NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047667

Metagenome / Metatranscriptome Family F047667

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047667
Family Type Metagenome / Metatranscriptome
Number of Sequences 149
Average Sequence Length 48 residues
Representative Sequence MSDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Number of Associated Samples 112
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 53.02 %
% of genes near scaffold ends (potentially truncated) 37.58 %
% of genes from short scaffolds (< 2000 bps) 84.56 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(20.134 % of family members)
Environment Ontology (ENVO) Unclassified
(30.201 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.074 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.16%    β-sheet: 0.00%    Coil/Unstructured: 86.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF13537GATase_7 21.48
PF03965Penicillinase_R 6.04
PF12847Methyltransf_18 2.01
PF05362Lon_C 2.01
PF05185PRMT5 1.34
PF00733Asn_synthase 1.34
PF08298AAA_PrkA 1.34
PF13522GATase_6 1.34
PF12911OppC_N 0.67
PF13528Glyco_trans_1_3 0.67
PF12543DUF3738 0.67
PF00873ACR_tran 0.67
PF06325PrmA 0.67
PF00171Aldedh 0.67
PF05685Uma2 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 6.04
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 6.04
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 2.01
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 2.01
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 2.01
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 2.01
COG2766Predicted Ser/Thr protein kinaseSignal transduction mechanisms [T] 1.34
COG4076Predicted RNA methylaseGeneral function prediction only [R] 1.34
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.67
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.67
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.67
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.67
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.67
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.67
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.92 %
UnclassifiedrootN/A12.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_4803446All Organisms → cellular organisms → Bacteria1321Open in IMG/M
2170459019|G14TP7Y01B46TBAll Organisms → cellular organisms → Bacteria746Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0788612All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2465Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0791237All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14317692All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104578460Not Available638Open in IMG/M
3300000550|F24TB_11135264Not Available639Open in IMG/M
3300000890|JGI11643J12802_11038625Not Available536Open in IMG/M
3300000891|JGI10214J12806_10031223All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300000953|JGI11615J12901_10747330All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300002239|JGI24034J26672_10103688All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300003319|soilL2_10044036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. PCC 74254862Open in IMG/M
3300003319|soilL2_10086460All Organisms → cellular organisms → Bacteria3978Open in IMG/M
3300004114|Ga0062593_100029319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3098Open in IMG/M
3300004114|Ga0062593_100049221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2610Open in IMG/M
3300004156|Ga0062589_100452369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1064Open in IMG/M
3300004157|Ga0062590_102131224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300004157|Ga0062590_102208725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria576Open in IMG/M
3300004463|Ga0063356_100873162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Spirulinales → Spirulinaceae → Spirulina → Spirulina subsalsa1266Open in IMG/M
3300004463|Ga0063356_101081094All Organisms → cellular organisms → Bacteria → Acidobacteria1154Open in IMG/M
3300004463|Ga0063356_101759550All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300004480|Ga0062592_102678977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria504Open in IMG/M
3300004643|Ga0062591_101515243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria671Open in IMG/M
3300005093|Ga0062594_100467067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1052Open in IMG/M
3300005288|Ga0065714_10088211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2027Open in IMG/M
