| Basic Information | |
|---|---|
| Family ID | F047641 |
| Family Type | Metagenome |
| Number of Sequences | 149 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MEKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 82.09 % |
| % of genes near scaffold ends (potentially truncated) | 15.44 % |
| % of genes from short scaffolds (< 2000 bps) | 69.13 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (44.295 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.846 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.483 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (84.564 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.84% β-sheet: 0.00% Coil/Unstructured: 63.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 10.07 |
| PF00959 | Phage_lysozyme | 2.68 |
| PF11351 | GTA_holin_3TM | 2.68 |
| PF08291 | Peptidase_M15_3 | 2.01 |
| PF07460 | NUMOD3 | 2.01 |
| PF09636 | XkdW | 2.01 |
| PF02801 | Ketoacyl-synt_C | 1.34 |
| PF13539 | Peptidase_M15_4 | 1.34 |
| PF00622 | SPRY | 1.34 |
| PF01541 | GIY-YIG | 0.67 |
| PF09374 | PG_binding_3 | 0.67 |
| PF01019 | G_glu_transpept | 0.67 |
| PF02945 | Endonuclease_7 | 0.67 |
| PF15943 | YdaS_antitoxin | 0.67 |
| PF06067 | DUF932 | 0.67 |
| PF01464 | SLT | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.13 % |
| Unclassified | root | N/A | 30.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002091|JGI24028J26656_1001496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5145 | Open in IMG/M |
| 3300002091|JGI24028J26656_1002040 | All Organisms → cellular organisms → Bacteria | 3952 | Open in IMG/M |
| 3300002091|JGI24028J26656_1004382 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. | 2216 | Open in IMG/M |
| 3300002091|JGI24028J26656_1005194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1966 | Open in IMG/M |
| 3300002092|JGI24218J26658_1021911 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300002161|JGI24766J26685_10048828 | Not Available | 955 | Open in IMG/M |
| 3300002199|metazooDRAFT_1238017 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300002307|JGI24890J29729_1058565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300002307|JGI24890J29729_1080837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300003823|Ga0007875_1014308 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300004448|Ga0065861_1086293 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300004460|Ga0066222_1096614 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300004774|Ga0007794_10115424 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300004807|Ga0007809_10042283 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300005527|Ga0068876_10243243 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300005527|Ga0068876_10724418 | Not Available | 530 | Open in IMG/M |
| 3300005581|Ga0049081_10051370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1560 | Open in IMG/M |
| 3300005582|Ga0049080_10055214 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005584|Ga0049082_10274880 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006641|Ga0075471_10246800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300006641|Ga0075471_10278522 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300008107|Ga0114340_1108665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
| 3300008110|Ga0114343_1210023 | Not Available | 553 | Open in IMG/M |
| 3300008267|Ga0114364_1088040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300009009|Ga0105105_11009754 | Not Available | 517 | Open in IMG/M |
| 3300009068|Ga0114973_10687625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300009151|Ga0114962_10016024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5385 | Open in IMG/M |
