| Basic Information | |
|---|---|
| Family ID | F047667 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.02 % |
| % of genes near scaffold ends (potentially truncated) | 37.58 % |
| % of genes from short scaffolds (< 2000 bps) | 84.56 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (20.134 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.201 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.074 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.16% β-sheet: 0.00% Coil/Unstructured: 86.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF13537 | GATase_7 | 21.48 |
| PF03965 | Penicillinase_R | 6.04 |
| PF12847 | Methyltransf_18 | 2.01 |
| PF05362 | Lon_C | 2.01 |
| PF05185 | PRMT5 | 1.34 |
| PF00733 | Asn_synthase | 1.34 |
| PF08298 | AAA_PrkA | 1.34 |
| PF13522 | GATase_6 | 1.34 |
| PF12911 | OppC_N | 0.67 |
| PF13528 | Glyco_trans_1_3 | 0.67 |
| PF12543 | DUF3738 | 0.67 |
| PF00873 | ACR_tran | 0.67 |
| PF06325 | PrmA | 0.67 |
| PF00171 | Aldedh | 0.67 |
| PF05685 | Uma2 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 6.04 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 6.04 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 2.01 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 2.01 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 2.01 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 2.01 |
| COG2766 | Predicted Ser/Thr protein kinase | Signal transduction mechanisms [T] | 1.34 |
| COG4076 | Predicted RNA methylase | General function prediction only [R] | 1.34 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.67 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.67 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.92 % |
| Unclassified | root | N/A | 12.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_4803446 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 2170459019|G14TP7Y01B46TB | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0788612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2465 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0791237 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14317692 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104578460 | Not Available | 638 | Open in IMG/M |
| 3300000550|F24TB_11135264 | Not Available | 639 | Open in IMG/M |
| 3300000890|JGI11643J12802_11038625 | Not Available | 536 | Open in IMG/M |
| 3300000891|JGI10214J12806_10031223 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300000953|JGI11615J12901_10747330 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300002239|JGI24034J26672_10103688 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300003319|soilL2_10044036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. PCC 7425 | 4862 | Open in IMG/M |
| 3300003319|soilL2_10086460 | All Organisms → cellular organisms → Bacteria | 3978 | Open in IMG/M |
| 3300004114|Ga0062593_100029319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3098 | Open in IMG/M |
| 3300004114|Ga0062593_100049221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2610 | Open in IMG/M |
| 3300004156|Ga0062589_100452369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1064 | Open in IMG/M |
| 3300004157|Ga0062590_102131224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300004157|Ga0062590_102208725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 576 | Open in IMG/M |
| 3300004463|Ga0063356_100873162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Spirulinales → Spirulinaceae → Spirulina → Spirulina subsalsa | 1266 | Open in IMG/M |
| 3300004463|Ga0063356_101081094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300004463|Ga0063356_101759550 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300004480|Ga0062592_102678977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 504 | Open in IMG/M |
| 3300004643|Ga0062591_101515243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 671 | Open in IMG/M |
| 3300005093|Ga0062594_100467067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1052 | Open in IMG/M |