3300005294|Ga0065705_10806435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300005330|Ga0070690_101365671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria569Open in IMG/M
3300005331|Ga0070670_100352415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1293Open in IMG/M
3300005334|Ga0068869_100160222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1751Open in IMG/M
3300005334|Ga0068869_100459247All Organisms → cellular organisms → Bacteria → Acidobacteria1057Open in IMG/M
3300005340|Ga0070689_101242430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria670Open in IMG/M
3300005340|Ga0070689_101764349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria564Open in IMG/M
3300005343|Ga0070687_100284588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1042Open in IMG/M
3300005344|Ga0070661_101347082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria599Open in IMG/M
3300005345|Ga0070692_11188074All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300005353|Ga0070669_100234155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1457Open in IMG/M
3300005365|Ga0070688_101479466All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005365|Ga0070688_101730456Not Available512Open in IMG/M
3300005438|Ga0070701_10603477All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300005441|Ga0070700_100293936All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300005444|Ga0070694_101525894All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005444|Ga0070694_101586852Not Available555Open in IMG/M
3300005444|Ga0070694_101622738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria549Open in IMG/M
3300005445|Ga0070708_100754359All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005457|Ga0070662_100899039All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005459|Ga0068867_100324517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1276Open in IMG/M
3300005466|Ga0070685_11033675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Spirulinales → Spirulinaceae → Spirulina → Spirulina subsalsa618Open in IMG/M
3300005518|Ga0070699_101797387Not Available561Open in IMG/M
3300005543|Ga0070672_100346465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1266Open in IMG/M
3300005617|Ga0068859_101880758All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005618|Ga0068864_100482581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Spirulinales → Spirulinaceae → Spirulina → Spirulina subsalsa1190Open in IMG/M
3300005713|Ga0066905_100475558All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300005840|Ga0068870_10284230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1038Open in IMG/M
3300005844|Ga0068862_100162247All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300005844|Ga0068862_102255577All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300006049|Ga0075417_10002584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5495Open in IMG/M
3300006049|Ga0075417_10459058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300006579|Ga0074054_10178518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300006844|Ga0075428_100084593All Organisms → cellular organisms → Bacteria3461Open in IMG/M
3300006844|Ga0075428_100102073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3127Open in IMG/M
3300006844|Ga0075428_100647688All Organisms → Viruses → Predicted Viral1127Open in IMG/M
3300006845|Ga0075421_100011163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria11118Open in IMG/M
3300006845|Ga0075421_100477912All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300006846|Ga0075430_100303661All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300006846|Ga0075430_100398322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1136Open in IMG/M
3300006847|Ga0075431_100027505All Organisms → cellular organisms → Bacteria5837Open in IMG/M
3300006847|Ga0075431_100225803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1909Open in IMG/M
3300006852|Ga0075433_10160724All Organisms → cellular organisms → Bacteria1999Open in IMG/M
3300006852|Ga0075433_10381706All Organisms → cellular organisms → Bacteria → Acidobacteria1244Open in IMG/M
3300006853|Ga0075420_101512328All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300006894|Ga0079215_10470722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales772Open in IMG/M
3300006894|Ga0079215_11533128Not Available527Open in IMG/M
3300006914|Ga0075436_101226410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300007004|Ga0079218_11286517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria768Open in IMG/M