| 3300009151|Ga0114962_10397922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300009152|Ga0114980_10210173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300009152|Ga0114980_10407967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300009155|Ga0114968_10135260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1475 | Open in IMG/M |
| 3300009159|Ga0114978_10132267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
| 3300009159|Ga0114978_10262619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300009159|Ga0114978_10503619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300009159|Ga0114978_10538975 | Not Available | 681 | Open in IMG/M |
| 3300009164|Ga0114975_10069165 | Not Available | 2061 | Open in IMG/M |
| 3300009183|Ga0114974_10139378 | Not Available | 1525 | Open in IMG/M |
| 3300010157|Ga0114964_10025062 | All Organisms → Viruses → Predicted Viral | 3352 | Open in IMG/M |
| 3300010157|Ga0114964_10110259 | Not Available | 1360 | Open in IMG/M |
| 3300010158|Ga0114960_10030187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3394 | Open in IMG/M |
| 3300010158|Ga0114960_10171690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
| 3300010158|Ga0114960_10206807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
| 3300010233|Ga0136235_1000830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15467 | Open in IMG/M |
| 3300010334|Ga0136644_10378176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300010354|Ga0129333_10002357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17541 | Open in IMG/M |
| 3300010354|Ga0129333_10096451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2733 | Open in IMG/M |
| 3300010354|Ga0129333_10199552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1820 | Open in IMG/M |
| 3300010885|Ga0133913_10788809 | All Organisms → Viruses → Predicted Viral | 2477 | Open in IMG/M |
| 3300010885|Ga0133913_11226672 | Not Available | 1921 | Open in IMG/M |
| 3300010885|Ga0133913_11411550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
| 3300010885|Ga0133913_11967383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
| 3300010885|Ga0133913_12356157 | Not Available | 1304 | Open in IMG/M |
| 3300010885|Ga0133913_12647865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
| 3300010970|Ga0137575_10015797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1266 | Open in IMG/M |
| 3300011010|Ga0139557_1013536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1564 | Open in IMG/M |
| 3300011116|Ga0151516_10834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13965 | Open in IMG/M |
| 3300011335|Ga0153698_1241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25079 | Open in IMG/M |
| 3300013286|Ga0136641_1058279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300013286|Ga0136641_1060616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300013372|Ga0177922_10673576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2891 | Open in IMG/M |
| 3300014811|Ga0119960_1000479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
| 3300015050|Ga0181338_1015619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
| 3300015050|Ga0181338_1023415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300015050|Ga0181338_1026864 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300017716|Ga0181350_1037443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
| 3300017716|Ga0181350_1154180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300017722|Ga0181347_1141251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300017722|Ga0181347_1192044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300017736|Ga0181365_1174090 | Not Available | 504 | Open in IMG/M |
| 3300017747|Ga0181352_1002945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6116 | Open in IMG/M |
