NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F047602

Metagenome Family F047602

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047602
Family Type Metagenome
Number of Sequences 149
Average Sequence Length 40 residues
Representative Sequence MDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAAISR
Number of Associated Samples 121
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 48.63 %
% of genes near scaffold ends (potentially truncated) 46.98 %
% of genes from short scaffolds (< 2000 bps) 79.87 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.987 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(28.188 % of family members)
Environment Ontology (ENVO) Unclassified
(40.940 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.087 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF01339CheB_methylest 13.42
PF03779SPW 6.04
PF06745ATPase 5.37
PF00989PAS 2.68
PF13596PAS_10 2.01
PF03705CheR_N 2.01
PF13561adh_short_C2 1.34
PF01797Y1_Tnp 1.34
PF01566Nramp 1.34
PF04542Sigma70_r2 0.67
PF00589Phage_integrase 0.67
PF02575YbaB_DNA_bd 0.67
PF08281Sigma70_r4_2 0.67
PF09866DUF2093 0.67
PF00106adh_short 0.67
PF13180PDZ_2 0.67
PF00072Response_reg 0.67
PF01964ThiC_Rad_SAM 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 26.85
COG1352Methylase of chemotaxis methyl-accepting proteinsSignal transduction mechanisms [T] 4.03
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 1.34
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.34
COG04224-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiCCoenzyme transport and metabolism [H] 0.67
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.67
COG0718DNA-binding nucleoid-associated protein YbaB/EfbCTranscription [K] 0.67
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.67
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.67
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.99 %
UnclassifiedrootN/A2.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16564658All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1072Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig151862All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1147Open in IMG/M
2228664022|INPgaii200_c0486406All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium545Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100528060All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.951Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1030452All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300000955|JGI1027J12803_102187509All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia530Open in IMG/M
3300000955|JGI1027J12803_107435717All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium714Open in IMG/M
3300000956|JGI10216J12902_101866743All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium755Open in IMG/M
3300002899|JGIcombinedJ43975_10002584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2869Open in IMG/M
3300002911|JGI25390J43892_10082217All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium727Open in IMG/M
3300005166|Ga0066674_10321063All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium727Open in IMG/M
3300005171|Ga0066677_10248608All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1009Open in IMG/M
3300005172|Ga0066683_10448421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium791Open in IMG/M
3300005176|Ga0066679_10002190All Organisms → cellular organisms → Bacteria8195Open in IMG/M
3300005180|Ga0066685_10088570All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2053Open in IMG/M
3300005186|Ga0066676_10098785All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1768Open in IMG/M
3300005187|Ga0066675_10057986All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2414Open in IMG/M
3300005187|Ga0066675_10581229All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium841Open in IMG/M
3300005339|Ga0070660_100349039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1218Open in IMG/M
3300005445|Ga0070708_100844483All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.860Open in IMG/M
3300005446|Ga0066686_10598598All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium749Open in IMG/M
3300005450|Ga0066682_10033693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3021Open in IMG/M