3300009094|Ga0111539_10189202All Organisms → cellular organisms → Bacteria → Acidobacteria2402Open in IMG/M
3300009094|Ga0111539_11152522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → unclassified Desulfatiglans → Desulfatiglans sp.901Open in IMG/M
3300009094|Ga0111539_11489708All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300009100|Ga0075418_11018021All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300009147|Ga0114129_10511263All Organisms → cellular organisms → Bacteria → Acidobacteria1567Open in IMG/M
3300009147|Ga0114129_10681361All Organisms → cellular organisms → Bacteria → Acidobacteria1323Open in IMG/M
3300009148|Ga0105243_11417180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300009553|Ga0105249_11175736All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300009678|Ga0105252_10111193All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300010046|Ga0126384_10693352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300010047|Ga0126382_11063560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300010047|Ga0126382_11968825Not Available555Open in IMG/M
3300010375|Ga0105239_13652963Not Available500Open in IMG/M
3300010403|Ga0134123_10593171All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300011119|Ga0105246_11392773All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300012041|Ga0137430_1174945Not Available619Open in IMG/M
3300012232|Ga0137435_1179370All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300012893|Ga0157284_10188536All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300012899|Ga0157299_10349821All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012911|Ga0157301_10408419All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300014326|Ga0157380_10838548All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300015372|Ga0132256_100152464All Organisms → cellular organisms → Bacteria → Acidobacteria2320Open in IMG/M
3300015372|Ga0132256_102747616Not Available591Open in IMG/M
3300015374|Ga0132255_101289520All Organisms → cellular organisms → Bacteria → Acidobacteria1101Open in IMG/M
3300018476|Ga0190274_12062186All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300019356|Ga0173481_10849844Not Available509Open in IMG/M
3300022899|Ga0247795_1087410All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300025315|Ga0207697_10267073All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300025893|Ga0207682_10239787All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300025901|Ga0207688_10741612Not Available622Open in IMG/M
3300025908|Ga0207643_10136082All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300025917|Ga0207660_11732671Not Available502Open in IMG/M
3300025918|Ga0207662_10049441All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2494Open in IMG/M
3300025923|Ga0207681_10818711All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300025923|Ga0207681_10876791All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300025923|Ga0207681_10901249All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300025925|Ga0207650_11089334All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300025926|Ga0207659_10181365All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300025938|Ga0207704_10678918All Organisms → cellular organisms → Bacteria → Acidobacteria851Open in IMG/M
3300025940|Ga0207691_10125517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2271Open in IMG/M
3300026095|Ga0207676_10122835All Organisms → cellular organisms → Bacteria2193Open in IMG/M
3300026118|Ga0207675_102140961All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300027573|Ga0208454_1125791All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300027665|Ga0209983_1153332Not Available528Open in IMG/M
3300027873|Ga0209814_10002338All Organisms → cellular organisms → Bacteria6950Open in IMG/M
3300027873|Ga0209814_10355060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300027880|Ga0209481_10008395All Organisms → cellular organisms → Bacteria4407Open in IMG/M
3300027880|Ga0209481_10205590Not Available985Open in IMG/M
3300027907|Ga0207428_10061851All Organisms → cellular organisms → Bacteria2962Open in IMG/M
3300027907|Ga0207428_10085660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2453Open in IMG/M
3300027909|Ga0209382_10027460All Organisms → cellular organisms → Bacteria → Acidobacteria6869Open in IMG/M
3300027909|Ga0209382_10696670All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300027909|Ga0209382_11830917Not Available590Open in IMG/M