| 3300005288|Ga0065714_10088211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2027 | Open in IMG/M |
| 3300005294|Ga0065705_10806435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300005330|Ga0070690_101365671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 569 | Open in IMG/M |
| 3300005331|Ga0070670_100352415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1293 | Open in IMG/M |
| 3300005334|Ga0068869_100160222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1751 | Open in IMG/M |
| 3300005334|Ga0068869_100459247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300005340|Ga0070689_101242430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 670 | Open in IMG/M |
| 3300005340|Ga0070689_101764349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 564 | Open in IMG/M |
| 3300005343|Ga0070687_100284588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1042 | Open in IMG/M |
| 3300005344|Ga0070661_101347082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 599 | Open in IMG/M |
| 3300005345|Ga0070692_11188074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005353|Ga0070669_100234155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1457 | Open in IMG/M |
| 3300005365|Ga0070688_101479466 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005365|Ga0070688_101730456 | Not Available | 512 | Open in IMG/M |
| 3300005438|Ga0070701_10603477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300005441|Ga0070700_100293936 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300005444|Ga0070694_101525894 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005444|Ga0070694_101586852 | Not Available | 555 | Open in IMG/M |
| 3300005444|Ga0070694_101622738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 549 | Open in IMG/M |
| 3300005445|Ga0070708_100754359 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005457|Ga0070662_100899039 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005459|Ga0068867_100324517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1276 | Open in IMG/M |
| 3300005466|Ga0070685_11033675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Spirulinales → Spirulinaceae → Spirulina → Spirulina subsalsa | 618 | Open in IMG/M |
| 3300005518|Ga0070699_101797387 | Not Available | 561 | Open in IMG/M |
| 3300005543|Ga0070672_100346465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1266 | Open in IMG/M |
| 3300005617|Ga0068859_101880758 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005618|Ga0068864_100482581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Spirulinales → Spirulinaceae → Spirulina → Spirulina subsalsa | 1190 | Open in IMG/M |
| 3300005713|Ga0066905_100475558 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300005840|Ga0068870_10284230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1038 | Open in IMG/M |
| 3300005844|Ga0068862_100162247 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300005844|Ga0068862_102255577 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006049|Ga0075417_10002584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5495 | Open in IMG/M |
| 3300006049|Ga0075417_10459058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300006579|Ga0074054_10178518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300006844|Ga0075428_100084593 | All Organisms → cellular organisms → Bacteria | 3461 | Open in IMG/M |
| 3300006844|Ga0075428_100102073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3127 | Open in IMG/M |
| 3300006844|Ga0075428_100647688 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300006845|Ga0075421_100011163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 11118 | Open in IMG/M |
| 3300006845|Ga0075421_100477912 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300006846|Ga0075430_100303661 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300006846|Ga0075430_100398322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1136 | Open in IMG/M |
| 3300006847|Ga0075431_100027505 | All Organisms → cellular organisms → Bacteria | 5837 | Open in IMG/M |