3300005450|Ga0066682_10161833All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1427Open in IMG/M
3300005450|Ga0066682_10199290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1282Open in IMG/M
3300005450|Ga0066682_10534298All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium742Open in IMG/M
3300005451|Ga0066681_10587549All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium687Open in IMG/M
3300005518|Ga0070699_101644376All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005536|Ga0070697_101861214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium539Open in IMG/M
3300005552|Ga0066701_10075890All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1916Open in IMG/M
3300005552|Ga0066701_10458360All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium791Open in IMG/M
3300005553|Ga0066695_10203262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1243Open in IMG/M
3300005553|Ga0066695_10606651All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005557|Ga0066704_10491904All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium809Open in IMG/M
3300005586|Ga0066691_10486051All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium738Open in IMG/M
3300005764|Ga0066903_101100418All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1465Open in IMG/M
3300005764|Ga0066903_108216411All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium534Open in IMG/M
3300006031|Ga0066651_10532473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium622Open in IMG/M
3300006794|Ga0066658_10760493All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium542Open in IMG/M
3300006796|Ga0066665_10077078All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2384Open in IMG/M
3300006797|Ga0066659_10920064All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium731Open in IMG/M
3300006797|Ga0066659_11314140All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium603Open in IMG/M
3300006797|Ga0066659_11878203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium508Open in IMG/M
3300006800|Ga0066660_10446243All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300006854|Ga0075425_101998338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300009012|Ga0066710_100127004All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3491Open in IMG/M
3300009012|Ga0066710_103262476All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium621Open in IMG/M
3300009137|Ga0066709_100409014All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1885Open in IMG/M
3300010046|Ga0126384_11320441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium670Open in IMG/M
3300010303|Ga0134082_10186462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium846Open in IMG/M
3300010325|Ga0134064_10398188All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium549Open in IMG/M
3300010335|Ga0134063_10016631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2984Open in IMG/M
3300010335|Ga0134063_10293349All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium781Open in IMG/M
3300010336|Ga0134071_10077001All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1556Open in IMG/M
3300010366|Ga0126379_12014676All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium680Open in IMG/M
3300010376|Ga0126381_101496995All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium975Open in IMG/M
3300011270|Ga0137391_11309130All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium571Open in IMG/M
3300012198|Ga0137364_10480837All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium933Open in IMG/M
3300012198|Ga0137364_11414937All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012200|Ga0137382_10036589All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2981Open in IMG/M
3300012200|Ga0137382_10815905All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium672Open in IMG/M
3300012201|Ga0137365_10067942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2689Open in IMG/M
3300012202|Ga0137363_10883373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium759Open in IMG/M
3300012203|Ga0137399_11424172All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium579Open in IMG/M
3300012204|Ga0137374_10001894All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae24318Open in IMG/M