| 3300017747|Ga0181352_1029366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1666 | Open in IMG/M |
| 3300017747|Ga0181352_1092884 | All Organisms → Viruses | 834 | Open in IMG/M |
| 3300017754|Ga0181344_1002936 | Not Available | 5975 | Open in IMG/M |
| 3300017754|Ga0181344_1023407 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
| 3300017754|Ga0181344_1043908 | Not Available | 1342 | Open in IMG/M |
| 3300017754|Ga0181344_1060431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1122 | Open in IMG/M |
| 3300017754|Ga0181344_1139307 | Not Available | 694 | Open in IMG/M |
| 3300017766|Ga0181343_1022834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1923 | Open in IMG/M |
| 3300017777|Ga0181357_1079788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
| 3300017777|Ga0181357_1096176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
| 3300017777|Ga0181357_1304921 | Not Available | 539 | Open in IMG/M |
| 3300017780|Ga0181346_1106608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300017785|Ga0181355_1056285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1666 | Open in IMG/M |
| 3300019784|Ga0181359_1017067 | Not Available | 2706 | Open in IMG/M |
| 3300019784|Ga0181359_1053300 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300019784|Ga0181359_1094025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300019784|Ga0181359_1116378 | Not Available | 962 | Open in IMG/M |
| 3300019784|Ga0181359_1118454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300020172|Ga0211729_10491868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300020197|Ga0194128_10144793 | Not Available | 1365 | Open in IMG/M |
| 3300020200|Ga0194121_10502764 | Not Available | 590 | Open in IMG/M |
| 3300021131|Ga0214206_1002355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3988 | Open in IMG/M |
| 3300021131|Ga0214206_1034581 | Not Available | 573 | Open in IMG/M |
| 3300021519|Ga0194048_10363712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300021961|Ga0222714_10323333 | Not Available | 838 | Open in IMG/M |
| 3300021963|Ga0222712_10002944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19018 | Open in IMG/M |
| 3300022179|Ga0181353_1098124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300022190|Ga0181354_1007251 | Not Available | 3095 | Open in IMG/M |
| 3300022407|Ga0181351_1001102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8523 | Open in IMG/M |
| 3300022407|Ga0181351_1043200 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300022407|Ga0181351_1218785 | Not Available | 620 | Open in IMG/M |
| 3300023174|Ga0214921_10479603 | Not Available | 601 | Open in IMG/M |
| 3300025598|Ga0208379_1072492 | Not Available | 857 | Open in IMG/M |
| 3300025781|Ga0208386_1005479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2351 | Open in IMG/M |
| 3300025872|Ga0208783_10089815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
| 3300027608|Ga0208974_1025842 | All Organisms → Viruses → Predicted Viral | 1798 | Open in IMG/M |
| 3300027734|Ga0209087_1064287 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
| 3300027734|Ga0209087_1080947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
| 3300027741|Ga0209085_1000549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27135 | Open in IMG/M |
| 3300027741|Ga0209085_1106817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| 3300027749|Ga0209084_1009431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6019 | Open in IMG/M |
| 3300027759|Ga0209296_1110592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1295 | Open in IMG/M |
| 3300027763|Ga0209088_10274256 | Not Available | 692 | Open in IMG/M |
| 3300027764|Ga0209134_10245221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300027777|Ga0209829_10125056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