| 3300006847|Ga0075431_100225803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1909 | Open in IMG/M |
| 3300006852|Ga0075433_10160724 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300006852|Ga0075433_10381706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300006853|Ga0075420_101512328 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006894|Ga0079215_10470722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 772 | Open in IMG/M |
| 3300006894|Ga0079215_11533128 | Not Available | 527 | Open in IMG/M |
| 3300006914|Ga0075436_101226410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300007004|Ga0079218_11286517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 768 | Open in IMG/M |
| 3300009094|Ga0111539_10189202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2402 | Open in IMG/M |
| 3300009094|Ga0111539_11152522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → unclassified Desulfatiglans → Desulfatiglans sp. | 901 | Open in IMG/M |
| 3300009094|Ga0111539_11489708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300009100|Ga0075418_11018021 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300009147|Ga0114129_10511263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300009147|Ga0114129_10681361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300009148|Ga0105243_11417180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300009553|Ga0105249_11175736 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009678|Ga0105252_10111193 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300010046|Ga0126384_10693352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300010047|Ga0126382_11063560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300010047|Ga0126382_11968825 | Not Available | 555 | Open in IMG/M |
| 3300010375|Ga0105239_13652963 | Not Available | 500 | Open in IMG/M |
| 3300010403|Ga0134123_10593171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300011119|Ga0105246_11392773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300012041|Ga0137430_1174945 | Not Available | 619 | Open in IMG/M |
| 3300012232|Ga0137435_1179370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012893|Ga0157284_10188536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300012899|Ga0157299_10349821 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012911|Ga0157301_10408419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300014326|Ga0157380_10838548 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300015372|Ga0132256_100152464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2320 | Open in IMG/M |
| 3300015372|Ga0132256_102747616 | Not Available | 591 | Open in IMG/M |
| 3300015374|Ga0132255_101289520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300018476|Ga0190274_12062186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300019356|Ga0173481_10849844 | Not Available | 509 | Open in IMG/M |
| 3300022899|Ga0247795_1087410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300025315|Ga0207697_10267073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300025893|Ga0207682_10239787 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300025901|Ga0207688_10741612 | Not Available | 622 | Open in IMG/M |
| 3300025908|Ga0207643_10136082 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300025917|Ga0207660_11732671 | Not Available | 502 | Open in IMG/M |
| 3300025918|Ga0207662_10049441 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2494 | Open in IMG/M |
| 3300025923|Ga0207681_10818711 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300025923|Ga0207681_10876791 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300025923|Ga0207681_10901249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300025925|Ga0207650_11089334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300025926|Ga0207659_10181365 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300025938|Ga0207704_10678918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300025940|Ga0207691_10125517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 2271 | Open in IMG/M |
