| Basic Information | |
|---|---|
| Family ID | F047524 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MLGRLQDRTGSPNLRTRVLAACVIVGLVVLTAPLAVLPLVHWLARFL |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.16 % |
| % of genes near scaffold ends (potentially truncated) | 34.23 % |
| % of genes from short scaffolds (< 2000 bps) | 84.56 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.758 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere (12.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.651 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.745 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 2.67% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF00012 | HSP70 | 55.03 |
| PF13183 | Fer4_8 | 8.05 |
| PF00692 | dUTPase | 1.34 |
| PF01556 | DnaJ_C | 0.67 |
| PF00293 | NUDIX | 0.67 |
| PF07504 | FTP | 0.67 |
| PF12728 | HTH_17 | 0.67 |
| PF13581 | HATPase_c_2 | 0.67 |
| PF14019 | DUF4235 | 0.67 |
| PF01940 | DUF92 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 55.03 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.34 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 1.34 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG1836 | Cytidylyltransferase family enzyme | General function prediction only [R] | 0.67 |
| COG3227 | Zn-dependent metalloprotease (Neutral protease B) | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.76 % |
| Unclassified | root | N/A | 36.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001205|C688J13580_1043976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300001686|C688J18823_10710523 | Not Available | 639 | Open in IMG/M |
| 3300002568|C688J35102_118280429 | Not Available | 545 | Open in IMG/M |
| 3300002568|C688J35102_118514949 | Not Available | 567 | Open in IMG/M |
| 3300002568|C688J35102_118617111 | Not Available | 577 | Open in IMG/M |
| 3300002568|C688J35102_119795380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300002568|C688J35102_120652644 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300003321|soilH1_10181284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1134 | Open in IMG/M |
| 3300003324|soilH2_10083865 | Not Available | 1199 | Open in IMG/M |
| 3300004114|Ga0062593_100444174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1179 | Open in IMG/M |
| 3300004480|Ga0062592_100078527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1945 | Open in IMG/M |
| 3300005093|Ga0062594_101656344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 666 | Open in IMG/M |
| 3300005177|Ga0066690_10683272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 681 | Open in IMG/M |
| 3300005187|Ga0066675_11273003 | Not Available | 543 | Open in IMG/M |
| 3300005327|Ga0070658_10000415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 36949 | Open in IMG/M |
| 3300005327|Ga0070658_10151840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1939 | Open in IMG/M |
| 3300005327|Ga0070658_10231592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1564 | Open in IMG/M |
| 3300005327|Ga0070658_10409718 | Not Available | 1165 | Open in IMG/M |
| 3300005327|Ga0070658_11587010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300005329|Ga0070683_100091144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2862 | Open in IMG/M |
| 3300005329|Ga0070683_100148429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2223 | Open in IMG/M |
| 3300005329|Ga0070683_102222418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 527 | Open in IMG/M |
| 3300005330|Ga0070690_100021114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3973 | Open in IMG/M |
| 3300005334|Ga0068869_100089221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2315 | Open in IMG/M |
| 3300005336|Ga0070680_100310483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1338 | Open in IMG/M |
| 3300005336|Ga0070680_100346670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1263 | Open in IMG/M |
