NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047624

Metagenome / Metatranscriptome Family F047624

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047624
Family Type Metagenome / Metatranscriptome
Number of Sequences 149
Average Sequence Length 42 residues
Representative Sequence MGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Number of Associated Samples 110
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.07 %
% of genes near scaffold ends (potentially truncated) 91.95 %
% of genes from short scaffolds (< 2000 bps) 92.62 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.718 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.188 % of family members)
Environment Ontology (ENVO) Unclassified
(42.282 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.322 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.29%    β-sheet: 0.00%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF00724Oxidored_FMN 4.03
PF07813LTXXQ 2.01
PF04392ABC_sub_bind 2.01
PF06147DUF968 2.01
PF02518HATPase_c 2.01
PF03401TctC 1.34
PF13091PLDc_2 1.34
PF13358DDE_3 1.34
PF00664ABC_membrane 0.67
PF00292PAX 0.67
PF04545Sigma70_r4 0.67
PF03308MeaB 0.67
PF08281Sigma70_r4_2 0.67
PF13592HTH_33 0.67
PF00211Guanylate_cyc 0.67
PF01243Putative_PNPOx 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 8.05
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 4.03
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 4.03
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.01
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.34
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.72 %
UnclassifiedrootN/A42.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002917|JGI25616J43925_10274470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300005167|Ga0066672_10019491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3519Open in IMG/M
3300005167|Ga0066672_10430462Not Available862Open in IMG/M
3300005332|Ga0066388_102228985All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium989Open in IMG/M
3300005332|Ga0066388_103202168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7836Open in IMG/M
3300005332|Ga0066388_108491764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria511Open in IMG/M
3300005436|Ga0070713_100981057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300005468|Ga0070707_101286345Not Available698Open in IMG/M
3300005468|Ga0070707_101950253Not Available555Open in IMG/M
3300005471|Ga0070698_102099388Not Available518Open in IMG/M
3300005535|Ga0070684_100444773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1197Open in IMG/M
3300005543|Ga0070672_100086621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2519Open in IMG/M
3300005552|Ga0066701_10832684Not Available549Open in IMG/M
3300005713|Ga0066905_100551996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7967Open in IMG/M
3300005713|Ga0066905_101038890Not Available724Open in IMG/M
3300005713|Ga0066905_101741889Not Available573Open in IMG/M
3300005713|Ga0066905_101747942Not Available572Open in IMG/M
3300005764|Ga0066903_100640272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1855Open in IMG/M
3300005764|Ga0066903_103081939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium902Open in IMG/M
3300005764|Ga0066903_105360006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300005764|Ga0066903_107029425Not Available583Open in IMG/M
3300005764|Ga0066903_107949895Not Available544Open in IMG/M
3300005764|Ga0066903_108949685Not Available507Open in IMG/M
3300006038|Ga0075365_10418931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium945Open in IMG/M
3300006755|Ga0079222_10550980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria863Open in IMG/M
3300006797|Ga0066659_10408670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71069Open in IMG/M
3300006881|Ga0068865_100059397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2674Open in IMG/M