| 3300026095|Ga0207676_10122835 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300026118|Ga0207675_102140961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300027573|Ga0208454_1125791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300027665|Ga0209983_1153332 | Not Available | 528 | Open in IMG/M |
| 3300027873|Ga0209814_10002338 | All Organisms → cellular organisms → Bacteria | 6950 | Open in IMG/M |
| 3300027873|Ga0209814_10355060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300027880|Ga0209481_10008395 | All Organisms → cellular organisms → Bacteria | 4407 | Open in IMG/M |
| 3300027880|Ga0209481_10205590 | Not Available | 985 | Open in IMG/M |
| 3300027907|Ga0207428_10061851 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
| 3300027907|Ga0207428_10085660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2453 | Open in IMG/M |
| 3300027909|Ga0209382_10027460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6869 | Open in IMG/M |
| 3300027909|Ga0209382_10696670 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027909|Ga0209382_11830917 | Not Available | 590 | Open in IMG/M |
| 3300028380|Ga0268265_10658088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300031538|Ga0310888_10061103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300031538|Ga0310888_11012052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031547|Ga0310887_10272972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300031547|Ga0310887_10353828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300031547|Ga0310887_10511919 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300031562|Ga0310886_10156971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300031562|Ga0310886_10683969 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031847|Ga0310907_10283744 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031854|Ga0310904_10618627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300031892|Ga0310893_10354451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300031908|Ga0310900_10448424 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031944|Ga0310884_10175971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300032000|Ga0310903_10034832 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300032000|Ga0310903_10066562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1439 | Open in IMG/M |
| 3300032012|Ga0310902_10300969 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300032013|Ga0310906_10866098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300032122|Ga0310895_10016475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. PCC 7425 | 2310 | Open in IMG/M |
| 3300032180|Ga0307471_104121578 | Not Available | 513 | Open in IMG/M |
| 3300032211|Ga0310896_10547812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300032421|Ga0310812_10123375 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300033412|Ga0310810_10000205 | All Organisms → cellular organisms → Bacteria | 60249 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 20.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.03% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.01% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.01% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0393.00001050 | 2162886012 | Miscanthus Rhizosphere | GADDMSEQARTPPKRPYASPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS |
| 4MG_05006910 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MSDQAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN |
| ICChiseqgaiiDRAFT_07886121 | 3300000033 | Soil | MSDQXPTSPKRPYXXPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN* |
| ICChiseqgaiiDRAFT_07912372 | 3300000033 | Soil | MSDQTPTSPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQK |
| ICChiseqgaiiFebDRAFT_143176922 | 3300000363 | Soil | MSDEAPKAPKRPYESPRLITYGDVRVLTQTNLTGQKADKGGAQKNRTS* |
| INPhiseqgaiiFebDRAFT_1045784602 | 3300000364 | Soil | MSDQAPTPPRRPYETPRLVTYGDIKALTQNTIVGQKADKGGAQKNRTS* |
| F24TB_111352642 | 3300000550 | Soil | MSDQAPTPPKRPYETPRLVTYGDIKALTQNDPTGQKADRGGAQKNRTS* |