| 3300005336|Ga0070680_101199010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300005336|Ga0070680_101241795 | Not Available | 645 | Open in IMG/M |
| 3300005339|Ga0070660_100269365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1392 | Open in IMG/M |
| 3300005339|Ga0070660_101100205 | Not Available | 673 | Open in IMG/M |
| 3300005366|Ga0070659_100005424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9157 | Open in IMG/M |
| 3300005366|Ga0070659_100477168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1061 | Open in IMG/M |
| 3300005435|Ga0070714_101490523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 661 | Open in IMG/M |
| 3300005435|Ga0070714_102441371 | Not Available | 508 | Open in IMG/M |
| 3300005454|Ga0066687_10962394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300005458|Ga0070681_11193220 | Not Available | 683 | Open in IMG/M |
| 3300005524|Ga0070737_10285982 | Not Available | 656 | Open in IMG/M |
| 3300005529|Ga0070741_10046107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5438 | Open in IMG/M |
| 3300005529|Ga0070741_10133712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2530 | Open in IMG/M |
| 3300005530|Ga0070679_101091745 | Not Available | 743 | Open in IMG/M |
| 3300005535|Ga0070684_102104854 | Not Available | 532 | Open in IMG/M |
| 3300005560|Ga0066670_10304432 | Not Available | 970 | Open in IMG/M |
| 3300005563|Ga0068855_102516758 | Not Available | 512 | Open in IMG/M |
| 3300005575|Ga0066702_10505655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300005587|Ga0066654_10104102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
| 3300005587|Ga0066654_10248436 | Not Available | 937 | Open in IMG/M |
| 3300005607|Ga0070740_10184693 | Not Available | 882 | Open in IMG/M |
| 3300006034|Ga0066656_10161312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1408 | Open in IMG/M |
| 3300006046|Ga0066652_100109980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2241 | Open in IMG/M |
| 3300006881|Ga0068865_101063798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300009093|Ga0105240_10625777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1182 | Open in IMG/M |
| 3300009098|Ga0105245_10738556 | Not Available | 1020 | Open in IMG/M |
| 3300009098|Ga0105245_10815025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300009098|Ga0105245_11007090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 878 | Open in IMG/M |
| 3300009098|Ga0105245_12215175 | Not Available | 603 | Open in IMG/M |
| 3300009174|Ga0105241_11084043 | Not Available | 753 | Open in IMG/M |
| 3300009176|Ga0105242_11083021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 814 | Open in IMG/M |
| 3300009545|Ga0105237_10605856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300009551|Ga0105238_12242330 | Not Available | 581 | Open in IMG/M |
| 3300010373|Ga0134128_12119820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300010375|Ga0105239_11931884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300010396|Ga0134126_10607318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
| 3300012955|Ga0164298_11067770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300012972|Ga0134077_10283046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300012977|Ga0134087_10104468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1190 | Open in IMG/M |
| 3300012989|Ga0164305_11508655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300013100|Ga0157373_10874179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300013102|Ga0157371_10719614 | Not Available | 748 | Open in IMG/M |
| 3300013104|Ga0157370_10152674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2149 | Open in IMG/M |
| 3300013105|Ga0157369_10073826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3659 | Open in IMG/M |
| 3300013105|Ga0157369_10274229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1757 | Open in IMG/M |