3300006953|Ga0074063_10125444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1108Open in IMG/M
3300007255|Ga0099791_10508139Not Available585Open in IMG/M
3300009090|Ga0099827_10067538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2748Open in IMG/M
3300009101|Ga0105247_10158037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1499Open in IMG/M
3300009137|Ga0066709_101731370Not Available884Open in IMG/M
3300009162|Ga0075423_12050560Not Available620Open in IMG/M
3300010048|Ga0126373_10505289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1252Open in IMG/M
3300010048|Ga0126373_12364064Not Available591Open in IMG/M
3300010048|Ga0126373_13002346Not Available526Open in IMG/M
3300010359|Ga0126376_12121556Not Available606Open in IMG/M
3300010360|Ga0126372_12426938Not Available575Open in IMG/M
3300010362|Ga0126377_10333696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1507Open in IMG/M
3300010362|Ga0126377_13611882Not Available500Open in IMG/M
3300010366|Ga0126379_11712448All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300010376|Ga0126381_103315737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium635Open in IMG/M
3300010398|Ga0126383_10664686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71118Open in IMG/M
3300010398|Ga0126383_11146197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium867Open in IMG/M
3300010398|Ga0126383_12312104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300010398|Ga0126383_12617746Not Available588Open in IMG/M
3300010398|Ga0126383_13079128Not Available544Open in IMG/M
3300012096|Ga0137389_10927291Not Available747Open in IMG/M
3300012200|Ga0137382_11340460Not Available504Open in IMG/M
3300012201|Ga0137365_10216440All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300012205|Ga0137362_11535469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300012206|Ga0137380_11561665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300012208|Ga0137376_11047154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300012209|Ga0137379_11320768Not Available626Open in IMG/M
3300012211|Ga0137377_11908118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300012355|Ga0137369_10067726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3036Open in IMG/M
3300012358|Ga0137368_10388313Not Available919Open in IMG/M
3300012582|Ga0137358_10772965Not Available640Open in IMG/M
3300012885|Ga0157287_1102391Not Available533Open in IMG/M
3300012914|Ga0157297_10232473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300012918|Ga0137396_10651934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium778Open in IMG/M
3300012930|Ga0137407_11315180Not Available687Open in IMG/M
3300012951|Ga0164300_10456584Not Available718Open in IMG/M
3300012955|Ga0164298_10039307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2194Open in IMG/M
3300015077|Ga0173483_10058238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1501Open in IMG/M
3300015373|Ga0132257_103230810Not Available593Open in IMG/M
3300016270|Ga0182036_10748226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria793Open in IMG/M
3300016270|Ga0182036_11342507Not Available597Open in IMG/M
3300016270|Ga0182036_11713110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300016294|Ga0182041_10213126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1547Open in IMG/M
3300016294|Ga0182041_11589647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300016294|Ga0182041_12135873Not Available523Open in IMG/M
3300016319|Ga0182033_11228377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300016341|Ga0182035_10494736Not Available1043Open in IMG/M
3300016341|Ga0182035_10554518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria988Open in IMG/M
3300016341|Ga0182035_11500094Not Available607Open in IMG/M
3300016341|Ga0182035_11557298Not Available595Open in IMG/M
3300016341|Ga0182035_12011300Not Available525Open in IMG/M