| JGI11643J12802_110386252 | 3300000890 | Soil | MSDQTPTSPKRPYQRPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN* |
| JGI10214J12806_100312232 | 3300000891 | Soil | MSDQTPTSPKRPYETPRLVTYGDIKTLTQNSATGQKADKGGAQKNRTS* |
| JGI11615J12901_107473302 | 3300000953 | Soil | MSDEAPKTPKRPYISPHLVTYGDVTTLTQNSDSGQKADKGGAQKNRTN* |
| JGI24034J26672_101036881 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | GADDMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS* |
| soilL2_100440364 | 3300003319 | Sugarcane Root And Bulk Soil | MRPDPISPMSDDAQTPKPAKLPYTPPRLVTYGDVTVITKSNLTGQKADKGGAQKNRTN* |
| soilL2_100864603 | 3300003319 | Sugarcane Root And Bulk Soil | MTDQATKPPKRSYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS* |
| Ga0062593_1000293193 | 3300004114 | Soil | MSDPAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN* |
| Ga0062593_1000492212 | 3300004114 | Soil | MSDQAPTPPKRPYDTPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0062589_1004523692 | 3300004156 | Soil | MSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS* |
| Ga0062590_1021312242 | 3300004157 | Soil | RRVGVRICSTMSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNRTA* |
| Ga0062590_1022087251 | 3300004157 | Soil | MSDQAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN* |
| Ga0063356_1008731622 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTDQAQTPPKRPYETPRLVTYGDIKTLTQTNLTGQKADKGGAQKNRTS* |
| Ga0063356_1010810942 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSDEAPKAPKRPYESPRLVTYGDVRVLTQTSLTGQKADKGGAQKNRTS* |
| Ga0063356_1017595502 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RPHFSMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS* |
| Ga0062592_1026789772 | 3300004480 | Soil | DPAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN* |
| Ga0062591_1015152431 | 3300004643 | Soil | IGGADEMSDPAPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN* |
| Ga0062594_1004670672 | 3300005093 | Soil | MTDQAPTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADKGGAQKNRTS* |
| Ga0065714_100882113 | 3300005288 | Miscanthus Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQYSVTGQKADKGGAQKNRTS* |
| Ga0065705_108064352 | 3300005294 | Switchgrass Rhizosphere | KRPYASPKLVTYGDVTTLTQNSLTGQKADKGGAQKNRTA* |
| Ga0070690_1013656712 | 3300005330 | Switchgrass Rhizosphere | TIGGADDMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS* |
| Ga0070670_1003524153 | 3300005331 | Switchgrass Rhizosphere | MSDQAPTPPKRPYASPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0068869_1001602222 | 3300005334 | Miscanthus Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS* |
| Ga0068869_1004592472 | 3300005334 | Miscanthus Rhizosphere | MSDEAPKPTKRPYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN* |
| Ga0070689_1012424301 | 3300005340 | Switchgrass Rhizosphere | MSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNR |
| Ga0070689_1017643491 | 3300005340 | Switchgrass Rhizosphere | GDTIGGADDMSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS* |
| Ga0070687_1002845882 | 3300005343 | Switchgrass Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS* |
| Ga0070661_1013470822 | 3300005344 | Corn Rhizosphere | ETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS* |
| Ga0070692_111880742 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNR |
| Ga0070669_1002341552 | 3300005353 | Switchgrass Rhizosphere | QAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS* |
| Ga0070688_1014794661 | 3300005365 | Switchgrass Rhizosphere | ATIGGADDMSDQAQKPPRRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS* |
| Ga0070688_1017304562 | 3300005365 | Switchgrass Rhizosphere | MSDEAPKPPKRPYASPKLVTYGDVTTLTQNSLTGQKADKGGAQKNRTA* |
| Ga0070701_106034772 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS* |
| Ga0070700_1002939361 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNRTG* |
| Ga0070694_1015258942 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SQMRDEATKPPKQPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTG* |