3300028380|Ga0268265_10658088All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300031538|Ga0310888_10061103All Organisms → cellular organisms → Bacteria → Acidobacteria1801Open in IMG/M
3300031538|Ga0310888_11012052All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300031547|Ga0310887_10272972All Organisms → cellular organisms → Bacteria → Acidobacteria952Open in IMG/M
3300031547|Ga0310887_10353828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300031547|Ga0310887_10511919All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300031562|Ga0310886_10156971All Organisms → cellular organisms → Bacteria → Acidobacteria1204Open in IMG/M
3300031562|Ga0310886_10683969All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300031847|Ga0310907_10283744All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031854|Ga0310904_10618627All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300031892|Ga0310893_10354451All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300031908|Ga0310900_10448424All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300031944|Ga0310884_10175971All Organisms → cellular organisms → Bacteria → Acidobacteria1125Open in IMG/M
3300032000|Ga0310903_10034832All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300032000|Ga0310903_10066562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1439Open in IMG/M
3300032012|Ga0310902_10300969All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300032013|Ga0310906_10866098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300032122|Ga0310895_10016475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. PCC 74252310Open in IMG/M
3300032180|Ga0307471_104121578Not Available513Open in IMG/M
3300032211|Ga0310896_10547812All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300032421|Ga0310812_10123375All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300033412|Ga0310810_10000205All Organisms → cellular organisms → Bacteria60249Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere20.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.37%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere5.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.03%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.68%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.01%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.01%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.01%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.34%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0393.000010502162886012Miscanthus RhizosphereGADDMSEQARTPPKRPYASPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS
4MG_050069102170459019Switchgrass, Maize And Mischanthus LitterMSDQAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN
ICChiseqgaiiDRAFT_078861213300000033SoilMSDQXPTSPKRPYXXPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN*
ICChiseqgaiiDRAFT_079123723300000033SoilMSDQTPTSPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQK
ICChiseqgaiiFebDRAFT_1431769223300000363SoilMSDEAPKAPKRPYESPRLITYGDVRVLTQTNLTGQKADKGGAQKNRTS*
INPhiseqgaiiFebDRAFT_10457846023300000364SoilMSDQAPTPPRRPYETPRLVTYGDIKALTQNTIVGQKADKGGAQKNRTS*
F24TB_1113526423300000550SoilMSDQAPTPPKRPYETPRLVTYGDIKALTQNDPTGQKADRGGAQKNRTS*
JGI11643J12802_1103862523300000890SoilMSDQTPTSPKRPYQRPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN*
JGI10214J12806_1003122323300000891SoilMSDQTPTSPKRPYETPRLVTYGDIKTLTQNSATGQKADKGGAQKNRTS*
JGI11615J12901_1074733023300000953SoilMSDEAPKTPKRPYISPHLVTYGDVTTLTQNSDSGQKADKGGAQKNRTN*
JGI24034J26672_1010368813300002239Corn, Switchgrass And Miscanthus RhizosphereGADDMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS*
soilL2_1004403643300003319Sugarcane Root And Bulk SoilMRPDPISPMSDDAQTPKPAKLPYTPPRLVTYGDVTVITKSNLTGQKADKGGAQKNRTN*
soilL2_1008646033300003319Sugarcane Root And Bulk SoilMTDQATKPPKRSYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS*
Ga0062593_10002931933300004114SoilMSDPAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN*
Ga0062593_10004922123300004114SoilMSDQAPTPPKRPYDTPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0062589_10045236923300004156SoilMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS*
Ga0062590_10213122423300004157SoilRRVGVRICSTMSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNRTA*
Ga0062590_10220872513300004157SoilMSDQAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN*
Ga0063356_10087316223300004463Arabidopsis Thaliana RhizosphereMTDQAQTPPKRPYETPRLVTYGDIKTLTQTNLTGQKADKGGAQKNRTS*
Ga0063356_10108109423300004463Arabidopsis Thaliana RhizosphereMSDEAPKAPKRPYESPRLVTYGDVRVLTQTSLTGQKADKGGAQKNRTS*