3300016387|Ga0182040_10354236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1139Open in IMG/M
3300016387|Ga0182040_11595418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300016404|Ga0182037_11471451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300016404|Ga0182037_12046054Not Available514Open in IMG/M
3300018055|Ga0184616_10146904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium869Open in IMG/M
3300018482|Ga0066669_11851401Not Available560Open in IMG/M
3300019362|Ga0173479_10046622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1401Open in IMG/M
3300020005|Ga0193697_1097061Not Available706Open in IMG/M
3300020170|Ga0179594_10307969Not Available600Open in IMG/M
3300021432|Ga0210384_11504080Not Available579Open in IMG/M
3300021560|Ga0126371_11415755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis826Open in IMG/M
3300021560|Ga0126371_12887427Not Available582Open in IMG/M
3300021951|Ga0222624_1035202Not Available707Open in IMG/M
3300025909|Ga0207705_10438711Not Available1012Open in IMG/M
3300025928|Ga0207700_11503537Not Available597Open in IMG/M
3300025986|Ga0207658_11925747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300026067|Ga0207678_11725725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300026312|Ga0209153_1189902Not Available731Open in IMG/M
3300026319|Ga0209647_1190184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300026328|Ga0209802_1146567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300027884|Ga0209275_10229629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1012Open in IMG/M
3300027915|Ga0209069_11049908Not Available503Open in IMG/M
3300028906|Ga0308309_11258523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300031082|Ga0308192_1082504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031543|Ga0318516_10686869Not Available581Open in IMG/M
3300031546|Ga0318538_10376526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria767Open in IMG/M
3300031561|Ga0318528_10043510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2254Open in IMG/M
3300031561|Ga0318528_10116957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1408Open in IMG/M
3300031573|Ga0310915_10258720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.31225Open in IMG/M
3300031680|Ga0318574_10636843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300031723|Ga0318493_10770887Not Available541Open in IMG/M
3300031748|Ga0318492_10639859Not Available568Open in IMG/M
3300031763|Ga0318537_10108580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1029Open in IMG/M
3300031763|Ga0318537_10269132All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031764|Ga0318535_10000791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8017Open in IMG/M
3300031765|Ga0318554_10671069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300031768|Ga0318509_10741246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300031770|Ga0318521_10817227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300031778|Ga0318498_10423481Not Available590Open in IMG/M
3300031779|Ga0318566_10505904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031779|Ga0318566_10624453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300031781|Ga0318547_10720186Not Available620Open in IMG/M
3300031792|Ga0318529_10459357Not Available592Open in IMG/M
3300031796|Ga0318576_10508088Not Available568Open in IMG/M
3300031805|Ga0318497_10544558Not Available650Open in IMG/M
3300031821|Ga0318567_10691938Not Available578Open in IMG/M
3300031831|Ga0318564_10331421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300031879|Ga0306919_10367051Not Available1101Open in IMG/M
3300031879|Ga0306919_10892919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300031880|Ga0318544_10286075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300031897|Ga0318520_10191378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1203Open in IMG/M
3300031897|Ga0318520_11033015Not Available520Open in IMG/M