| Ga0070694_1015868521 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDETPKPTKRPYSSPRLVTYGDVTTLTQNNLTGQKADKGGAQKNRTN* |
| Ga0070694_1016227382 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GATIGGAGDMTDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0070708_1007543592 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDETPKPTKRPYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN* |
| Ga0070662_1008990392 | 3300005457 | Corn Rhizosphere | MNDQPKPLKRPYTRPRLVTYGDIRTLTQTSLVGQKADKGGAQKNRTS* |
| Ga0068867_1003245172 | 3300005459 | Miscanthus Rhizosphere | MSDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0070685_110336752 | 3300005466 | Switchgrass Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS* |
| Ga0070699_1017973871 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSDPNFHMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNTVSGQKADKGGAQKNRTN* |
| Ga0070672_1003464651 | 3300005543 | Miscanthus Rhizosphere | MSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGA |
| Ga0068859_1018807582 | 3300005617 | Switchgrass Rhizosphere | MSDEAPKPPKQPYTSPKLVTYGDVTTLTQNSLTGQKADKGGAQKNRTA* |
| Ga0068864_1004825812 | 3300005618 | Switchgrass Rhizosphere | MSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKG |
| Ga0066905_1004755583 | 3300005713 | Tropical Forest Soil | MADEAPKPPKRPYQSPRLVTYGDITTLTQTNPIGKKSDRGGAQKNRTS* |
| Ga0068870_102842301 | 3300005840 | Miscanthus Rhizosphere | PTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS* |
| Ga0068862_1001622473 | 3300005844 | Switchgrass Rhizosphere | MTDQAPTPPKRPYATPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS* |
| Ga0068862_1022555772 | 3300005844 | Switchgrass Rhizosphere | SDQTPTSPKRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS* |
| Ga0075417_100025843 | 3300006049 | Populus Rhizosphere | MSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSLTGQKADKGGAQKNRTS* |
| Ga0075417_104590582 | 3300006049 | Populus Rhizosphere | PYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN* |
| Ga0074054_101785182 | 3300006579 | Soil | MSDDTPKPPKRPYSSPKLVTYGDVTTLTQTNLTGQKADKGGAQKNRTG* |
| Ga0075428_1000845933 | 3300006844 | Populus Rhizosphere | MSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS* |
| Ga0075428_1001020733 | 3300006844 | Populus Rhizosphere | MTDQAPPPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0075428_1006476883 | 3300006844 | Populus Rhizosphere | MSDESQPPKRPYTRPRLFTYGDIRTLTQTNLVGQKADKGGAQKNRTS* |
| Ga0075421_1000111635 | 3300006845 | Populus Rhizosphere | MSDETPKPPKRPYATPRLVTYGDIKTLTQFSPAGQKADKGGAQKNRTN* |
| Ga0075421_1004779122 | 3300006845 | Populus Rhizosphere | MSDDAPKAPKRPYDSPRLVTYGDVRTLTQNNPTGQKADKGGAQKNRTN* |
| Ga0075430_1003036612 | 3300006846 | Populus Rhizosphere | MTDEAPKPPKRPYESPRLITYGDIKTLTQTLPTGQRADKAGAQKNRTN* |
| Ga0075430_1003983221 | 3300006846 | Populus Rhizosphere | PPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0075431_1000275055 | 3300006847 | Populus Rhizosphere | MSDEAPKPPKRPYATPRLVTYGDIKTLTQFSPAGQKADKGGAQKNRTN* |
| Ga0075431_1002258033 | 3300006847 | Populus Rhizosphere | MSDESQPPKRPYTSPRLVTYGDIRTLTQTTLVGQKADKGGAQKNRTS* |
| Ga0075433_101607242 | 3300006852 | Populus Rhizosphere | MSDEAPKPPKRPYSSPRLVTYGDVTTLTQNTASGQKADKGGAQKNRTN* |
| Ga0075433_103817062 | 3300006852 | Populus Rhizosphere | SMSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS* |
| Ga0075420_1015123281 | 3300006853 | Populus Rhizosphere | SDEAPKPPKREYTTPRLITYGDIKTLTQFSPTGQKADKGGAQKNRTN* |
| Ga0079215_104707222 | 3300006894 | Agricultural Soil | MTDQVPTPKRPYESPRLVTYGDIKALTQTTLVGQKADKGGAQKNRTA* |
| Ga0079215_115331282 | 3300006894 | Agricultural Soil | MSDQVPTPPKRPYETPRLVTYGDIKALTQTNLVGQKSDKGGAQKSRTA* |
| Ga0075436_1012264102 | 3300006914 | Populus Rhizosphere | LRMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNTASGQKADKGGAQKNRTN* |
| Ga0079218_112865171 | 3300007004 | Agricultural Soil | MSDPGPTPPKRPYETPRLVTYGDIKTLTQTTLVGQKADKGGAQKNRTA |
| Ga0111539_101892023 | 3300009094 | Populus Rhizosphere | MSDEAPKPPKRPYESPRLVTYGDIRTLTQFNATGQKADKGGAQKNRTS* |