| 3300013105|Ga0157369_10956592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
| 3300013105|Ga0157369_11425238 | Not Available | 705 | Open in IMG/M |
| 3300013297|Ga0157378_10162456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2090 | Open in IMG/M |
| 3300013307|Ga0157372_11012893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300013307|Ga0157372_11547198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300013307|Ga0157372_12447591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300013307|Ga0157372_12560766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300013307|Ga0157372_13171588 | Not Available | 524 | Open in IMG/M |
| 3300014150|Ga0134081_10043438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1330 | Open in IMG/M |
| 3300014166|Ga0134079_10403610 | Not Available | 636 | Open in IMG/M |
| 3300015068|Ga0167645_111312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300015356|Ga0134073_10222663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300015371|Ga0132258_11068398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2040 | Open in IMG/M |
| 3300015372|Ga0132256_102415921 | Not Available | 628 | Open in IMG/M |
| 3300018431|Ga0066655_10964562 | Not Available | 587 | Open in IMG/M |
| 3300018468|Ga0066662_10012522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4484 | Open in IMG/M |
| 3300018468|Ga0066662_10224607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1509 | Open in IMG/M |
| 3300018468|Ga0066662_11763880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces fradiae → Streptomyces fradiae ATCC 10745 = DSM 40063 | 648 | Open in IMG/M |
| 3300019890|Ga0193728_1299968 | Not Available | 610 | Open in IMG/M |
| 3300020069|Ga0197907_10934393 | Not Available | 650 | Open in IMG/M |
| 3300020069|Ga0197907_11049030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 994 | Open in IMG/M |
| 3300020075|Ga0206349_1112359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3334 | Open in IMG/M |
| 3300020081|Ga0206354_10635630 | Not Available | 702 | Open in IMG/M |
| 3300020081|Ga0206354_10685734 | Not Available | 559 | Open in IMG/M |
| 3300020081|Ga0206354_11693992 | Not Available | 683 | Open in IMG/M |
| 3300020082|Ga0206353_10480455 | Not Available | 710 | Open in IMG/M |
| 3300020082|Ga0206353_10776395 | Not Available | 1024 | Open in IMG/M |
| 3300020082|Ga0206353_10804626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1297 | Open in IMG/M |
| 3300020082|Ga0206353_10840961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300020082|Ga0206353_11659158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
| 3300020082|Ga0206353_11698378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 824 | Open in IMG/M |
| 3300021184|Ga0196959_10070319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 760 | Open in IMG/M |
| 3300021362|Ga0213882_10005122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4551 | Open in IMG/M |
| 3300021362|Ga0213882_10076816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1339 | Open in IMG/M |
| 3300021377|Ga0213874_10205535 | Not Available | 710 | Open in IMG/M |
| 3300021953|Ga0213880_10027312 | Not Available | 1304 | Open in IMG/M |
| 3300022467|Ga0224712_10007391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3197 | Open in IMG/M |
| 3300022467|Ga0224712_10012933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2644 | Open in IMG/M |
| 3300022467|Ga0224712_10312536 | Not Available | 737 | Open in IMG/M |
| 3300022467|Ga0224712_10627833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300025909|Ga0207705_10008106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7696 | Open in IMG/M |
| 3300025909|Ga0207705_10238881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1383 | Open in IMG/M |
| 3300025909|Ga0207705_10463960 | Not Available | 982 | Open in IMG/M |