3300031912|Ga0306921_12073377Not Available603Open in IMG/M
3300031942|Ga0310916_10154767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621894Open in IMG/M
3300031942|Ga0310916_11551761Not Available539Open in IMG/M
3300031945|Ga0310913_10084172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2127Open in IMG/M
3300031946|Ga0310910_10275328All Organisms → cellular organisms → Bacteria → Proteobacteria1320Open in IMG/M
3300031947|Ga0310909_11447141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131549Open in IMG/M
3300031954|Ga0306926_10654130All Organisms → cellular organisms → Bacteria → Proteobacteria1278Open in IMG/M
3300032001|Ga0306922_10596685All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300032010|Ga0318569_10396373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium643Open in IMG/M
3300032039|Ga0318559_10030661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2146Open in IMG/M
3300032044|Ga0318558_10471490Not Available626Open in IMG/M
3300032052|Ga0318506_10057834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1582Open in IMG/M
3300032052|Ga0318506_10411721Not Available599Open in IMG/M
3300032065|Ga0318513_10381888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense687Open in IMG/M
3300032065|Ga0318513_10554671Not Available562Open in IMG/M
3300032090|Ga0318518_10591815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300032090|Ga0318518_10624659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300032261|Ga0306920_100297256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2405Open in IMG/M
3300033289|Ga0310914_11790695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.34%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.67%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25616J43925_1027447013300002917Grasslands SoilLNMGSPLYRIRLSETKLPKEEVGKIVRQMQSESKIVDFIAAKE*
Ga0066672_1001949163300005167SoilEGPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE*
Ga0066672_1043046213300005167SoilLRGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE*
Ga0066388_10222898513300005332Tropical Forest SoilGGRLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIAAKE*
Ga0066388_10320216813300005332Tropical Forest SoilPLNMGGQLYRIRLSETKLPQDEVGRIIREMQSDSKVVGFIAAKE*
Ga0066388_10849176423300005332Tropical Forest SoilPLNMGGRLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIIAKE*
Ga0070713_10098105713300005436Corn, Switchgrass And Miscanthus RhizosphereMGNPLYVIRLSETKLPKEEVDNIIKQMQSESKIVDFIAVK*
Ga0070707_10128634513300005468Corn, Switchgrass And Miscanthus RhizosphereGPLRGQLYRIRLSETKLREEEVGKIVRQMQSESNVVSFIAAKE*
Ga0070707_10195025313300005468Corn, Switchgrass And Miscanthus RhizospherePLNMGGQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAAKE*
Ga0070698_10209938813300005471Corn, Switchgrass And Miscanthus RhizosphereRGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVAFIAAKE*
Ga0070684_10044477323300005535Corn RhizosphereVEGPLNMGGQLYRIRLSEAKLPRDEVGKIIRQMQEESKVVGFIAVNE*
Ga0070672_10008662113300005543Miscanthus RhizosphereMGGQLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE*
Ga0066701_1083268423300005552SoilLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE*
Ga0066905_10055199623300005713Tropical Forest SoilEGPLNMGGQLYRIRLSETKLPQDEVGRIIREMQSDSKVVGFIAAKE*
Ga0066905_10103889013300005713Tropical Forest SoilLNMGGQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAAKE*
Ga0066905_10174188913300005713Tropical Forest SoilLNMGGQLYRIRLSETKLPKDEVGKIVRQMQAESKVVGFIAARE*
Ga0066905_10174794223300005713Tropical Forest SoilGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIAAEK*
Ga0066903_10064027243300005764Tropical Forest SoilPLNMGGQLYRIRLSETKLPQDEVGKIIQQMQSESKVVGFVAAKE*
Ga0066903_10308193933300005764Tropical Forest SoilLKDRLNGQLYRIRLSETKLPTEEVGKIVRQMQSESNVVNFIAAK
Ga0066903_10536000613300005764Tropical Forest SoilQLYRIRLSETKLPKDEVGRIVRQMQAESKVVGFIAARE*