3300012204|Ga0137374_10090790All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2917Open in IMG/M
3300012205|Ga0137362_10640994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium915Open in IMG/M
3300012210|Ga0137378_11166346All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium686Open in IMG/M
3300012211|Ga0137377_10293903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1559Open in IMG/M
3300012211|Ga0137377_11489285All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium603Open in IMG/M
3300012349|Ga0137387_10461508All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300012349|Ga0137387_10994028All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium602Open in IMG/M
3300012350|Ga0137372_10710517All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium727Open in IMG/M
3300012351|Ga0137386_10612463All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia784Open in IMG/M
3300012354|Ga0137366_10089793All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2333Open in IMG/M
3300012354|Ga0137366_11039462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium567Open in IMG/M
3300012356|Ga0137371_10144048All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1867Open in IMG/M
3300012357|Ga0137384_10722993All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium808Open in IMG/M
3300012359|Ga0137385_10461571All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1078Open in IMG/M
3300012362|Ga0137361_11320998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium645Open in IMG/M
3300012532|Ga0137373_11315863All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300012685|Ga0137397_10035701All Organisms → cellular organisms → Bacteria3552Open in IMG/M
3300012923|Ga0137359_10708458All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium877Open in IMG/M
3300012927|Ga0137416_10406712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1154Open in IMG/M
3300012929|Ga0137404_10030798All Organisms → cellular organisms → Bacteria3965Open in IMG/M
3300012948|Ga0126375_11430672All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium587Open in IMG/M
3300012957|Ga0164303_10021348All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2501Open in IMG/M
3300012960|Ga0164301_11822291All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300012971|Ga0126369_11411747All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium786Open in IMG/M
3300012975|Ga0134110_10181080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia879Open in IMG/M
3300014154|Ga0134075_10377354All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium624Open in IMG/M
3300015357|Ga0134072_10201351All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium689Open in IMG/M
3300015358|Ga0134089_10375920All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium603Open in IMG/M
3300015373|Ga0132257_101156256All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium978Open in IMG/M
3300016270|Ga0182036_10377629All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1099Open in IMG/M
3300016371|Ga0182034_10145736All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300017654|Ga0134069_1098629All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium951Open in IMG/M
3300017657|Ga0134074_1024136All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2017Open in IMG/M
3300018000|Ga0184604_10036643All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300018054|Ga0184621_10048317All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300018431|Ga0066655_10082431All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1756Open in IMG/M
3300018431|Ga0066655_10391829All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia916Open in IMG/M
3300018433|Ga0066667_10794764All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia804Open in IMG/M
3300018433|Ga0066667_10984444All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium727Open in IMG/M
3300018468|Ga0066662_10052622All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2607Open in IMG/M
3300018468|Ga0066662_10254013All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1439Open in IMG/M
3300018468|Ga0066662_10418948All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1185Open in IMG/M
3300018482|Ga0066669_10757729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium857Open in IMG/M