| 3300025909|Ga0207705_10805814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300025912|Ga0207707_10000071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 102604 | Open in IMG/M |
| 3300025912|Ga0207707_10044597 | All Organisms → cellular organisms → Bacteria | 3866 | Open in IMG/M |
| 3300025912|Ga0207707_10320761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
| 3300025912|Ga0207707_10347390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1278 | Open in IMG/M |
| 3300025912|Ga0207707_10729338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300025913|Ga0207695_10975383 | Not Available | 727 | Open in IMG/M |
| 3300025914|Ga0207671_10426511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300025917|Ga0207660_10563452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300025917|Ga0207660_10652740 | Not Available | 858 | Open in IMG/M |
| 3300025917|Ga0207660_10977511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300025919|Ga0207657_10388287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1099 | Open in IMG/M |
| 3300025919|Ga0207657_10507930 | Not Available | 944 | Open in IMG/M |
| 3300025919|Ga0207657_10511730 | Not Available | 940 | Open in IMG/M |
| 3300025919|Ga0207657_10741479 | Not Available | 761 | Open in IMG/M |
| 3300025927|Ga0207687_11847677 | Not Available | 517 | Open in IMG/M |
| 3300025929|Ga0207664_11891293 | Not Available | 519 | Open in IMG/M |
| 3300025938|Ga0207704_11561905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300025944|Ga0207661_10168853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1903 | Open in IMG/M |
| 3300025949|Ga0207667_10116596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2752 | Open in IMG/M |
| 3300025949|Ga0207667_10783778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
| 3300025949|Ga0207667_11164977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300026089|Ga0207648_11278095 | Not Available | 689 | Open in IMG/M |
| 3300026308|Ga0209265_1033948 | Not Available | 1578 | Open in IMG/M |
| 3300026550|Ga0209474_10540331 | Not Available | 592 | Open in IMG/M |
| 3300027766|Ga0209796_10027333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1711 | Open in IMG/M |
| 3300027766|Ga0209796_10035394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300030515|Ga0268254_10046171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
| 3300031679|Ga0318561_10436962 | Not Available | 720 | Open in IMG/M |
| 3300031938|Ga0308175_100707789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300031938|Ga0308175_101235961 | Not Available | 831 | Open in IMG/M |
| 3300031938|Ga0308175_102437954 | Not Available | 586 | Open in IMG/M |
| 3300031996|Ga0308176_12208646 | Not Available | 588 | Open in IMG/M |
| 3300032008|Ga0318562_10628196 | Not Available | 620 | Open in IMG/M |
| 3300032895|Ga0335074_10165999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2761 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 12.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 11.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 10.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 8.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.01% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.01% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 2.01% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.01% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.34% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.34% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030515 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J13580_10439761 | 3300001205 | Soil | MLGRLQDRSGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVH |
| C688J18823_107105231 | 3300001686 | Soil | GGPRLRVRVLAALVIVGMVVLTAPLVVLPVSHLLARLF* |
| C688J35102_1182804291 | 3300002568 | Soil | MLGRLQDRRGTPNLRTRALAALVVLGLVVLTAPLVVLPVAHWLGRVL* |
| C688J35102_1185149491 | 3300002568 | Soil | MLGRLQDRRGEPRTRVRVLAALVIVGMVVLTSPLVLVPVARWLITFL* |