Ga0066903_10702942513300005764Tropical Forest SoilVDGPLRAGGSLYRIRLSESRLPKDEVDRIVRSMHEESKVVAFIAAAD*
Ga0066903_10794989523300005764Tropical Forest SoilLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE*
Ga0066903_10894968523300005764Tropical Forest SoilMGGQLYRIRISGTKLPKEEVDQIVRQTQSESKVVDYIAVEE*
Ga0075365_1041893113300006038Populus EndosphereGQLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE*
Ga0079222_1055098013300006755Agricultural SoilQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAAKE*
Ga0066659_1040867023300006797SoilEGPLNMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVGFVAAKE*
Ga0068865_10005939743300006881Miscanthus RhizosphereQLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE*
Ga0074063_1012544433300006953SoilPLNMGGQLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE*
Ga0099791_1050813923300007255Vadose Zone SoilPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAVKE*
Ga0099827_1006753813300009090Vadose Zone SoilVVEGPLNMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIACR*
Ga0105247_1015803713300009101Switchgrass RhizosphereMGGQLYRIRLSEAKLPRDEVGKIIRQMQEESKVVGFIAVNE*
Ga0066709_10173137013300009137Grasslands SoilLNMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIVAKE*
Ga0075423_1205056013300009162Populus RhizosphereQLYRIRLSETTLPKDEVGKIVQQMQAESKVVGFIAARD*
Ga0126373_1050528943300010048Tropical Forest SoilKGQLYRIRLSNTKLPQEEVGNLVSQMQSESKVVEFIAAKE*
Ga0126373_1236406413300010048Tropical Forest SoilYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE*
Ga0126373_1300234613300010048Tropical Forest SoilIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE*
Ga0126376_1212155613300010359Tropical Forest SoilNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIIGFIAAKE*
Ga0126372_1242693813300010360Tropical Forest SoilQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE*
Ga0126377_1033369623300010362Tropical Forest SoilVVDGPLNIGGPAYRVRLSETKLQEDEVDKIVRQMQSESKIVDFIAAKE*
Ga0126377_1361188213300010362Tropical Forest SoilVVEGPLRGQLYRIRLSETKLPKEEVGKIVRQIQSESNVVNFIAAKE*
Ga0126379_1171244833300010366Tropical Forest SoilGQLYRIRLSETKLPREEVGKIVRQMQSESNVVGFIAAKE*
Ga0126381_10331573723300010376Tropical Forest SoilVVEGPLNMGGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIAAEK*
Ga0126383_1066468613300010398Tropical Forest SoilRIRLSETKLPKDEVGKIVQQMQAESKVVGFIAARE*
Ga0126383_1114619723300010398Tropical Forest SoilPLEGQLYRIRLSKTKLPQEEVGNLVSQMQSESKVVDFIAAKE*
Ga0126383_1231210413300010398Tropical Forest SoilLEGQLYRIRLSKTKLPQEEVGNLVSQMQSESKVVDFIAAKE*
Ga0126383_1261774613300010398Tropical Forest SoilRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE*
Ga0126383_1307912813300010398Tropical Forest SoilLYRIRLSETKLPKDEVGKIVQQMQAESKVVGFIAARE*
Ga0137389_1092729113300012096Vadose Zone SoilIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE*
Ga0137382_1134046013300012200Vadose Zone SoilVEGPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAARE*
Ga0137365_1021644013300012201Vadose Zone SoilKMGGPVYRVRLSETKLPKEEVGKIVRQMQSESKIVDFIAAEE*
Ga0137362_1153546923300012205Vadose Zone SoilGPLNMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIAAKE*
Ga0137380_1156166523300012206Vadose Zone SoilMGGQLYRIRLFETKLPKEEVGKIVRQMQSESKVVDFIAAKE*
Ga0137376_1104715413300012208Vadose Zone SoilMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKIIDFIAAKE*
Ga0137379_1132076823300012209Vadose Zone SoilYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE*
Ga0137377_1190811813300012211Vadose Zone SoilEGPLNMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVGFIAARE*
Ga0137369_1006772643300012355Vadose Zone SoilVEGPLNMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVGFVAAKE*
Ga0137368_1038831313300012358Vadose Zone SoilLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE*
Ga0137358_1077296513300012582Vadose Zone SoilMGGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIAAK
Ga0157287_110239123300012885SoilVVEGPLRGQLYRIRLSEIKLPKEEVGKIVRQMQSESKVVAFIAAKE*