3300018482|Ga0066669_11533948All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300019789|Ga0137408_1222257All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1636Open in IMG/M
3300019879|Ga0193723_1027541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae1723Open in IMG/M
3300019879|Ga0193723_1081428All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium927Open in IMG/M
3300020004|Ga0193755_1139349All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium744Open in IMG/M
3300020006|Ga0193735_1014635All Organisms → cellular organisms → Bacteria2460Open in IMG/M
3300020170|Ga0179594_10019728All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2031Open in IMG/M
3300021560|Ga0126371_10084706All Organisms → cellular organisms → Bacteria3119Open in IMG/M
3300022534|Ga0224452_1031172All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300022534|Ga0224452_1057395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1162Open in IMG/M
3300022756|Ga0222622_10053764All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2289Open in IMG/M
3300025905|Ga0207685_10397307All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium706Open in IMG/M
3300025910|Ga0207684_11673649All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium513Open in IMG/M
3300026277|Ga0209350_1043005All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1321Open in IMG/M
3300026307|Ga0209469_1013748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2963Open in IMG/M
3300026316|Ga0209155_1025963All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2409Open in IMG/M
3300026324|Ga0209470_1283477All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium630Open in IMG/M
3300026326|Ga0209801_1369327All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300026327|Ga0209266_1233363All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium609Open in IMG/M
3300026329|Ga0209375_1207249All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium736Open in IMG/M
3300026528|Ga0209378_1070403All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1610Open in IMG/M
3300026538|Ga0209056_10705183All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium511Open in IMG/M
3300026548|Ga0209161_10361379All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium646Open in IMG/M
3300026551|Ga0209648_10500906All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium705Open in IMG/M
3300026552|Ga0209577_10294221All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1213Open in IMG/M
3300028536|Ga0137415_10002253All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus19222Open in IMG/M
3300028796|Ga0307287_10101095All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1088Open in IMG/M
3300028814|Ga0307302_10096596All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300028819|Ga0307296_10109240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1484Open in IMG/M
3300028828|Ga0307312_10062635All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2245Open in IMG/M
3300028884|Ga0307308_10492956All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium588Open in IMG/M
3300028884|Ga0307308_10540881All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031715|Ga0307476_10579635All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium832Open in IMG/M
3300031820|Ga0307473_10074019All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1720Open in IMG/M
3300031912|Ga0306921_10232493All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2160Open in IMG/M
3300032001|Ga0306922_11953846All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium573Open in IMG/M
3300032180|Ga0307471_101447123All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium846Open in IMG/M
3300032180|Ga0307471_101447834All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium846Open in IMG/M
3300032205|Ga0307472_101245168All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium713Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil28.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil10.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.36%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.01%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_001221202088090014SoilMGNSASAQAEGLDRLLLSSLKYWEVERDLIEERLAARGS