| C688J35102_1186171111 | 3300002568 | Soil | SAFPAYAPAMLGRLQDRSGSPNLRTRLLAGAVIVGLVVLTAPLAVLPVVHWLARFL* |
| C688J35102_1197953802 | 3300002568 | Soil | MLRQLQDRRGGPRLRVRVLAALVIVGMVVLTAPLVVLPVSHLLARLF* |
| C688J35102_1206526442 | 3300002568 | Soil | MLGRLQDRRGEPNIRVRVLAALVIVGLVVLTAPLAVLPVL |
| soilH1_101812842 | 3300003321 | Sugarcane Root And Bulk Soil | VLGRLQDRTGAPNLRTRLLAAAVIVGLVILTAPLAVLPVVHWLARFI* |
| soilH2_100838651 | 3300003324 | Sugarcane Root And Bulk Soil | MLGRLQDRRGEPRFRVRLLAALVIVGMVVLTAPLVVVPLVGWLADHL* |
| Ga0062593_1004441742 | 3300004114 | Soil | MLGRLQDRRGEPRARVRVLAALVIVGMLLLTAPLVLVPVTRWLLSFL* |
| Ga0062592_1000785271 | 3300004480 | Soil | QGSAAYAPAMLGRLQDRRGEPRFRVRLLAALVIVGMVVLTAPLVVVPLVGWLADHL* |
| Ga0062594_1016563441 | 3300005093 | Soil | MLGRLQDRRGEPNLRTRALAGLVVLGLVVLTAPLVVMPLLGWLARML* |
| Ga0066690_106832722 | 3300005177 | Soil | MLGRLQDRRGEPRLRARVLAALVIAGMLLLTAPLVLVPVVRWMFGFL* |
| Ga0066675_112730032 | 3300005187 | Soil | ARPAPYASAMLGQLQDRRGEPNLRTRVLAALVVAGLVVLTAPLVVLPVAHWLSRML* |
| Ga0070658_1000041510 | 3300005327 | Corn Rhizosphere | MLGRLQDRTGAPNLRTRLLAAAVVVGLVVLTAPLVVLPIAHWLARLL* |
| Ga0070658_101518402 | 3300005327 | Corn Rhizosphere | VLGRLQDSRGEPNLRTRALAALVIVGLVVLTAPLVVLPVVHLLARLF* |
| Ga0070658_102315922 | 3300005327 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIVGLVVLTAPLAVLPLVHWLARFL* |
| Ga0070658_104097182 | 3300005327 | Corn Rhizosphere | GRLQDRTGSPNLRTRLLAAAVIVGMVVLTAPLAVLPLLHWLAQLL* |
| Ga0070658_115870102 | 3300005327 | Corn Rhizosphere | YARMVLGRLQDRTGAPNLRTRLLAAAVIVGLVILTAPLAVLPVVHWLAHIL* |
| Ga0070683_1000911442 | 3300005329 | Corn Rhizosphere | MLGRLQDRTGAPHRGTRLLAGAVIVGLVVLTAPLAVLPVVHWLTHFV* |
| Ga0070683_1001484292 | 3300005329 | Corn Rhizosphere | MLGRLQDRRGEPRLRVRLLAALVVAGLVLLTAPLALIPVVRWLFGFL* |
| Ga0070683_1022224182 | 3300005329 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIVGLVVLTAPLAVLPLV |
| Ga0070690_1000211143 | 3300005330 | Switchgrass Rhizosphere | VLGRLQDSRGAPNLRTRVLAALVIVGLVVLTAPLVVLPLVHLLARIL* |
| Ga0068869_1000892213 | 3300005334 | Miscanthus Rhizosphere | VLGRLQDSRGEPNLRTRVLAALVIVGLVVLTAPLVVLPLVHLLARLL* |
| Ga0070680_1003104832 | 3300005336 | Corn Rhizosphere | MLGRLQDRTGSPNARTRVFAAAVIIGMIVLTAPLAVLPVVHWLARFL* |
| Ga0070680_1003466702 | 3300005336 | Corn Rhizosphere | MVLGRLQDRTGAPNLRTRLLAAAVIVGLVILTAPLAVLPVVHWLAHIL* |
| Ga0070680_1011990102 | 3300005336 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRLLAAAVIVGMVVLTAPLAVLPLLHWLAQLL* |
| Ga0070680_1012417951 | 3300005336 | Corn Rhizosphere | MLGRLQDRRGAPRLRVRVLAALVIVGMIVLTAPLVVVPLAGWLADHL* |
| Ga0070660_1002693652 | 3300005339 | Corn Rhizosphere | QDSRGEPNLRTRALAALVIVGLVVLTAPLVVLPVVHLLARLF* |
| Ga0070660_1011002051 | 3300005339 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRLLAGAVIVGLVVLTAPLAVLPVVHWLARFL* |
| Ga0070659_1000054247 | 3300005366 | Corn Rhizosphere | MGPVLGRLQDSRGEPNLRTRALAALVIVGLVVLTAPLVVLPVVHLLARLF* |
| Ga0070659_1004771682 | 3300005366 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIIGLLVLTAPLAVLPLVHWLARFL* |
| Ga0070714_1014905232 | 3300005435 | Agricultural Soil | MLGRLQDRTGSPHRGTRLLAGAVIVGLVVLTAPLAVLPVVHWLVQVL* |
| Ga0070714_1024413712 | 3300005435 | Agricultural Soil | MLGQLQNRRGRPNLRTRVLAALVVLGLIVLTAPLVVLPLMHLLAAVL* |
| Ga0066687_109623942 | 3300005454 | Soil | LGRLQDRRGEPRLRARVLAALVIAGMLLLTAPLVLVPVVRWMFGFL* |
| Ga0070681_111932202 | 3300005458 | Corn Rhizosphere | TLRAMLGRLQDRRGEPRARVRVLAALVIVGMLLLTAPLVLVPVTRWVLSFL* |
| Ga0070737_102859821 | 3300005524 | Surface Soil | VPVGDALGPAAAYRPGMLGRLQDRRGEPNARVRVLAAMVIVGLVVLTAPLVVIPVTAWVAHHL* |
| Ga0070741_100461072 | 3300005529 | Surface Soil | VQFVLGRLQDTRGEPRLRVRVLAALVVLGLLVLTAPLVMVPLIDWLSSHL* |
| Ga0070741_101337122 | 3300005529 | Surface Soil | MLGRLQDRRGEPNLRTRALAALVIVGLLILTAPLVVVPLVSWLSRVL* |
| Ga0070679_1010917452 | 3300005530 | Corn Rhizosphere | QDRTGAPRRGTRLLAGAVIVGLVVLTAPLAVLPVVHWFTHFV* |
| Ga0070684_1021048541 | 3300005535 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIIGLIVLTAPLAVLPLVHWLARFL* |