Ga0157297_1023247313300012914SoilPLNMGGQLYRIRLSEAKLPRDEVGKIIRQMQEESKVVGFIAVNE*
Ga0137396_1065193413300012918Vadose Zone SoilMGSPLYRIRLSETKLPKEEVGKIVRQMQSESKIVDFIAAKE*
Ga0137407_1131518013300012930Vadose Zone SoilGPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE*
Ga0164300_1045658423300012951SoilYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE*
Ga0164298_1003930743300012955SoilGGQLYRIRLSEAKLPRDEVGKIIRQMQEESKVVGFIAVNE*
Ga0173483_1005823833300015077SoilLYRIRLSETKLPKEEVGKIVRQMQSESKVVAFIAAKE*
Ga0132257_10323081013300015373Arabidopsis RhizosphereIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE*
Ga0182036_1074822623300016270SoilGPLKGQLYRIRLSETKLPKEEVGKIVREMQSESNVVNFIAAQE
Ga0182036_1134250713300016270SoilGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIAAEE
Ga0182036_1171311023300016270SoilMGGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIA
Ga0182041_1021312613300016294SoilLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAQE
Ga0182041_1158964713300016294SoilNMGGQLYRIRLSETKLPKDEVGKIVRQMQAESKVVGFIAARE
Ga0182041_1213587313300016294SoilPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0182033_1122837723300016319SoilMGGPVYRIRIAGTKLPKEEVGKIVRQMQSESKIVDYIA
Ga0182035_1049473623300016341SoilKGQLYRIRLSETKLPTEEVGKIVRQMQSESNVVNFITAKE
Ga0182035_1055451823300016341SoilLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAQE
Ga0182035_1150009413300016341SoilPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0182035_1155729823300016341SoilVVEGPKQFGLYTIKLSETKLPADEVNKIVRQMQEESKIVSLVAVKQ
Ga0182035_1201130013300016341SoilGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0182040_1035423613300016387SoilGPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVDFIAAKE
Ga0182040_1159541813300016387SoilGPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0182037_1147145123300016404SoilEGPLNMGGRLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIVAKE
Ga0182037_1204605413300016404SoilNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0184616_1014690423300018055Groundwater SedimentPLNMGGQLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE
Ga0066669_1185140113300018482Grasslands SoilVEGPLKGQLYRVRLSETRLPKEEVGKIIRQMQSESNVVGFVAAKE
Ga0173479_1004662243300019362SoilVVEGPLRGQLYRIRLSEIKLPKEEVGKIVRQMQSESKVVAFIAAKE
Ga0193697_109706113300020005SoilLYRIRLSEARLPKDEVGKIIRQMQGESKVVGFIAVNE
Ga0179594_1030796913300020170Vadose Zone SoilEGPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAVKE
Ga0210384_1150408013300021432SoilPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQSESKVVGFIAVRE
Ga0126371_1141575513300021560Tropical Forest SoilVVEGPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVAFIAAKE
Ga0126371_1288742713300021560Tropical Forest SoilQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0222624_103520223300021951Groundwater SedimentPLNMGGQLYRIRLSEAKLPKDEVGKIIRQMQEESKVVGFIAVNE
Ga0207705_1043871113300025909Corn RhizosphereLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE
Ga0207700_1150353713300025928Corn, Switchgrass And Miscanthus RhizosphereLRGQLYRIRLSETKLPKEEVGKIVRQMQSESKVVAFIAAKE
Ga0207658_1192574713300025986Switchgrass RhizosphereGPLNMGGQLYRIRLSEAKLPKDEVGKIIRQMQGESKVVGFIAVNE
Ga0207678_1172572513300026067Corn RhizosphereLNMGGQLYRIRLSEAKLPRDEVGKIIRQMQEESKVVGFIAVNE
Ga0209153_118990223300026312SoilQLYRIRLSETKLPREEVGKIVRQMQSESNVVGFIAAKE
Ga0209647_119018423300026319Grasslands SoilLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIAAKE
Ga0209802_114656723300026328SoilMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0209275_1022962933300027884SoilAGGGLYRIRLAENPLPPNDVGKIVRQMQEESRIVGFIAAAD
Ga0209069_1104990813300027915WatershedsLYRIRLSEAKLPKDEVGKIIRQMQEESKVVGFIAVNE
Ga0308309_1125852313300028906SoilGPLNMGGQLYRIRLSDTKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0308192_108250423300031082SoilMGGQLYRIRLSEAKLPKDEVGKIIRQMQEESKVVGFIAVNE