| 3300027785|Ga0209246_10359522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300027793|Ga0209972_10398250 | Not Available | 585 | Open in IMG/M |
| 3300027805|Ga0209229_10004125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6036 | Open in IMG/M |
| 3300027902|Ga0209048_10399810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300027963|Ga0209400_1090437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1450 | Open in IMG/M |
| 3300028025|Ga0247723_1010777 | All Organisms → Viruses → Predicted Viral | 3544 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1237796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300031758|Ga0315907_10000786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 44552 | Open in IMG/M |
| 3300031758|Ga0315907_10241925 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
| 3300031787|Ga0315900_10264384 | Not Available | 1457 | Open in IMG/M |
| 3300031857|Ga0315909_10224136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1467 | Open in IMG/M |
| 3300031857|Ga0315909_10411159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300031857|Ga0315909_10451335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300031857|Ga0315909_10928330 | Not Available | 534 | Open in IMG/M |
| 3300032116|Ga0315903_10059348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3840 | Open in IMG/M |
| 3300032116|Ga0315903_10227832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1630 | Open in IMG/M |
| 3300034064|Ga0335001_0000068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55047 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.04% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 4.70% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.01% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.01% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.01% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.34% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.34% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.34% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.67% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.67% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.67% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.67% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.67% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24028J26656_10014962 | 3300002091 | Lentic | MEKLQISTQLLNSIMAYLGTRPYQEVFQLIEAIQTEAKNQPSVEPTE* |
| JGI24028J26656_10020405 | 3300002091 | Lentic | MDKLLISSQVLNQILGYLGSRPYQEVYQLIEALQAEAKNQPAPPPVSETTD* |
| JGI24028J26656_10043822 | 3300002091 | Lentic | MEKFQLSTQLLNSIMAYLGTRPYQEVFQLIEAIQTEAKNQPPVQPDSEPHE* |
| JGI24028J26656_10051945 | 3300002091 | Lentic | MENFLISTQLLNKILGYLGSRPYQEVFQLIEALQAEAKNQPAPPPVPETTD* |
| JGI24218J26658_10219111 | 3300002092 | Lentic | MEKLQISTQVLNSIMAYLGTRPYQEVFQLIEAIQTEAKNQPSVEPDSEPHE* |
| JGI24766J26685_100488283 | 3300002161 | Freshwater And Sediment | MENMQISVKLLNQILGYLGNRPYTEVFQLVEALQNEAKNQPVAEQEERPGE* |
| metazooDRAFT_12380171 | 3300002199 | Lake | METLQISMQLMNQIIAYLGSRPYQESFQLIQAIQNEASNQPAKDTTPAE* |
| JGI24890J29729_10585653 | 3300002307 | Lentic | MEKLEISTDALNKIFAYLAAKPYQEVFQLIEAIQNEAKNQLVKEERVETHE* |
| JGI24890J29729_10808372 | 3300002307 | Lentic | EKLQISTQLLNSIMAYLGTRPYQEVFQLIEAIQTEAKNQAPVQPESEPHE* |
| Ga0007875_10143082 | 3300003823 | Freshwater | MEKLTLSTQLVNQIMGYLGTKPFQEVFQLIDAINKEAKNQQQTPPTSLE* |
| Ga0065861_10862932 | 3300004448 | Marine | MEKLQVSTQLLNQIMGYLGTRPYQEVFQLIEAIQTEAKNQPSVEPTAEDHE* |
| Ga0066222_10966142 | 3300004460 | Marine | MEKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQAEAKNQPSVEPTAEDHE* |
| Ga0007794_101154242 | 3300004774 | Freshwater | MEKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQKEAKEQPEPTPNE* |
| Ga0007809_100422833 | 3300004807 | Freshwater | MNVSIELLNQILGYLGTRPYQEVFQLINAIQDVAKQTIPAVEPTNPQE* |
| Ga0068876_102432433 | 3300005527 | Freshwater Lake | MKKLLISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKEQPKAENGQPDAN* |
| Ga0068876_107244182 | 3300005527 | Freshwater Lake | MEHMQISVKLLNQVLGYLGNRPYTEVFQLIEALQLEAKNQPQAEQEERPGE* |
| Ga0049081_100513705 | 3300005581 | Freshwater Lentic | MDKLQISTQLLNSIMGYLGTRPYQEVFQLIDAIQKEAKEQPVPELTNE* |
| Ga0049081_100562013 | 3300005581 | Freshwater Lentic | MDKLTLSTQLVNALLGYLGARPYQEVFQLIEALQKEAKNQVPPADGE* |
| Ga0049080_100552142 | 3300005582 | Freshwater Lentic | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPELTNE* |
| Ga0049080_100845861 | 3300005582 | Freshwater Lentic | MDKLTLSTQLVNAVLGYLGARPYQEVFQLIEALQKEAKNQVPPAVDGE |
| Ga0049082_102748802 | 3300005584 | Freshwater Lentic | MEKLQISTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPSVEPTE* |
| Ga0075471_102468002 | 3300006641 | Aqueous | METLQISAQLLNGIIGYLGTRPYQEVFQLVQALQNEVANQPKPDAPAE* |
| Ga0075471_102785221 | 3300006641 | Aqueous | VEKLIISTKLLNQIIGYLGTRPFQEVHQLIQDLQEEAKNQPVSNPEE* |
| Ga0114340_11086653 | 3300008107 | Freshwater, Plankton | MKKLQISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKAQPSEEAKAE* |
| Ga0114343_12100232 | 3300008110 | Freshwater, Plankton | MKKLMISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKDQPKVENGQPDAS* |
| Ga0114364_10880403 | 3300008267 | Freshwater, Plankton | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPSVEPTE* |
| Ga0105105_110097542 | 3300009009 | Freshwater Sediment | MKTLQISEQLLNSIIGYLGTRPYQEVFQLVDAMQAEAKNQPKVEDGQPNAD* |
| Ga0114973_106876253 | 3300009068 | Freshwater Lake | MNNKERHMDKLQISAQLLNQIMGYLGTRPYQEVYQLIEASQKEAKEQPLVEPSPENHE* |
| Ga0114962_100160243 | 3300009151 | Freshwater Lake | MEKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPSPENHE* |
| Ga0114962_103979223 | 3300009151 | Freshwater Lake | MEKLQISAQLLNQIMGYLGTRPYQEVYQLIEAVQNEAKNQPEPKQDE* |
| Ga0114980_102101732 | 3300009152 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLVEAIQKEAKEQPVPELTNE* |
| Ga0114980_104079673 | 3300009152 | Freshwater Lake | MDKITLTTQLVNSVMGYLGTRPYQEVFQLIEAIQNEAKAQPQAEEQKAPE* |
| Ga0114968_101352603 | 3300009155 | Freshwater Lake | MNNKERHMDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPSPENHE* |
| Ga0114978_101322673 | 3300009159 | Freshwater Lake | MEKLQISAQLLNQIMGFLGTRPYQEVYQLIEAIQNEAKNQPTPEPTE* |
| Ga0114978_102626191 | 3300009159 | Freshwater Lake | QLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPELTNE* |
| Ga0114978_105036193 | 3300009159 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPSPENHE* |
| Ga0114978_105389752 | 3300009159 | Freshwater Lake | MEKITLSTNLVNAIIGYLGTRPYQEVFQLVEAMQKEAKEQTPQQDLATE* |
| Ga0114975_100691651 | 3300009164 | Freshwater Lake | MEKLQISAQLLNSLIGYLGTRPYQEVFQLVEALQAEAKNQPEKAPE* |
| Ga0114974_101393783 | 3300009183 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKNQPTPEPTE* |
| Ga0114964_100250623 | 3300010157 | Freshwater Lake | MEKLQVSTQLLNQIMGYLGTRPYQEVFQLIEAIQAEAKNQPSVEPTAEDHE* |
| Ga0114964_101102591 | 3300010157 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE* |
| Ga0114960_100301872 | 3300010158 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPEPKQDE* |
| Ga0114960_101716903 | 3300010158 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAVQNEAKNQPEPKQDE* |
| Ga0114960_102068072 | 3300010158 | Freshwater Lake | MEKLQISAQLLNAVIGYLGTRPYQEVFQLVEALQAEAKSQPVAEKAPE* |
| Ga0136235_100083016 | 3300010233 | Freshwater | MDKLSLSINLVNQVMGYLGTRPYQEVFQLVEAMQKEAQAXXXX* |
| Ga0136644_103781763 | 3300010334 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAVQTEAKNQPEPKQDE* |
| Ga0129333_100023579 | 3300010354 | Freshwater To Marine Saline Gradient | MKKLLITEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKEQPKAENGQPDAN* |
| Ga0129333_100964515 | 3300010354 | Freshwater To Marine Saline Gradient | MTDMKEKAMKTLQISEQLLNALIGYLGTRPYQEVYQLVEAMQKEAKEQPKAENGQPDAN* |
| Ga0129333_101995523 | 3300010354 | Freshwater To Marine Saline Gradient | MKTLQISEQLLNALVGYLGTRPYQEVFQLVEALQNEAKNQPKVEDGKPDAN* |
| Ga0133913_103927983 | 3300010885 | Freshwater Lake | MELKMEIKLSVNLVNQLLGYLGTRPYQEVFQLIEALQTEAKNQPQVEEQKELE* |
| Ga0133913_107888094 | 3300010885 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKE |
| Ga0133913_112266725 | 3300010885 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQP |
| Ga0133913_114115505 | 3300010885 | Freshwater Lake | MEKLQISAQLLNAVIGYLGTRPYQEVFQLVEALQAEAKNQPVAEKAPE* |
| Ga0133913_119673833 | 3300010885 | Freshwater Lake | MEKLQISAQLLNSLIGYLGTRPYQEVFQLVEALQAEAKNQPVAEKAPE* |
| Ga0133913_123561573 | 3300010885 | Freshwater Lake | MKKLQISAQLLNQIIGYLGTRPYQEVYQLIEVIQKEAKEQPLVEPSPENHE* |
| Ga0133913_126478652 | 3300010885 | Freshwater Lake | MDKITLTTQLVNSVMGYLGTRPYQEVFQLIEAIQNEAKTQPQAEEQKAPE* |
| Ga0137575_100157974 | 3300010970 | Pond Fresh Water | MDKLIISTPVLNQVLGYLGTRPYQEVFQLIEALQDEAKNQPTQKTPSE* |
| Ga0139557_10135363 | 3300011010 | Freshwater | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPTPENHE* |
| Ga0151516_1083416 | 3300011116 | Freshwater | MEKLQVSTQLLNQIMAYLGTRPYQEVYQLIEAVQNEAKNQPEPKTDE* |
| Ga0153698_12413 | 3300011335 | Freshwater | MEKLQISTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPTPESVE* |
| Ga0136641_10013439 | 3300013286 | Freshwater | MNDKLSLSVNLLNSVLAYLGSRPYQEVFQLIDALQKEAKEQLEKE* |
| Ga0136641_10582793 | 3300013286 | Freshwater | MDKLIISTQVLNQILGYLGLRPYQEVFQLIEAIQNEAKNQPKKEEQVETHE* |
| Ga0136641_10606162 | 3300013286 | Freshwater | MNELIVSTQTLNQILAYLGSRPYHEVFQLIEAIQSEAKNQPKQENQAENHD* |
| Ga0177922_106735763 | 3300013372 | Freshwater | MDKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE* |
| Ga0119960_10004793 | 3300014811 | Aquatic | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEVAAE* |
| Ga0181338_10156193 | 3300015050 | Freshwater Lake | MEKLQISTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPEPKQDE* |
| Ga0181338_10234153 | 3300015050 | Freshwater Lake | MEKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE* |
| Ga0181338_10268643 | 3300015050 | Freshwater Lake | MNNKERHMDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPTPENHE* |
| Ga0181350_10133721 | 3300017716 | Freshwater Lake | MDKITLSTQLVNAVLGYLGARPYQEVFQLIEGLQNEAK |
| Ga0181350_10374431 | 3300017716 | Freshwater Lake | QLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPEPKQDE |
| Ga0181350_11541803 | 3300017716 | Freshwater Lake | LNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPPPENHE |
| Ga0181347_11412511 | 3300017722 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLV |
| Ga0181347_11920443 | 3300017722 | Freshwater Lake | EMTNNKERHMDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPTPENHE |
| Ga0181365_11740901 | 3300017736 | Freshwater Lake | KLTLSTQLVNQILGYLGTRPYQEVFQLVDALQKEAKDQVQAEEQKAE |
| Ga0181352_10029456 | 3300017747 | Freshwater Lake | MEKLQISAQLLNSLIGYLGTRPYQEVFQLVEALQAEAKNQPVAEKDAE |
| Ga0181352_10293665 | 3300017747 | Freshwater Lake | KEKAMKTLQISEQLLNALIGYLGTRPYQEVFQLVEAMQAEAKAQPSEEAKAE |
| Ga0181352_10928843 | 3300017747 | Freshwater Lake | MKKLLISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKEQ |
| Ga0181344_10029367 | 3300017754 | Freshwater Lake | MDKLIISTPLLNNILGYLGSRPYQEVFQLIEALQNEAKSQPKQEVPSE |
| Ga0181344_10234075 | 3300017754 | Freshwater Lake | SEQLLNAIIGYLGSRPYQEVFQLVEAMQAEAKNQPKEEAKAE |
| Ga0181344_10439082 | 3300017754 | Freshwater Lake | MEHMQISVKLLNQVLGYLGNRPYTEVFQLIEALQLEAKNQPQADQEERPGE |
| Ga0181344_10604314 | 3300017754 | Freshwater Lake | MEKLQLSTQLLNSLMGYLGTRPYQEVFQLIEAIQKEAKEQPSVE |