KansclcFeb2_144060302124908045SoilMMNGECAEPEPTDRLLASALRFWEVERDLIEERLAAKRRLRVPS
INPgaii200_048640622228664022SoilLWPEAIDDDEFAQTEEIDRLLLSSLRYWEVEHNLIEERMAALGR
INPhiseqgaiiFebDRAFT_10052806013300000364SoilDEIESAEVEEIDRLLLSSLRYWEVERDLIDERVAAMGR*
AP72_2010_repI_A001DRAFT_103045233300000893Forest SoilLWPETVDDEESGQAVEIDKLLLSSLKYWEVEHDLIEERLEQLGR*
JGI1027J12803_10218750923300000955SoilWRPQVVPDDEMTESEEIDRLLLSSLRYWEVERDLIEERLAAKGR*
JGI1027J12803_10743571733300000955SoilESAETEEIDRLLLSSLKFWEVERDLIEERLAVSRARRNGALHRR
JGI10216J12902_10186674323300000956SoilADESAQAEEIDNLLLSSLRYWEVERDLIEERMAQLPW*
JGIcombinedJ43975_1000258443300002899SoilMSNSESAQAEGLDRLLLSSLKYWEVERDLIEERLATRGR*
JGI25390J43892_1008221723300002911Grasslands SoilMMNGDESVEPEEIDRLLLSSLRLWEVERDLIEERMATRSR*
Ga0066674_1032106323300005166SoilGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0066677_1024860823300005171SoilMDDNESSQAEEIDRLLLSSLRFWTVERDLIEERMAAISR*
Ga0066683_1044842123300005172SoilMMNGDESVEAEEIDRLLLSSLRLWEVERDLIEERMAAKGR*
Ga0066679_10002190143300005176SoilMNDDESTQAEEIDRLLLSSLRFWEVERDLIEERLAARGR*
Ga0066685_1008857043300005180SoilMNDDESTQAEEIDRLLLSSLRYWEVERDLIEERMGAIGR*
Ga0066676_1009878533300005186SoilMDDDESTQAEGIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0066675_1005798623300005187SoilMIGDDESPDAEQTDRLLLSSLRFWEVERDLIEERIAARGRRSTA*
Ga0066675_1058122913300005187SoilMVNGESAEPEQTDRLLVSALRFWEVERDLIEERMAAKSR*
Ga0070660_10034903923300005339Corn RhizosphereMNGNKSVEAEETDRLLLSSLKYWEVERDLIEERLAARCR*
Ga0070708_10084448323300005445Corn, Switchgrass And Miscanthus RhizosphereSQPETMDDNEFAQAEEIDRLLLSSLRYWEVERDLIEERVAAMGR*
Ga0066686_1059859813300005446SoilGALWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0066682_1003369363300005450SoilMIGDDESPDAEQTDRLLLSSLRFWEVERDLIEERMGAIGR*
Ga0066682_1016183323300005450SoilMMNGDEPVEPEEIDRLLLSSLRLWEVERDLIEERMATRSR*
Ga0066682_1019929043300005450SoilMNGDESVEAEEIDRLLLSSLRLWEVERDLIEERMAAKGR*
Ga0066682_1053429823300005450SoilWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0066681_1058754913300005451SoilSGALWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPFARTRFNRSL*
Ga0070699_10164437623300005518Corn, Switchgrass And Miscanthus RhizosphereWPETVDVDESAQPEKIDRLLLSSLRYWEVERDLMDERVAQ*
Ga0070697_10186121413300005536Corn, Switchgrass And Miscanthus RhizosphereMDDNEFAQAEEIDRLLLSSLRFWEAERDLIEERVAAMGG*
Ga0066701_1007589033300005552SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERLAARGC*
Ga0066701_1045836023300005552SoilLWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0066695_1020326213300005553SoilMVNGESAEPEQTDRLLVSALRFWEVEHDLIEERMAAKGR*
Ga0066695_1060665123300005553SoilDESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPC*
Ga0066704_1049190423300005557SoilEDDESALTEETDRLLLSSLRFWEVEHDLIEERVAAIGR*
Ga0066691_1048605123300005586SoilMDDDESTQAEGIDRLLLSSLRYWEVERDLIEERMAAI
Ga0066903_10110041823300005764Tropical Forest SoilMDDNEAAQAQETDRLLLSSLRFWEVERDLIEERMAAMSR*
Ga0066903_10821641113300005764Tropical Forest SoilMNGDESAESAGIDRLLLSSLRFWEIERDLIEERMAALGR*
Ga0066651_1053247323300006031SoilDESTQAEGIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0066658_1076049323300006794SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0066665_1007707833300006796SoilMNGDESVEPEEIDRLLLSLLRLWEVERDLIEERMAT*
Ga0066659_1092006423300006797SoilMNGYESVEAEENDRLLLSSLKYWEVERDLIEERLAARSR*
Ga0066659_1131414013300006797SoilMDDNKSAQAEEIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0066659_1187820313300006797SoilTGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0066660_1044624323300006800SoilGHEPAETEETDKLLLSSLRYWEVTRDLIEERIAALRR*
Ga0075425_10199833813300006854Populus RhizosphereVWRTNHLNGDESAEGEQIDRLLFSSLRLWEVERDLIEERMAARGR*
Ga0066710_10012700443300009012Grasslands SoilMPDDNGSAEAEGIDRLLLSALRYWEVERDLIEERMAASGR
Ga0066710_10326247623300009012Grasslands SoilMVNGESAEPEQTDRLLVSALRFWEVEHDLIEERMAAKGR
Ga0066709_10040901413300009137Grasslands SoilADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0126384_1132044113300010046Tropical Forest SoilMGDADESAQDEEIDRILLSSLRYWEVDRDLIEERVEQIG
Ga0134082_1018646223300010303Grasslands SoilMDDDESTQAEGIDRLLLSSLRFWEVERDLIEERMAAISR
Ga0134064_1039818813300010325Grasslands SoilDESAQAEEIDNLLLSSLRYWEVERDLIEERMAQLRW*
Ga0134063_1001663113300010335Grasslands SoilDESVEAEEIDRLLLSSLRLWEVERDLIEERMAAKGR*
