAIAEATGMDYSEIADGDLTEWL |
| Ga0335060_0299515_749_880 | 3300034122 | Freshwater | MAKMKTIEMILMENHPNGIFNEDDVWEAIAEATGMDYSEIADGD |
| Ga0335013_0703248_1_111 | 3300034284 | Freshwater | MKDLYGILTEWYPDGNYTEEQLWEAIAESQGMDYSEI |
| Ga0335048_0187237_5_145 | 3300034356 | Freshwater | MKTVEMVLMENHPDGVYTEDDVWEAIAESQGMDYSEIADGDLAEWL |
| ⦗Top⦘ |