| Ga0181344_11393071 | 3300017754 | Freshwater Lake | MDKLIISTQLLNSILGYLGSRPYQEVFQLIEALQNEAKSQPKQEVPSE |
| Ga0181343_10228345 | 3300017766 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFHLIEAIQKEAKEQPVPELTNE |
| Ga0181357_10797881 | 3300017777 | Freshwater Lake | MEKLQISTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEVAAE |
| Ga0181357_10961763 | 3300017777 | Freshwater Lake | QLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE |
| Ga0181357_13049212 | 3300017777 | Freshwater Lake | MDKLQISTQLLNQIMGYLGARPYQEVFQLIEAIQKEAKEQPVPEITN |
| Ga0181346_11066082 | 3300017780 | Freshwater Lake | MEKIQLSTQLLNQLLGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE |
| Ga0181355_10562852 | 3300017785 | Freshwater Lake | MDKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE |
| Ga0181359_10170676 | 3300019784 | Freshwater Lake | MDKLTLSTQLVNQILGYLGTRPYQEVFQLVDALQKEAKDQVQAEEQKAE |
| Ga0181359_10533003 | 3300019784 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPTPENHE |
| Ga0181359_10808112 | 3300019784 | Freshwater Lake | MDKLTLSTQLVNALLGYLGARPYQEVFQLIEALQKEAKNQVPPAVDGE |
| Ga0181359_10940252 | 3300019784 | Freshwater Lake | MEKLQISTQLLNQIMGYLGTCPYQEVFQLIEAIQKEAKEQPVPEITNE |
| Ga0181359_11163783 | 3300019784 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPELTNE |
| Ga0181359_11184542 | 3300019784 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPSVEPTE |
| Ga0194113_101705342 | 3300020074 | Freshwater Lake | MKTLAISEKLLNAILGYLGARPYQEVFQLIEALQTEAKNQPQDNGQNSEPVQ |
| Ga0194111_105165373 | 3300020083 | Freshwater Lake | VGERKIMKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQAEAKNQPQDNGQNSEPVQ |
| Ga0194112_103901893 | 3300020109 | Freshwater Lake | MKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQAEAKNQPQDNGQNSEPVQ |
| Ga0211729_104918681 | 3300020172 | Freshwater | MEKITLSTQLVNAVLGYLGTRPYQEVFQIIEALQNEAKNQPKPEVQTE |
| Ga0194131_100628381 | 3300020193 | Freshwater Lake | MKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQTEAKNQPQDNGQNSEPV |
| Ga0194131_101050383 | 3300020193 | Freshwater Lake | MKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQTEAKNQPQDNGQ |
| Ga0194131_101206473 | 3300020193 | Freshwater Lake | MKTLAISEKLLNAILGYLGARPYQEVFQLIEALQAEAKNQPQEGGQHSDAGA |
| Ga0194128_100268444 | 3300020197 | Freshwater Lake | MKTLQVSEKLLNAILGYLGSRPYQEVFQLIEALQAEAKNQPQDNGQNSEPVQ |
| Ga0194128_101447933 | 3300020197 | Freshwater Lake | MKTLQISEQLLNAILGYLGSRPYQEVFQLIEALQTEAKNQAKDNGHPNIN |
| Ga0194121_100685931 | 3300020200 | Freshwater Lake | MKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQAEAKNQPQD |
| Ga0194121_104580471 | 3300020200 | Freshwater Lake | VGERKIMKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQTEAKNQPQDNGQNSEPV |
| Ga0194121_105027643 | 3300020200 | Freshwater Lake | IPKETMKTLQISEQLLNAILGYLGSRPYQEVFQLIEALQTEAKNQAKDNGQPNTN |
| Ga0194126_107185841 | 3300020603 | Freshwater Lake | VGERKIMKTLQVSEKLLNAILGYLGSRPYGEVFQLIEALQTEAKNQPQD |
| Ga0214206_10023557 | 3300021131 | Freshwater | MEKLQISTQLLNQLMAYLGTRPYQEVYQVIEAIQNEAKNQPLVEPSPEAHE |
| Ga0214206_10345812 | 3300021131 | Freshwater | MEKLQISTQLVNAMLAYLGTKPFQEVFQLISAIQAEANNQAKPEAPAAEPVPAPAEEPNV |
| Ga0194048_103637123 | 3300021519 | Anoxic Zone Freshwater | MEKLQISAQLLNAVIGYLGTRPYQEVFQLVEALQAEAKNQPEKAPE |
| Ga0222714_103233333 | 3300021961 | Estuarine Water | MKTLQISEQLLNSIIGYLGTRPYQEVFQLVEAMQAEAKNQPKDEAKAE |
| Ga0222712_100029444 | 3300021963 | Estuarine Water | MDKLIISTPVLNNILAYLGSRPYQEVFQLIEALQNEAKNQPKQETPSE |
| Ga0181353_10981244 | 3300022179 | Freshwater Lake | LLNSIIGYLGTRPYQEVFQLVEALQAEAKNQPVAEKAAE |
| Ga0181354_10072513 | 3300022190 | Freshwater Lake | MEKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEITNE |
| Ga0181351_10011025 | 3300022407 | Freshwater Lake | MEKLQISTQLLNQIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEVAAE |
| Ga0181351_10432005 | 3300022407 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPPPENHE |
| Ga0181351_12187852 | 3300022407 | Freshwater Lake | MDKLQISTQLLNQIMGYLGARPYQEVFQLIEAIQKEAKEQPVPEIANE |
| Ga0214921_104796032 | 3300023174 | Freshwater | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEVAAE |
| Ga0208379_10724923 | 3300025598 | Freshwater | MNVSIELLNQILGYLGTRPYQEVFQLINAIQDVAKQTIPAVEPTNPQE |
| Ga0208386_10054791 | 3300025781 | Freshwater | MEKLQISTNLINGLLSYLGSRPYQEVFQLIEGIQTEARNQ |
| Ga0208783_100898152 | 3300025872 | Aqueous | METLQISAQLLNGIIGYLGTRPYQEVFQLVQALQNEVANQPKPDAPAE |
| Ga0208974_10258424 | 3300027608 | Freshwater Lentic | MDKLQISTQLLNSIMGYLGTRPYQEVFQLIDAIQKEAKEQPVPELTNE |
| Ga0209087_10642872 | 3300027734 | Freshwater Lake | MEKLQISAQLLNQIMGFLGTRPYQEVYQLIEAIQNEAKNQPTPEPTE |
| Ga0209087_10809471 | 3300027734 | Freshwater Lake | MDKITLTTQLVNSVMGYLGTRPYQEVFQLIEAIQNEAKTQPQAEEQKAPE |
| Ga0209085_10005498 | 3300027741 | Freshwater Lake | MEKLQVSTQLLNQIMGYLGTRPYQEVFQLIEAIQAEAKNQPSVEPTAEDHE |
| Ga0209085_11068172 | 3300027741 | Freshwater Lake | MEKLQISAQLLNQIMGYLGTRPYQEVYQLIEAVQNEAKNQPEPKQDE |
| Ga0209084_100943110 | 3300027749 | Freshwater Lake | MEKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPSPENHE |
| Ga0209296_11105924 | 3300027759 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKNQPTPEPTE |
| Ga0209088_102742561 | 3300027763 | Freshwater Lake | MDKITLTTQLVNSVMGYLGTRPYQEVFQLIEAIQNEAKAQPQAEEQKAPE |
| Ga0209134_102452211 | 3300027764 | Freshwater Lake | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPELTN |
| Ga0209829_101250563 | 3300027777 | Freshwater Lake | MKKLQISAQLLNQIIGYLGTRPYQEVYQLIEVIQKEAKEQPLVEPSPENHE |
| Ga0209246_100648912 | 3300027785 | Freshwater Lake | MAMDKLTLSTQLVNALLGYLGARPYQEVFQLIEALQKEAKNQVPPAVDGE |
| Ga0209246_103595223 | 3300027785 | Freshwater Lake | QISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPTPENHE |
| Ga0209972_103982502 | 3300027793 | Freshwater Lake | MKKLLISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKEQPKAENGQPDAN |
| Ga0209229_100041257 | 3300027805 | Freshwater And Sediment | MENMQISVKLLNQILGYLGNRPYTEVFQLVEALQNEAKNQPVAEQEERPGE |
| Ga0209048_103998102 | 3300027902 | Freshwater Lake Sediment | MEKLQISTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPTPEPTE |
| Ga0209400_10904373 | 3300027963 | Freshwater Lake | MDKLQISAQLLNQIMGYLGTRPYQEVYQLIEAIQKEAKEQPLVEPSPENHE |
| Ga0247723_10107775 | 3300028025 | Deep Subsurface Sediment | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQ |
| (restricted) Ga0247832_12377962 | 3300028557 | Freshwater | MEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKEQPVPEIANE |
| Ga0315907_1000078624 | 3300031758 | Freshwater | MENFNISLQLINQVLAYLGTRPYQEVFQLVEAIQAEAKNQQKVENGQSDAS |
| Ga0315907_102419253 | 3300031758 | Freshwater | MKKLMISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKDQPKVENGQPDAS |
| Ga0315900_102643842 | 3300031787 | Freshwater | MEHMQISVKLLNQVLGYLGNRPYTEVFQLIEALQLEAKNQPQAEQEERPGE |
| Ga0315909_102241365 | 3300031857 | Freshwater | KLQISEQLLNAIIGYLGTRPYQEVFQLVEALQAEAKNQPKAENGQPDAS |
| Ga0315909_104111592 | 3300031857 | Freshwater | MKKLQISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKAQPSEEAKAE |
| Ga0315909_104513352 | 3300031857 | Freshwater | MKKLQISEQLLNGIIGYLGTRPYQEVFQLVEALQAEAKEQPKVEDGQPIAD |
| Ga0315909_109283302 | 3300031857 | Freshwater | MKRLLITEQLLNGIIGYLGTRPYQEVFQLVEALQAEAKDQPVAEKAAE |
| Ga0315903_100593488 | 3300032116 | Freshwater | MKKLQISEQLLNAIIGYLGTRPYQEVFQLVEALQAEAKNQPKAENGQPDAS |
| Ga0315903_102278322 | 3300032116 | Freshwater | MKKLMISEQLLNAIIGYLGTRPYQEVFQLVEAMQAEAKDQPKAENGQPDAS |
| Ga0335001_0000068_52767_52922 | 3300034064 | Freshwater | MKKLLITEQLLNAIIGYLGTRPYQEVFQLVEALQAEAKDQPKADDGQPNAN |
| ⦗Top⦘ |