Ga0134063_1029334923300010335Grasslands SoilSAQVEAIDRLLLSSLRYWEVERDLIEERMAARGC*
Ga0134071_1007700153300010336Grasslands SoilDESPDAEQTDRLLLSSLRFWEVERDLIEERIAARRRRSTA*
Ga0126372_1271292223300010360Tropical Forest SoilSPNGEKPDRLLLSALKYWEVERDLIEERMAAMSR*
Ga0126379_1201467613300010366Tropical Forest SoilTFDGEESGQAEEIDRLLLSSLNYWEVEHDLIEERLEQLGR*
Ga0126381_10149699513300010376Tropical Forest SoilTVDENKFAQAEEIDKLLLSSLRFWEIERDLIEERITAMSR*
Ga0137391_1130913023300011270Vadose Zone SoilMMNNSESDQVEATDRLLLSSLRFWEVERNLIEERLATRRSA
Ga0137364_1048083723300012198Vadose Zone SoilMVNGESAEPEQSDRLLVSALRFWEVERDLIEERMAAKGR*
Ga0137364_1141493723300012198Vadose Zone SoilADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPC*
Ga0137382_1003658913300012200Vadose Zone SoilMNGYKSVEAEENDRLLLSSLKYWEVERDLIEERLAARSR*
Ga0137382_1081590513300012200Vadose Zone SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAARGF*
Ga0137365_1006794233300012201Vadose Zone SoilMDDAEFAQAEETDRLLLSSLRYWEVERDLIEERVAAIGR*
Ga0137363_1088337313300012202Vadose Zone SoilMDDNESVQAEEIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0137399_1142417213300012203Vadose Zone SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAARGC*
Ga0137374_10001894273300012204Vadose Zone SoilMMDDDESAQTEEIDRLVVSSLRFWEVERDLIEERMAAIGR*
Ga0137374_1009079033300012204Vadose Zone SoilMVNGESAEPEQTDRLLVSALRFWEVERDLIEERMAAKGR*
Ga0137362_1064099413300012205Vadose Zone SoilHEPDEIEEVDKLLLSSLHYWEVTRDLIEERMAARGW*
Ga0137378_1116634613300012210Vadose Zone SoilLWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQL
Ga0137377_1029390333300012211Vadose Zone SoilMMNGDESVEPEEIDRLLLSSLRLWEVERDLIEERMAAKGR*
Ga0137377_1148928523300012211Vadose Zone SoilSGALWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0137387_1046150833300012349Vadose Zone SoilETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPC*
Ga0137387_1099402813300012349Vadose Zone SoilETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0137387_1105535423300012349Vadose Zone SoilSKRSGTPQPETMDDNESAQAEEIDRLLLSSLRFWTVERDLIEERMAAISR*
Ga0137372_1071051723300012350Vadose Zone SoilMDDNESAQAEEIDRLLLSSLRFWAVERDLIEERMAAISR*
Ga0137386_1061246323300012351Vadose Zone SoilAEMIGDDESPDAEQTDRLLLSSLRFWEVERDLIEERVAAIGR*
Ga0137366_1008979323300012354Vadose Zone SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEDSMAAIGR*
Ga0137366_1103946223300012354Vadose Zone SoilESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0137371_1014404823300012356Vadose Zone SoilMDDAEFAQAEETDRLLLSSLRYGEVERDLIEERVAAIGR*
Ga0137384_1072299323300012357Vadose Zone SoilMDDHESAQAEEIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0137385_1046157133300012359Vadose Zone SoilMDDNESAEAEEIDRLLLSSLRFWEVERDLIEERMAAISR*
Ga0137361_1132099813300012362Vadose Zone SoilMDDDESAQTEEIGRLLLSSLRYWEVERDLIEERVTAIRSVTVSL*
Ga0137373_1131586323300012532Vadose Zone SoilSAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0137397_1003570123300012685Vadose Zone SoilMNGDESAEAEETDRLLLSSLRYWEVERDLIEERLGARSR*
Ga0137359_1070845823300012923Vadose Zone SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAVISR*
Ga0137416_1040671223300012927Vadose Zone SoilESNHAEEIDRRLLSSLRYWEVERDLIEERVAAIGR*
Ga0137404_1003079823300012929Vadose Zone SoilMEGDELAEAEAIDKLLLSSLRYWEVERDLIEERLATRGR*
Ga0126375_1143067223300012948Tropical Forest SoilMNGDESAEYAGIDRLLLSSLRFWEIERDLIEERMAALGR*
Ga0164303_1002134823300012957SoilMDGNESVQVAEIDRLLLSSLRFWEVERDLIEERVAATDR*
Ga0164301_1182229113300012960SoilMDGNESVQVDEIDRLLLSSLRFWEVERDLIEERVAATDR*
Ga0126369_1141174723300012971Tropical Forest SoilLTKHAETPPPETIDDIESAEAKEIDRLLLSSLKYWEVERDLIEERMAAMSR*
Ga0134110_1018108013300012975Grasslands SoilTLDDNESAQVEAIDRLLLSSLRYWEVERDLIEERMAAISR*
Ga0134075_1037735423300014154Grasslands SoilMVNGESAEPEQSDRLLVSALRFWEVEHDLIEERMAAKGR*
Ga0134072_1020135133300015357Grasslands SoilDADESAEAEEIDSLLLSSLRYWEVERDLIEERMAQLPW*
Ga0134089_1037592013300015358Grasslands SoilLQPETLDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAAIGR*
Ga0132257_10115625633300015373Arabidopsis RhizosphereYESAQIEEIDSLLRSSLRYWEVEHDLIEERMAQLRW*
Ga0182036_1037762933300016270SoilMDDNKCAQAEQIDRLLLSALKFWEVERDLIEERIAAMSQ
Ga0182034_1014573633300016371SoilNKCAQAEQIDRLLLSALKFWEVERDLIEERMAAMSQ
Ga0182039_1167157513300016422SoilKCAQAEQIDRLLLSALKFWEVERDLIEERIAAISQ
Ga0134069_109862923300017654Grasslands SoilMVNGESAEPEQTDRLLVSALRFWEVERDLIEERMAAKSR