Ga0063356_10175955023300004463Arabidopsis Thaliana RhizosphereRPHFSMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS*
Ga0062592_10267897723300004480SoilDPAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN*
Ga0062591_10151524313300004643SoilIGGADEMSDPAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN*
Ga0062594_10046706723300005093SoilMTDQAPTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADKGGAQKNRTS*
Ga0065714_1008821133300005288Miscanthus RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQYSVTGQKADKGGAQKNRTS*
Ga0065705_1080643523300005294Switchgrass RhizosphereKRPYASPKLVTYGDVTTLTQNSLTGQKADKGGAQKNRTA*
Ga0070690_10136567123300005330Switchgrass RhizosphereTIGGADDMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS*
Ga0070670_10035241533300005331Switchgrass RhizosphereMSDQAPTPPKRPYASPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0068869_10016022223300005334Miscanthus RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS*
Ga0068869_10045924723300005334Miscanthus RhizosphereMSDEAPKPTKRPYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN*
Ga0070689_10124243013300005340Switchgrass RhizosphereMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNR
Ga0070689_10176434913300005340Switchgrass RhizosphereGDTIGGADDMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS*
Ga0070687_10028458823300005343Switchgrass RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS*
Ga0070661_10134708223300005344Corn RhizosphereETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS*
Ga0070692_1118807423300005345Corn, Switchgrass And Miscanthus RhizosphereMSYEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNR
Ga0070669_10023415523300005353Switchgrass RhizosphereQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS*
Ga0070688_10147946613300005365Switchgrass RhizosphereATIGGADDMSDQAQKPPRRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS*
Ga0070688_10173045623300005365Switchgrass RhizosphereMSDEAPKPPKRPYASPKLVTYGDVTTLTQNSLTGQKADKGGAQKNRTA*
Ga0070701_1060347723300005438Corn, Switchgrass And Miscanthus RhizosphereMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS*
Ga0070700_10029393613300005441Corn, Switchgrass And Miscanthus RhizosphereMSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNRTG*
Ga0070694_10152589423300005444Corn, Switchgrass And Miscanthus RhizosphereSQMRDEATKPPKQPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTG*
Ga0070694_10158685213300005444Corn, Switchgrass And Miscanthus RhizosphereMSDETPKPTKRPYSSPRLVTYGDVTTLTQNNLTGQKADKGGAQKNRTN*
Ga0070694_10162273823300005444Corn, Switchgrass And Miscanthus RhizosphereGATIGGAGDMTDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0070708_10075435923300005445Corn, Switchgrass And Miscanthus RhizosphereMSDETPKPTKRPYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN*
Ga0070662_10089903923300005457Corn RhizosphereMNDQPKPLKRPYTRPRLVTYGDIRTLTQTSLVGQKADKGGAQKNRTS*
Ga0068867_10032451723300005459Miscanthus RhizosphereMSDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0070685_1103367523300005466Switchgrass RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS*
Ga0070699_10179738713300005518Corn, Switchgrass And Miscanthus RhizosphereMTSDPNFHMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNTVSGQKADKGGAQKNRTN*
Ga0070672_10034646513300005543Miscanthus RhizosphereMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGA
Ga0068859_10188075823300005617Switchgrass RhizosphereMSDEAPKPPKQPYTSPKLVTYGDVTTLTQNSLTGQKADKGGAQKNRTA*
Ga0068864_10048258123300005618Switchgrass RhizosphereMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKG
Ga0066905_10047555833300005713Tropical Forest SoilMADEAPKPPKRPYQSPRLVTYGDITTLTQTNPIGKKSDRGGAQKNRTS*
Ga0068870_1028423013300005840Miscanthus RhizospherePTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS*
Ga0068862_10016224733300005844Switchgrass RhizosphereMTDQAPTPPKRPYATPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS*
Ga0068862_10225557723300005844Switchgrass RhizosphereSDQTPTSPKRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS*
Ga0075417_1000258433300006049Populus RhizosphereMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSLTGQKADKGGAQKNRTS*
Ga0075417_1045905823300006049Populus RhizospherePYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN*
Ga0074054_1017851823300006579SoilMSDDTPKPPKRPYSSPKLVTYGDVTTLTQTNLTGQKADKGGAQKNRTG*
Ga0075428_10008459333300006844Populus RhizosphereMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS*