| Ga0111539_111525222 | 3300009094 | Populus Rhizosphere | MSNDAPKPPKRPYARPRLVTYGDIRTLTQTNLVGQKADKGGAQKNRTS* |
| Ga0111539_114897082 | 3300009094 | Populus Rhizosphere | GRDSFFANGKMSPDAISPMSDEAPKPPKRPYTSPRLVTYGDVTALTQNNLTGQKADKGGAQKNRTN* |
| Ga0075418_110180212 | 3300009100 | Populus Rhizosphere | MTDEAPKPPKRPYESPRLITYGDIKTLTQNLPTGQRADKAGAQKNRTN* |
| Ga0114129_105112632 | 3300009147 | Populus Rhizosphere | MSEQAPQAPKRPYTSPRLVTYGDVRTLTQNNLTGQKADKGGAQKNRTS* |
| Ga0114129_106813611 | 3300009147 | Populus Rhizosphere | MTSDPSFHMSDEAPKPPKRPYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN* |
| Ga0105243_114171802 | 3300009148 | Miscanthus Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTG* |
| Ga0105249_111757361 | 3300009553 | Switchgrass Rhizosphere | MTDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKN |
| Ga0105252_101111932 | 3300009678 | Soil | MTDQAQTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADKGGAQKNRTS* |
| Ga0126384_106933522 | 3300010046 | Tropical Forest Soil | MTEETTKPPKRPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTN* |
| Ga0126382_110635602 | 3300010047 | Tropical Forest Soil | MTDEAPKPPKRPYETPRLVTYGDIKTLTQMNPVGQKSDRGGAQKNRTS* |
| Ga0126382_119688252 | 3300010047 | Tropical Forest Soil | MSDEAPKPPKRPYSSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTN* |
| Ga0105239_136529632 | 3300010375 | Corn Rhizosphere | ETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0134123_105931712 | 3300010403 | Terrestrial Soil | MSDQAPTSPKRPYESPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0105246_113927732 | 3300011119 | Miscanthus Rhizosphere | MSDQAPTPPKRPYATPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS* |
| Ga0137430_11749452 | 3300012041 | Soil | MTDQAQTPPKRPYETPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS* |
| Ga0137435_11793702 | 3300012232 | Soil | MTDQAQTPPKRPYETPRLVTFGDIKTLTQTTLTGQKADKGGAQKNRTS* |
| Ga0157284_101885362 | 3300012893 | Soil | MSDQAPTPPKRPYDTPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS* |
| Ga0157299_103498212 | 3300012899 | Soil | MSDQAPTPPKRPYATPRLVTYGDIKALTQTTLIGQKADKGGAQKNRTS* |
| Ga0157301_104084191 | 3300012911 | Soil | MSDQAPTPPKRPYATPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS |
| Ga0157380_108385482 | 3300014326 | Switchgrass Rhizosphere | MSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQ |
| Ga0132256_1001524643 | 3300015372 | Arabidopsis Rhizosphere | MSPDAISPMSDEAPKPPKRPYTSPRLVTYGDVTTLTQNNTSGQKADKGGAQKNRTN* |
| Ga0132256_1027476161 | 3300015372 | Arabidopsis Rhizosphere | MSDEAPKPPKRPYSSPRLVTYGDVTTLTQTNLTGQKADK |
| Ga0132255_1012895202 | 3300015374 | Arabidopsis Rhizosphere | MSPDPISPMSDEAPKPPKRPYTSPRLVTYGDVTALTQNNLTGQKADKGGAQKNRTN* |
| Ga0190274_120621862 | 3300018476 | Soil | MSDQASTPPKRPYASPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS |
| Ga0173481_108498442 | 3300019356 | Soil | MSDQAPTPPKRPYDTPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Ga0247795_10874102 | 3300022899 | Soil | MSDQAPTPPKRPYDTPRLVTYGDIKTLTQNSLTGQ |
| Ga0207697_102670731 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS |
| Ga0207682_102397872 | 3300025893 | Miscanthus Rhizosphere | MTDQAPTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADKGGAQKNRTS |
| Ga0207688_107416122 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQTNPIGQKADKAGSQKNRTN |
| Ga0207643_101360821 | 3300025908 | Miscanthus Rhizosphere | TPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS |
| Ga0207660_117326712 | 3300025917 | Corn Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS |
| Ga0207662_100494413 | 3300025918 | Switchgrass Rhizosphere | MSDQTPTSPKRPYESPRLVTYGDIKTLTQFNLTGQKADKGGAQKNRTS |
| Ga0207681_108187112 | 3300025923 | Switchgrass Rhizosphere | SFGATIGGADDMSDQAPTPPKRPYETPRLVTYGDIKALTQNTVVGQKADKGGAQKNRTS |
| Ga0207681_108767912 | 3300025923 | Switchgrass Rhizosphere | ARTPPKRPYASPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS |
| Ga0207681_109012491 | 3300025923 | Switchgrass Rhizosphere | MTDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Ga0207650_110893341 | 3300025925 | Switchgrass Rhizosphere | MSDQAPTPPKRPYASPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Ga0207659_101813652 | 3300025926 | Miscanthus Rhizosphere | MSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS |
| Ga0207704_106789182 | 3300025938 | Miscanthus Rhizosphere | CSTMSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNRTG |
| Ga0207691_101255172 | 3300025940 | Miscanthus Rhizosphere | MSDQAPTPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Ga0207676_101228353 | 3300026095 | Switchgrass Rhizosphere | SFGDTIGGADDMSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS |
| Ga0207675_1021409611 | 3300026118 | Switchgrass Rhizosphere | MSDEAPKPPKRPYASPKLVTYGDVTTLTQTSLTGQKADKGGAQKNR |
| Ga0208454_11257912 | 3300027573 | Soil | MTDQAQTPPKRPYETPRLVTYGDIKTLTQNNFTGQKADK |
| Ga0209983_11533322 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MTDQAQTPPKRPYETPRLVTYGDIKTLTQTNLTGQKADKGGAQKNRTS |
| Ga0209814_100023383 | 3300027873 | Populus Rhizosphere | MSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSLTGQKADKGGAQKNRTS |
| Ga0209814_103550601 | 3300027873 | Populus Rhizosphere | PYSSPRLVTYGDVTTLTQNSLTGQKADKGGAQKNRTN |
| Ga0209481_100083951 | 3300027880 | Populus Rhizosphere | MSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSPTGQKADKGGAQKNRTS |
| Ga0209481_102055901 | 3300027880 | Populus Rhizosphere | MSDEAPKAPKRPYDSPRLVTYGDVRTLTQTSLTGQKADKGGAQKN |
| Ga0207428_100618513 | 3300027907 | Populus Rhizosphere | MSDEAPKPPKRPYESPRLVTYGDIRTLTQFNATGQKADKGGAQKNRTS |
| Ga0207428_100856602 | 3300027907 | Populus Rhizosphere | MTDQAPPPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Ga0209382_100274603 | 3300027909 | Populus Rhizosphere | MSDESQPPKRPYTSPRLVTYGDIRTLTQTTLVGQKADKGGAQKNRTS |
| Ga0209382_106966702 | 3300027909 | Populus Rhizosphere | MSDESQPPKRPYTRPRLFTYGDIRTLTQTNLVGQKADKGGAQKNRTS |
| Ga0209382_118309171 | 3300027909 | Populus Rhizosphere | MASMSDDAPKAPKRPYDSPRLVTYGDVRTLTQNNPTGQKADKGGAQKNRTN |
| Ga0268265_106580882 | 3300028380 | Switchgrass Rhizosphere | MTDQAPTPPKRPYATPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS |
| Ga0310888_100611032 | 3300031538 | Soil | MTDDAPTPPKQQYTSPRLITYGDIRTLTQTTVVGQKADKGGAQKNRTA |
| Ga0310888_110120521 | 3300031538 | Soil | MTDQAPTPPKRPYETPRLVTYGDIKTLTQTSLTGQKADK |
| Ga0310887_102729722 | 3300031547 | Soil | MRDEATKPPKQPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNRTG |
| Ga0310887_103538282 | 3300031547 | Soil | MTDDAPTPPKQQYTSPRLITYGDIRTLTQTTIVGQKADKGGAQKNRTA |
| Ga0310887_105119192 | 3300031547 | Soil | MSEQARTPPKRPYASPRLVTYGDIKTLTQNTIVGQKADKGGAQKNRTS |
| Ga0310886_101569711 | 3300031562 | Soil | PTPPKQQYTSPRLITYGDIRTLTQTTIVGQKADKGGAQKNRTA |
| Ga0310886_106839692 | 3300031562 | Soil | MSNDAPKPPKRPYARPRLVTYGDIRTLTQTNLVGQKADKGGAQKNRTS |
| Ga0310907_102837442 | 3300031847 | Soil | MRDEATKPPKQPYTSPRLVTYGDVTTLTQTNLTGQKADKGGAQKNR |
| Ga0310904_106186271 | 3300031854 | Soil | MTDQAPTPPKRPYETPRLVTYGDIKTLTQNNFTGQ |
| Ga0310893_103544512 | 3300031892 | Soil | MSDETPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRT |
| Ga0310900_104484242 | 3300031908 | Soil | MTDQAPTPPKRPYETPRLVTYGDIKTLTQTSLTGQ |
| Ga0310884_101759711 | 3300031944 | Soil | YTSPRLIAYGDIRTLTQTTVVGQKADKGGAQKNRTA |
| Ga0310903_100348321 | 3300032000 | Soil | TPPKRPYETPRLVTYGDIKTLTQNSLTGQKADKGGAQKNRTS |
| Ga0310903_100665622 | 3300032000 | Soil | MSDQAPTPPKRPYASPRLVTYGDIKTLTQTNLTGQKADKGGAQKNRTS |
| Ga0310902_103009692 | 3300032012 | Soil | MTDQAPTPPKRPYETPRLVTYGDIKTLTQTSLTGQKADKGGAQKNRTS |
| Ga0310906_108660982 | 3300032013 | Soil | TISGARDMTDEAPPPPKRPYASPRLVTYGDIRVLTQTTTMGQKSDKGGAQKSRTG |
| Ga0310895_100164752 | 3300032122 | Soil | MTDQAPTPPKRPYETPRLVTYGDIKTLTQTTLTGQKADKGGAQKNRTS |
| Ga0307471_1041215782 | 3300032180 | Hardwood Forest Soil | MSDEAPKPPKRPYSTPKLVTYGDVTTLTQTNLTGQKADKGGAQKNRTN |
| Ga0310896_105478122 | 3300032211 | Soil | MTDDAPTPPKQQYTSPRLITYGDIRTLTQTTLVGQKADKGGAQKNRTA |
| Ga0310812_101233752 | 3300032421 | Soil | DMSDQTPTSPKRPYESPRLVTYGDIKTLTQYSVTGQKADKGGAQKNRTS |
| Ga0310810_1000020554 | 3300033412 | Soil | MSDQTPTSPKRPYESPRLVTYGDIKTLTQFNVTGQKADKGGAQKNRTS |
| ⦗Top⦘ |