| Ga0066670_103044322 | 3300005560 | Soil | MLGRLQDRRGEPTARVRVLAALVIVGLVVLTAPLAVLPALHWLARFI* |
| Ga0068855_1025167582 | 3300005563 | Corn Rhizosphere | VLGRLQDRRGAPSLRTRAMAALVILGMIVLTAPLVVVPFVGWVTHHLL* |
| Ga0066702_105056552 | 3300005575 | Soil | MLGRLQDRTGSPNLRTRVLAACVIIGLVILTAPLAVLPVVHWLMRLL* |
| Ga0066654_101041021 | 3300005587 | Soil | DRSGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLVHVL* |
| Ga0066654_102484362 | 3300005587 | Soil | PAMLGRLQDRTGSPNVRTRLLAAAVIVGLIVLTAPLAVLPVVHWLARFL* |
| Ga0070740_101846932 | 3300005607 | Surface Soil | VPAGVVVRDDGLMLGQLQNGRGEPNLRTRVLAALVIVGLLVLTAPLVVLPLAHLLAQIL* |
| Ga0066656_101613121 | 3300006034 | Soil | AYAPTMLGRLQDRSGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLVHVL* |
| Ga0066652_1001099802 | 3300006046 | Soil | LRQLQGRQGRPNLRTRLLAALVVVGLVVLTAPLVVLPVAHWLAGL* |
| Ga0068865_1010637982 | 3300006881 | Miscanthus Rhizosphere | MLGRLQDRTGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLAHVL* |
| Ga0105240_106257772 | 3300009093 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRLLAGAVVVGLIVLTAPLAVLPVLHWLAQFV* |
| Ga0105245_107385562 | 3300009098 | Miscanthus Rhizosphere | LQDSRGEPNLRTRVLAALVIVGLVVLTAPLVVLPLVHLLARLL* |
| Ga0105245_108150252 | 3300009098 | Miscanthus Rhizosphere | MLGRLQDRRGVPRLRVRVLAALVIAGMLILTAPLALVPVVRWMFGFL* |
| Ga0105245_110070902 | 3300009098 | Miscanthus Rhizosphere | MLGRLQDRTGSPNLRTRLLAAAVVVGLIVLTAPLAVLPVVHWLAQLF* |
| Ga0105245_122151752 | 3300009098 | Miscanthus Rhizosphere | MLGRLQDRRGEPRTRVRVLAALVIVGMIVLTAPLVLIPVTQWLFSFL* |
| Ga0105241_110840432 | 3300009174 | Corn Rhizosphere | MLGQLQNQRGQPNLRTRALAALVIVGLLVLTAPLIVLPLVHLLARIL* |
| Ga0105242_110830212 | 3300009176 | Miscanthus Rhizosphere | VLGRLQDRRGDPNLRTRVIAALVIVGLVVLTAPLVVLPLAHLLARML* |
| Ga0105237_106058562 | 3300009545 | Corn Rhizosphere | MLGQLQNRRGQPNLRTRLTAALVVLGLIVLTAPLVVLPLAHLLARIL* |
| Ga0105238_122423301 | 3300009551 | Corn Rhizosphere | APTMLGRLQDRTGSPNLRTRVLAGCVIIGLVVLTAPLAVLPLVHWLARFL* |
| Ga0134128_121198201 | 3300010373 | Terrestrial Soil | VLGRLQDRTGAPNLRTRLLAAAVIVGLVILTAPLAVLPVVHWL |
| Ga0105239_119318842 | 3300010375 | Corn Rhizosphere | MLGRLQNRRGEPTLRVRALAALVVIGLVVLTAPLVV |
| Ga0134126_106073182 | 3300010396 | Terrestrial Soil | MLGRLQDRTGAPNVRTRMLAAAVVIGMVILTAPLVVLPIVHWLAHLL* |
| Ga0164298_110677702 | 3300012955 | Soil | MLGRLQDRTGSPNVRTRWLAAAVIVGLIVLTAPLAVLPV |
| Ga0134077_102830462 | 3300012972 | Grasslands Soil | MLGRLQDRTGSPNLRTRLLAGAVIVGLVVLTAPLAVLPVVHWLAHVL* |
| Ga0134087_101044682 | 3300012977 | Grasslands Soil | MLGRLQDRTGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLVHVL* |
| Ga0164305_115086551 | 3300012989 | Soil | RTAYAPAMLGRLQDRRGEPRLRVRVLAALVIVGMVVLTAPLVVFPVVSWLADHL* |
| Ga0157373_108741792 | 3300013100 | Corn Rhizosphere | MLGRLQDRRGEPRTRVRVLAALVIAGMVLLTSPLVLIPVVRWLVGFL* |
| Ga0157371_107196141 | 3300013102 | Corn Rhizosphere | MLGRLQDRTGSPHRGTRLLAGAVIVGLVVLTAPLAVLPLVHWLVQVL* |
| Ga0157370_101526742 | 3300013104 | Corn Rhizosphere | MLGRLQDRRGEPRLRSRVLAALVIVGLLLLTAPLALIPVVRWLFGFL* |
| Ga0157369_100738262 | 3300013105 | Corn Rhizosphere | MLGQLQDRRGRPNLRTRALAALVIVGLVVLTAPLVVLPVVHLLARIL* |
| Ga0157369_102742292 | 3300013105 | Corn Rhizosphere | MAAYAPDMLGRLQDRTGAPNVRTRMLAAAVVIGMVILTAPLVVLPIVHWLAHLL* |
| Ga0157369_109565922 | 3300013105 | Corn Rhizosphere | MLGRLQDRTGAPNLRTRLLAAAVVVGLVVLTAPIVVLPIVHWLARLL* |
| Ga0157369_114252382 | 3300013105 | Corn Rhizosphere | MLGRLQDRQGAPNVRTRLLAVLVILGMLVLTAPLVVVPVAGWLSRFL* |
| Ga0157378_101624562 | 3300013297 | Miscanthus Rhizosphere | MGPVLGRLQDSRGEPNLRTRALAALVIVVLLVLTAPLVVLPVVHLLARLF* |
| Ga0157372_110128932 | 3300013307 | Corn Rhizosphere | MLGRLQDRRGEPRMRVRVLAALVIAGMVLLTSPLVLIPVVRWLVTLL* |
| Ga0157372_115471981 | 3300013307 | Corn Rhizosphere | MLGRLQDRTGSPHRGTRLLAGAVIVGLVVLTAPLAVLPVVHWLVHVL* |
| Ga0157372_124475912 | 3300013307 | Corn Rhizosphere | MLGRLQDRRGEPRLRVRVLAALVIVGMVVLTAPLVVFPVLSWLADHL* |