Ga0075428_10010207333300006844Populus RhizosphereMTDQAPPPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0075428_10064768833300006844Populus RhizosphereMSDESQPPKRPYTRPRLFTYGDIRTLTQTNLVGQKADKGGAQKNRTS*
Ga0075421_10001116353300006845Populus RhizosphereMSDETPKPPKRPYATPRLVTYGDIKTLTQFSPAGQKADKGGAQKNRTN*
Ga0075421_10047791223300006845Populus RhizosphereMSDDAPKAPKRPYDSPRLVTYGDVRTLTQNNPTGQKADKGGAQKNRTN*
Ga0075430_10030366123300006846Populus RhizosphereMTDEAPKPPKRPYESPRLITYGDIKTLTQTLPTGQRADKAGAQKNRTN*
Ga0075430_10039832213300006846Populus RhizospherePPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0075431_10002750553300006847Populus RhizosphereMSDEAPKPPKRPYATPRLVTYGDIKTLTQFSPAGQKADKGGAQKNRTN*
Ga0075431_10022580333300006847Populus RhizosphereMSDESQPPKRPYTSPRLVTYGDIRTLTQTTLVGQKADKGGAQKNRTS*
Ga0075433_1016072423300006852Populus RhizosphereMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNTASGQKADKGGAQKNRTN*
Ga0075433_1038170623300006852Populus RhizosphereSMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS*
Ga0075420_10151232813300006853Populus RhizosphereSDEAPKPPKREYTTPRLITYGDIKTLTQFSPTGQKADKGGAQKNRTN*
Ga0079215_1047072223300006894Agricultural SoilMTDQVPTPKRPYESPRLVTYGDIKALTQTTLVGQKADKGGAQKNRTA*
Ga0079215_1153312823300006894Agricultural SoilMSDQVPTPPKRPYETPRLVTYGDIKALTQTNLVGQKSDKGGAQKSRTA*
Ga0075436_10122641023300006914Populus RhizosphereLRMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNTASGQKADKGGAQKNRTN*
Ga0079218_1128651713300007004Agricultural SoilMSDPGPTPPKRPYETPRLVTYGDIKTLTQTTLVGQKADKGGAQKNRTA
Ga0111539_1018920233300009094Populus RhizosphereMSDEAPKPPKRPYESPRLVTYGDIRTLTQFNATGQKADKGGAQKNRTS*
Ga0111539_1115252223300009094Populus RhizosphereMSNDAPKPPKRPYARPRLVTYGDIRTLTQTNLVGQKADKGGAQKNRTS*
Ga0111539_1148970823300009094Populus RhizosphereGRDSFFANGKMSPDAISPMSDEAPKPPKRPYTSPRLVTYGDVTALTQNNLTGQKADKGGAQKNRTN*
Ga0075418_1101802123300009100Populus RhizosphereMTDEAPKPPKRPYESPRLITYGDIKTLTQNLPTGQRADKAGAQKNRTN*
Ga0114129_1051126323300009147Populus RhizosphereMSEQAPQAPKRPYTSPRLVTYGDVRTLTQNNLTGQKADKGGAQKNRTS*
Ga0114129_1068136113300009147Populus RhizosphereMTSDPSFHMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN*
Ga0105243_1141718023300009148Miscanthus RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTG*
Ga0105249_1117573613300009553Switchgrass RhizosphereMTDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKN
Ga0105252_1011119323300009678SoilMTDQAQTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADKGGAQKNRTS*
Ga0126384_1069335223300010046Tropical Forest SoilMTEETTKPPKRPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTN*
Ga0126382_1106356023300010047Tropical Forest SoilMTDEAPKPPKRPYETPRLVTYGDIKTLTQMNPVGQKSDRGGAQKNRTS*
Ga0126382_1196882523300010047Tropical Forest SoilMSDEAPKPPKRPYSSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTN*
Ga0105239_1365296323300010375Corn RhizosphereETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0134123_1059317123300010403Terrestrial SoilMSDQAPTSPKRPYESPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0105246_1139277323300011119Miscanthus RhizosphereMSDQAPTPPKRPYATPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS*
Ga0137430_117494523300012041SoilMTDQAQTPPKRPYETPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS*
Ga0137435_117937023300012232SoilMTDQAQTPPKRPYETPRLVTFGDIKTLTQTTLTGQKADKGGAQKNRTS*
Ga0157284_1018853623300012893SoilMSDQAPTPPKRPYDTPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS*
Ga0157299_1034982123300012899SoilMSDQAPTPPKRPYATPRLVTYGDIKALTQTTLIGQKADKGGAQKNRTS*
Ga0157301_1040841913300012911SoilMSDQAPTPPKRPYATPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS
Ga0157380_1083854823300014326Switchgrass RhizosphereMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQ
Ga0132256_10015246433300015372Arabidopsis RhizosphereMSPDAISPMSDEAPKPPKRPYTSPRLVTYGDVTTLTQNNTSGQKADKGGAQKNRTN*
Ga0132256_10274761613300015372Arabidopsis RhizosphereMSDEAPKPPKRPYSSPRLVTYGDVTTLTQTNLTGQKADK
Ga0132255_10128952023300015374Arabidopsis RhizosphereMSPDPISPMSDEAPKPPKRPYTSPRLVTYGDVTALTQNNLTGQKADKGGAQKNRTN*
Ga0190274_1206218623300018476SoilMSDQASTPPKRPYASPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS
Ga0173481_1084984423300019356SoilMSDQAPTPPKRPYDTPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Ga0247795_108741023300022899SoilMSDQAPTPPKRPYDTPRLVTYGDIKTLTQNSLTGQ
Ga0207697_1026707313300025315Corn, Switchgrass And Miscanthus RhizosphereMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS
Ga0207682_1023978723300025893Miscanthus RhizosphereMTDQAPTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADKGGAQKNRTS
Ga0207688_1074161223300025901Corn, Switchgrass And Miscanthus RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN
Ga0207643_1013608213300025908Miscanthus RhizosphereTPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS
Ga0207660_1173267123300025917Corn RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS
Ga0207662_1004944133300025918Switchgrass RhizosphereMSDQTPTSPKRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS
Ga0207681_1081871123300025923Switchgrass RhizosphereSFGATIGGADDMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS
Ga0207681_1087679123300025923Switchgrass RhizosphereARTPPKRPYASPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS
Ga0207681_1090124913300025923Switchgrass RhizosphereMTDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Ga0207650_1108933413300025925Switchgrass RhizosphereMSDQAPTPPKRPYASPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Ga0207659_1018136523300025926Miscanthus RhizosphereMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS
Ga0207704_1067891823300025938Miscanthus RhizosphereCSTMSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNRTG
Ga0207691_1012551723300025940Miscanthus RhizosphereMSDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Ga0207676_1012283533300026095Switchgrass RhizosphereSFGDTIGGADDMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS
Ga0207675_10214096113300026118Switchgrass RhizosphereMSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNR
Ga0208454_112579123300027573SoilMTDQAQTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADK
Ga0209983_115333223300027665Arabidopsis Thaliana RhizosphereMTDQAQTPPKRPYETPRLVTYGDIKTLTQTNLTGQKADKGGAQKNRTS
Ga0209814_1000233833300027873Populus RhizosphereMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSLTGQKADKGGAQKNRTS
Ga0209814_1035506013300027873Populus RhizospherePYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN
Ga0209481_1000839513300027880Populus RhizosphereMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS
Ga0209481_1020559013300027880Populus RhizosphereMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSLTGQKADKGGAQKN
Ga0207428_1006185133300027907Populus RhizosphereMSDEAPKPPKRPYESPRLVTYGDIRTLTQFNATGQKADKGGAQKNRTS
Ga0207428_1008566023300027907Populus RhizosphereMTDQAPPPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Ga0209382_1002746033300027909Populus RhizosphereMSDESQPPKRPYTSPRLVTYGDIRTLTQTTLVGQKADKGGAQKNRTS
Ga0209382_1069667023300027909Populus RhizosphereMSDESQPPKRPYTRPRLFTYGDIRTLTQTNLVGQKADKGGAQKNRTS
Ga0209382_1183091713300027909Populus RhizosphereMASMSDDAPKAPKRPYDSPRLVTYGDVRTLTQNNPTGQKADKGGAQKNRTN
Ga0268265_1065808823300028380Switchgrass RhizosphereMTDQAPTPPKRPYATPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS
Ga0310888_1006110323300031538SoilMTDDAPTPPKQQYTSPRLITYGDIRTLTQTTVVGQKADKGGAQKNRTA
Ga0310888_1101205213300031538SoilMTDQAPTPPKRPYETPRLVTYGDIKTLTQTSLTGQKADK
Ga0310887_1027297223300031547SoilMRDEATKPPKQPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTG
Ga0310887_1035382823300031547SoilMTDDAPTPPKQQYTSPRLITYGDIRTLTQTTIVGQKADKGGAQKNRTA
Ga0310887_1051191923300031547SoilMSEQARTPPKRPYASPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS
Ga0310886_1015697113300031562SoilPTPPKQQYTSPRLITYGDIRTLTQTTIVGQKADKGGAQKNRTA
Ga0310886_1068396923300031562SoilMSNDAPKPPKRPYARPRLVTYGDIRTLTQTNLVGQKADKGGAQKNRTS
Ga0310907_1028374423300031847SoilMRDEATKPPKQPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNR
Ga0310904_1061862713300031854SoilMTDQAPTPPKRPYETPRLVTYGDIKTLTQNNFTGQ
Ga0310893_1035445123300031892SoilMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRT
Ga0310900_1044842423300031908SoilMTDQAPTPPKRPYETPRLVTYGDIKTLTQTSLTGQ
Ga0310884_1017597113300031944SoilYTSPRLIAYGDIRTLTQTTVVGQKADKGGAQKNRTA
Ga0310903_1003483213300032000SoilTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS
Ga0310903_1006656223300032000SoilMSDQAPTPPKRPYASPRLVTYGDIKTLTQTNLTGQKADKGGAQKNRTS
Ga0310902_1030096923300032012SoilMTDQAPTPPKRPYETPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS
Ga0310906_1086609823300032013SoilTISGARDMTDEAPPPPKRPYASPRLVTYGDIRVLTQTTTMGQKSDKGGAQKSRTG
Ga0310895_1001647523300032122SoilMTDQAPTPPKRPYETPRLVTYGDIKTLTQTTLTGQKADKGGAQKNRTS
Ga0307471_10412157823300032180Hardwood Forest SoilMSDEAPKPPKRPYSTPKLVTYGDVTTLTQTNLTGQKADKGGAQKNRTN
Ga0310896_1054781223300032211SoilMTDDAPTPPKQQYTSPRLITYGDIRTLTQTTLVGQKADKGGAQKNRTA
Ga0310812_1012337523300032421SoilDMSDQTPTSPKRPYESPRLVTYGDIKTLTQYSVTGQKADKGGAQKNRTS
Ga0310810_10000205543300033412SoilMSDQTPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.