Ga0318516_1068686913300031543SoilRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318538_1037652613300031546SoilLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE
Ga0318528_1004351013300031561SoilVEGPLRGQLYRIRLSETKLPKEEAGKIVRQMQSESNVVNFIAAKE
Ga0318528_1011695723300031561SoilGQLYRIRLSEIKLPTEEVGKIVRQMQSESNVVNFIAAKE
Ga0310915_1025872023300031573SoilVVEGPLNMGGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIAAEE
Ga0318574_1063684313300031680SoilGPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVDFIAANE
Ga0318493_1077088713300031723SoilVVEGPLRGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE
Ga0318492_1063985923300031748SoilPLNMGGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIAAEE
Ga0318537_1010858023300031763SoilMGGPVYRIRISGTKLPKEEVGKIVRQMQSESKIVDYIAAEE
Ga0318537_1026913213300031763SoilLYRIRLSGTKLPKEEVDKIVRQMQSESKVVDYIAAKE
Ga0318535_10000791103300031764SoilNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318554_1067106923300031765SoilGGQLYRIRLSDTKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0318509_1074124613300031768SoilGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIIGFIAAKD
Ga0318521_1081722713300031770SoilMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIIGFIAAKD
Ga0318498_1042348113300031778SoilGGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318566_1050590423300031779SoilQGPLNMGGRLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIVAKE
Ga0318566_1062445313300031779SoilQLYRIRLSETKLPKDEVGKIVRQMQAESKVVGFIAARE
Ga0318547_1072018613300031781SoilVEGPLRGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE
Ga0318529_1045935723300031792SoilLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318576_1050808813300031796SoilVEGPLEGQLYRIRLSETRLPKEEVGKIIRQMQSESNVVGFVAAKE
Ga0318497_1054455813300031805SoilVEGPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318567_1069193823300031821SoilLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0318564_1033142113300031831SoilNMGGRLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIVAKE
Ga0306919_1036705133300031879SoilGPVYRIRISGTKLPKEEVGKIVGQMHSESKIVDYIAAEE
Ga0306919_1089291913300031879SoilEGPLKGQLYRIRLSETKLPKEEVGKLVRQMQSESNVVDFIAAKE
Ga0318544_1028607523300031880SoilPLKGQLYRIRLSEIKLPTEEVGKIVRQMQSESNVVNFIAAKE
Ga0318520_1019137833300031897SoilAWVFEGPLKGQLSRIRLSETKLPTEEVGKIVRQMQSESNVVGFVAAKE
Ga0318520_1103301513300031897SoilLYRIRLSETKLPKEEVGKIVRQMQSESNVVPFIAAKE
Ga0306921_1207337713300031912SoilMGGPVYRIRISGTKLPKEEVGRIVRQIQSESKVVDYIAAEE
Ga0310916_1015476713300031942SoilLYRIRLSETKLREEEVGKIVRQMRSESNVVSFIAAKE
Ga0310916_1155176113300031942SoilLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVAFIAAKE
Ga0310913_1008417213300031945SoilGQLYRIRLSETRLPKEEVGKIIRQMQSESNVVGFVAAKE
Ga0310910_1027532823300031946SoilRIRLSETKLPKEEVGKIVRQMQSESKVVDFIAAKE
Ga0310909_1144714113300031947SoilAKVVDGPMGGQLYRIRLSETKLPKEEVDQIVRQTESESKVVDYIAAEE
Ga0306926_1065413013300031954SoilEGPLNMGGRLYRIRLSETKLPKEEVGKIVRQMQSESKVVDFIAAKE
Ga0306922_1059668513300032001SoilEGPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVAFIAAKE
Ga0318569_1039637323300032010SoilGGRLYRIRLSETKLPKEEVAKIVRQMQSESKVVDFIVAKE
Ga0318559_1003066113300032039SoilPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFIAAKE
Ga0318558_1047149013300032044SoilATVVEGPLRGQLYRIRLSETKLPKEEVGKIVRQIQSESNVVNFIAAKE
Ga0318506_1005783423300032052SoilTVVEGPLRGQLYRIRLSETKLPKEEAGKIVRQMQSESNVVNFIAAKE
Ga0318506_1041172113300032052SoilLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318513_1038188813300032065SoilLKGQLYRIRLSEIRLPKEEVGKIIRQMQSESNVVGFVAAKE
Ga0318513_1055467113300032065SoilGPLNMGGQLYRIRLSETKLPKDEVGKIVRQMQEESQIIGFIAAKE
Ga0318518_1059181513300032090SoilVEGPLKGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVDFIANE
Ga0318518_1062465913300032090SoilGQLYRIRLSETKLPKDEVGKIVRQMQEESKIVGFIAAKE
Ga0306920_10029725613300032261SoilVVEGPLRGQLYRIRLSETKLPKEEVGKIVRQMQSESNVVNFITVKE
Ga0310914_1179069513300033289SoilPLEGQLYRIRLSKTKLPQEEVGNLVSQMQSESKVVDFIAAKE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.