| Ga0157372_125607662 | 3300013307 | Corn Rhizosphere | MLGRLQDRTGAPNLRTRLLAAAVVVGLVVLTAPLVVLPIAHWLARL |
| Ga0157372_131715881 | 3300013307 | Corn Rhizosphere | MLGRLQDRTGSPNVRTRLLAAAVIVGLVVLTAPLAVLPVLHWLAQFL* |
| Ga0134081_100434382 | 3300014150 | Grasslands Soil | MLGRLQDRSGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLVHVL* |
| Ga0134079_104036102 | 3300014166 | Grasslands Soil | YSSAVLRQLQGRQGRPNLRTRLLAALVVVGLVVLTAPLVVLPVAHWLAGL* |
| Ga0167645_1113122 | 3300015068 | Glacier Forefield Soil | MLGRLQDRRGEPRLRVRLLAALVIAGMVLLTAPLALIPVARWIVGFL* |
| Ga0134073_102226632 | 3300015356 | Grasslands Soil | MLGRLQDRTGSPNLRTRVLAACVIIGLVILTAPLAVLPVVHWLM |
| Ga0132258_110683981 | 3300015371 | Arabidopsis Rhizosphere | MLPALRDPRGKPSLEVRLLAGLVVLGMVVLTAPLVVVP |
| Ga0132256_1024159212 | 3300015372 | Arabidopsis Rhizosphere | YASAMLGRLQDRRGEPRLRVRVLAALVIAGMVLLTAPLALVPVVRWLMALL* |
| Ga0066655_109645622 | 3300018431 | Grasslands Soil | PNLRTRALAACVIIGLVVLTAPLAVLPLVHWLARFL |
| Ga0066662_100125222 | 3300018468 | Grasslands Soil | MLGRLQDRTGSPNLRTRVLAGAVIVGLIVLTAPLAVLPVLHWLARYL |
| Ga0066662_102246072 | 3300018468 | Grasslands Soil | VLGRLQDRTGSPNLRTRLLAAAIVVGLIVLTAPLAVLPLVHWLARFL |
| Ga0066662_117638801 | 3300018468 | Grasslands Soil | VPWRAAYAPVMLGRLQDRTGSPNLRTRALAACVILGLVILTAPLAVLPVVHWLARFL |
| Ga0193728_12999682 | 3300019890 | Soil | MLGRLQNRTGEPNARTRALAALVIIGLLVLTAPLVMIPLVGWLARVL |
| Ga0197907_109343931 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | RTGAPNLRTRLLAAAVVVGLVVLTAPLVVLPVAHWLARLL |
| Ga0197907_110490302 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIVGLVVLTAPLAVLPLVHWLARFL |
| Ga0206349_11123591 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | LQDRTGAPNVRTRMLAAAVVIGMVILTAPLVVLPIVHWLAHLL |
| Ga0206354_106356302 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LQDRTGSPNLRTRVLAACVIIGLLVLTAPLAVLPLVHWLARFL |
| Ga0206354_106857342 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | QDFLHRTLNPPRAYAPAMLGRLQDRRGEPRARVRFLAGLVIVGMIVLTAPLAVVPLVGWLADHL |
| Ga0206354_116939922 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MMGRLQDRRGEPNLRTRALAGIVVLGMVVLTAPLVVLPVLRWLLRMV |
| Ga0206353_104804552 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIIGLIVLTAPLAVLPLVHWLARFL |
| Ga0206353_107763951 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRLQDRTGAPNVRTRMLAAAVVIGMVILTAPLVVLPIVHWLAHLL |
| Ga0206353_108046262 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRLQNRRGEPTLRVRALAALVLIGMLVLTAPLIVLPVVHWIARFI |
| Ga0206353_108409612 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGLATYARPVLGRLQDRRGEPNLRTGALAALVIVGMVVLTAPLVVFPIAHWIARLV |
| Ga0206353_116591581 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRLQDRRGEPRARVRFLAGLVIVGMIVLTAPLAVVPLVGWLADHL |
| Ga0206353_116983782 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MMGRLQDRRGEPNLRTRALAGIVVLGMVVLTAPLVVLPVL |
| Ga0196959_100703192 | 3300021184 | Soil | MLSRLRDRRGEPSYRTRFLAALVVVGLVVLTAPVIVLPIVRGVAELLR |
| Ga0213882_100051223 | 3300021362 | Exposed Rock | MLGRLQDRRGEPNLRVRLTAALVIVGLVVLTAPIVMIPIINWLSERF |
| Ga0213882_100768161 | 3300021362 | Exposed Rock | MLGRLQDRRGEPNLRTRVLAALVIVGLVILTAPLVVVPLVGWLSRVL |
| Ga0213874_102055352 | 3300021377 | Plant Roots | VGPPYAGLVLGRLQNRRGAPNLRARVLAALVIAGLLVLTAPLVVLPIVRWLAQIL |
| Ga0213880_100273122 | 3300021953 | Exposed Rock | LVLGRLQNRRGAPNLRARVLAALVIAGLLVLTAPLVVLPIVRWLAQIL |
| Ga0224712_100073911 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | QDRTGAPNVRTRMLAAAVVIGMVILTAPLVVLPIVHWLAHLL |
| Ga0224712_100129331 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQLQNRRGEPNLRTRLLAALVILGLLVLTAPLIVLPVVQWLARVL |
| Ga0224712_103125362 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | KSWAAYAPAMLGRLQDRRGEPNLRTRALAGLVVLGLVVLTAPLVVMPLLGWLARML |
| Ga0224712_106278331 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRLQDRTGSPHRGTRLLAGAVIVGLVVLTAPLAVLP |
| Ga0207705_100081062 | 3300025909 | Corn Rhizosphere | MLGRLQDRTGAPNLRTRLLAAAVVVGLVVLTAPLVVLPIAHWLARLL |