Ga0134074_102413643300017657Grasslands SoilSGALWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW
Ga0184604_1003664313300018000Groundwater SedimentMNGDESAEAEETDRLLLSSLRYWEVERDLIEERLGARSR
Ga0184621_1004831733300018054Groundwater SedimentESAQVEEIDRLLLSSLKYWEVERDLIEERMAARGW
Ga0066655_1008243143300018431Grasslands SoilMNGDESVEAEEIDRLLLSSLRLWEVERDLIEERMAAKGR
Ga0066655_1039182933300018431Grasslands SoilESVEPEEIDRLLLSSLRLWEVERDLIEERMATRSR
Ga0066667_1079476413300018433Grasslands SoilETMDDDESTQAEGIDRLLLSSLRFWEVERDLIEERMAAISR
Ga0066667_1098444413300018433Grasslands SoilADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW
Ga0066662_1005262243300018468Grasslands SoilMNDDESTQAEEIDRLLLSSLRYWEVERDLIEERMGAIGR
Ga0066662_1025401313300018468Grasslands SoilMDDDESAQAEEIDRLLLSSLRYWEVERDLIEERVAARGC
Ga0066662_1041894823300018468Grasslands SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERLAARGC
Ga0066669_1075772923300018482Grasslands SoilMMNGDESVEAEEIDRLLLSSLRLWEVERDLIEERMAAKGR
Ga0066669_1153394823300018482Grasslands SoilLETSRPETMDDDESTQAEGIDRLLLSSLRFWEVERDLIEERMAARGC
Ga0137408_122225723300019789Vadose Zone SoilMEGDELAEAEAIDKLLLSSLRYWEVERDLIEERLATRGR
Ga0193723_102754133300019879SoilMHDDESAQAEEIDRLLLSSLRFWEVERDLIEERLEAKGC
Ga0193723_108142823300019879SoilMPDDNGSAEAEGIDRLLLSALRYWEVERDLIEERMAARAR
Ga0193755_113934923300020004SoilVNGDESAEAEEIDRLLLSSLRLWEVERDLIEERLAARK
Ga0193735_101463513300020006SoilMNDNESAQAEEIDRLLLSSLRFWEVERDLIEERLQARGC
Ga0179594_1001972833300020170Vadose Zone SoilMNGYESVEAEENDRLLLSSLKYWEVERDLIEERLAARSR
Ga0126371_1008470643300021560Tropical Forest SoilMDDNEAAQAQETDRLLLSSLRFWEVERDLIEERMAAMSR
Ga0224452_103117213300022534Groundwater SedimentDESAEAEAIDKLLLSSLRYWEVERDLIEERMAAKGR
Ga0224452_105739543300022534Groundwater SedimentMNGDEPADTEGTDRLLLSSLRYWEVERDLIEERLAARSG
Ga0222622_1005376433300022756Groundwater SedimentMNGDEPAEAEVTDRLLLSSLRYWEVERDLIEERLAARSR
Ga0207685_1039730723300025905Corn, Switchgrass And Miscanthus RhizosphereDGSAQAEEIDSLLRSSLRYWEVERDLIEERMAQLP
Ga0207684_1167364913300025910Corn, Switchgrass And Miscanthus RhizosphereAEFAQTEEIDRLVLSSLRYWEVEHDLIEERMAARGC
Ga0209350_104300533300026277Grasslands SoilMMNGDESVEPEEIDRLLLSSLRLWEVERDLIEERMATRSR
Ga0209469_101374823300026307SoilMMNGDEPVEPEEIDRLLLSSLRLWEVERDLIEERMATRSR
Ga0209155_102596323300026316SoilMDDNESSQAEEIDRLLLSSLRFWTVERDLIEERMAAISR
Ga0209470_128347723300026324SoilRSGALWPETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW
Ga0209801_136932713300026326SoilWRASRPETINDDESTQAEEIDRLLLSSLRYWEVERDLIEERVAAIGR
Ga0209266_123336313300026327SoilETGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW
Ga0209375_120724913300026329SoilGDADESAQAEEIDSLLLSSLRYWEVERDLIEERMAQLPW
Ga0209378_107040313300026528SoilKRSGTSRPETMNDDESTQAEEIDRLLLSSLRYWEVERDLIEERMGAIGR
Ga0209056_1070518313300026538SoilMDDNESAQAEEIDRLLLSSLRFWEVERDLIEERMAAISR
Ga0209161_1036137913300026548SoilMMNGDESVEPEEIDRLLLSLLRLWEVERDLIEERMAT
Ga0209648_1050090623300026551Grasslands SoilMNGDHSAQAEETDRLLLSSLRYWEVERDLIEERLAARSR
Ga0209577_1029422113300026552SoilESAGAEETDRLLVSSLRFWEVERDLIEERLAARGC
Ga0137415_10002253223300028536Vadose Zone SoilESNHAEEIDRRLLSSLRYWEVERDLIEERVAAIGR
Ga0307287_1010109533300028796SoilMPKSKRRLWPETVDTDESAQAEEIDRLLLSSLRYWGIERDLIEERMAQLDR
Ga0307302_1009659613300028814SoilSEVLWPEPTDDESAQVEEIDRLLLSSLKYWEVERDLIEERMAARGW
Ga0307296_1010924013300028819SoilPEPTDDESAQVEEIDRLLLSSLKYWEVERDLIEERMAASRR
Ga0307312_1006263533300028828SoilMEGDESAEAEAIDKLLLSSLRYWEVERDLIEERMAAKGR
Ga0307308_1049295613300028884SoilDGDESAEAEETDRLLLSSLRFWEVERDLIDERMATRSR
Ga0307308_1054088123300028884SoilNGDESAEAEQIDRLLFSSLRLWEVERDLIEERMAARGR
Ga0307476_1057963513300031715Hardwood Forest SoilETIDEIEPAEAEEIDRLLLSSLRYWEVERDLIEERVAATGR
Ga0307473_1007401913300031820Hardwood Forest SoilESQPETMDDNEFAQAEEIDRLLLSSLRFWEAERDLIEERVAAMGR
Ga0306921_1023249343300031912SoilMNGHEPDATEEVDKLLLSSLRYWEVTRDLIEERMAALGR
Ga0306922_1195384623300032001SoilKDDNESAQAEEIDRLLLSSLKFWEVERDLIEERTATTSR
Ga0307471_10144712323300032180Hardwood Forest SoilDDNGSAEAEGIDRLLLSALRYWEVERDLIEERMAARAR
Ga0307471_10144783413300032180Hardwood Forest SoilMDDNESAQAEEIDRLLLSSLRFWEVEHDLIEERAAAIRSVSVPL
Ga0307472_10124516823300032205Hardwood Forest SoilPQPEPIDNNESAQAEEIDRLLLSSLRFWEVERDLIEERVAAMGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.