| Ga0207705_102388812 | 3300025909 | Corn Rhizosphere | MGPVLGRLQDSRGEPNLRTRALAALVIVGLVVLTAPLVVLPVVHLLARLF |
| Ga0207705_104639601 | 3300025909 | Corn Rhizosphere | SPPSAYAPKMLGRLQDRTGSPNLRTRLLAAAVIVGMVVLTAPLAVLPLLHWLAQLL |
| Ga0207705_108058142 | 3300025909 | Corn Rhizosphere | MLGRLQDRRGEPRARVRVLAALVIVGMLLLTAPLVLVPVTRWLLSFL |
| Ga0207707_10000071115 | 3300025912 | Corn Rhizosphere | MLGRLQDRRGEPRLRVRLLAALVVAGLVLLTAPLALIPVVRWLFGFL |
| Ga0207707_100445973 | 3300025912 | Corn Rhizosphere | MLGRLQDRRGEPNLRTRALAGLVVLGLVVLTAPLVVMPLLGWLARML |
| Ga0207707_103207612 | 3300025912 | Corn Rhizosphere | MVLGRLQDRTGAPNLRTRLLAAAVIVGLVILTAPLAVLPVVHWLAHIL |
| Ga0207707_103473902 | 3300025912 | Corn Rhizosphere | MGPVLGRLQDSRGEPNLRTRVLAALVIVGMVVLTAPLVVLPLVHLLARIL |
| Ga0207707_107293382 | 3300025912 | Corn Rhizosphere | MLGRLQDRTGSPNARTRVFAAAVIIGMIVLTAPLAVLPVVHWLARFL |
| Ga0207695_109753832 | 3300025913 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRLLAGAVVVGLIVLTAPLAVLPVLHWLAQFV |
| Ga0207671_104265112 | 3300025914 | Corn Rhizosphere | MLGQLQNRRGQPNLRTRLTAALVVLGLIVLTAPLVVLPLAHLLARIL |
| Ga0207660_105634522 | 3300025917 | Corn Rhizosphere | MLGRLQDRTGSPNARTRVFAAAVIIGMIVLTAPLAVLPVVH |
| Ga0207660_106527402 | 3300025917 | Corn Rhizosphere | MLGRLQDRRGAPRLRVRVLAALVIVGMIVLTAPLVVVPLAGWLADHL |
| Ga0207660_109775111 | 3300025917 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRLLAAAVIVGMVVLTAPLAVLPLLHWLAQLL |
| Ga0207657_103882872 | 3300025919 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRVLAACVIIGLLVLTAPLAVLPLVHWLARFL |
| Ga0207657_105079302 | 3300025919 | Corn Rhizosphere | MGLVLGRLQDSRGEPNLRTRVLAALVIVGLVVLTAPLVVLPLVHLLARLL |
| Ga0207657_105117302 | 3300025919 | Corn Rhizosphere | PRARVRVLAALVIVGMLLLTAPLVLVPVTRWLLSFL |
| Ga0207657_107414791 | 3300025919 | Corn Rhizosphere | MLGRLQDRRGEPRMRVRVLAALVIAGMVLLTAPLVLVPVVRWLAALL |
| Ga0207687_118476771 | 3300025927 | Miscanthus Rhizosphere | RLQDRRGEPRTRVRVLAALVIVGMIVLTAPLVLIPVTQWLFSFL |
| Ga0207664_118912931 | 3300025929 | Agricultural Soil | MLGRLQDRRGHANLRTRALAALVVLGLVVLTAPLVVLPVLHWLARMF |
| Ga0207704_115619051 | 3300025938 | Miscanthus Rhizosphere | SARSAYAPAMLGRLQDRTGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLAHVL |
| Ga0207661_101688531 | 3300025944 | Corn Rhizosphere | GAPHRGTRLLAGAVIVGLVVLTAPLAVLPVVHWLTHFV |
| Ga0207667_101165961 | 3300025949 | Corn Rhizosphere | GQLQNRRGEPNLRTRLLAALVILGLLVLTAPLIVLPVVQWLARVL |
| Ga0207667_107837782 | 3300025949 | Corn Rhizosphere | VLGRLQDRRGAPSLRTRAMAALVILGMIVLTAPLVVVPFVGWVTHHLL |
| Ga0207667_111649772 | 3300025949 | Corn Rhizosphere | MLGRLQDRTGSPNLRTRLLAGAVIVGLVVLTAPLAVLPVVHWLARFL |
| Ga0207648_112780952 | 3300026089 | Miscanthus Rhizosphere | MLARLQDRRGEPRTRVRVLAALVIVGMIVLIAPFVLIPVTQWLFSFL |
| Ga0209265_10339482 | 3300026308 | Soil | DRSGSPNLRTRVLAAAVIIGLIVLTAPLAVLPVVHWLVHVL |
| Ga0209474_105403312 | 3300026550 | Soil | MLGRLQDRRGEPRLRARVLAALVIAGMLLLTAPLVLVPVVRWMFGFL |
| Ga0209796_100273332 | 3300027766 | Agave | VLGRLQDRTGSPNLRTRLLAAAVIVGMIILTAPLAVLPLVHWLARFL |
| Ga0209796_100353942 | 3300027766 | Agave | MLGRLQDRRGEPNLRTRALAALVILGLVVLTAPLVMLPLLHWIARLV |
| Ga0268254_100461712 | 3300030515 | Agave | RAASGPHRAPNLRTRVLAAAIIVGLVVLTAPLAVLPVVHWLAHML |
| Ga0318561_104369622 | 3300031679 | Soil | VLSRLQDTRGEPNLRVRALALLVIVGLVVLTAPVVMVPLIEWLAHQI |
| Ga0308175_1007077892 | 3300031938 | Soil | MLGRLQDRRGAPNLRTRALAGLVVLGMVVLTAPLVVLPVLHWFAGML |
| Ga0308175_1012359611 | 3300031938 | Soil | GEPRARVRVLAALVIVGMLLLTAPLVLVPVTRWLLSFL |
| Ga0308175_1024379541 | 3300031938 | Soil | LRRTAQAAGAGFATYARFVLGRLQDRRGDPNLRTRVLAALVILGMVVLTAPLVVFPIAHWIARLV |
| Ga0308176_122086462 | 3300031996 | Soil | MLGRLQDRRGGPNLRTRLLAGVVVLGMVVLTAPLAVLPVLRWLTGML |
| Ga0318562_106281961 | 3300032008 | Soil | LSRLQDTRGEPNLRVRALALLVIVGLVVLTAPVVMVPLIEWLAHQI |
| Ga0335074_101659993 | 3300032895 | Soil | VLSRLQDTQGAPRIRVRLLAALVIVGLLVLTAPIVMVPLVGWLAHLA |
| ⦗Top⦘ |