| Basic Information | |
|---|---|
| Family ID | F047460 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLR |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 59.46 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 99.33 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.289 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (36.913 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.181 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (75.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.29 % |
| All Organisms | root | All Organisms | 6.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 36.91% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 30.87% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 8.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026740 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028148 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028157 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028463 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24752J21851_10566111 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLLHFVMFECIYDHFVTALNSAQMGQSGAINAKVRATK |
| Ga0070690_1002275591 | 3300005330 | Switchgrass Rhizosphere | MFLLHFVMFGCIYYRFVATLNLVQMGQFGAINAKVRITKSRLNLSLRTRPIHTIGP* |
| Ga0070690_1009848501 | 3300005330 | Switchgrass Rhizosphere | MFGCIYDCFVTALNSVQMGQSGAINAKVRATKSRLNLSLRTCPIHTIGP* |
| Ga0070666_110830201 | 3300005335 | Switchgrass Rhizosphere | MYLLHFVMFECIYDCFVTALNSVQMGHSGAINGKVRATKSRLNLSLRTHPI |
| Ga0070668_1019334381 | 3300005347 | Switchgrass Rhizosphere | MLHFVMFECISDRFVSALNSMQMGQSGATNAKDCVTKSRQNLSLRTCPIHTIGP* |
| Ga0070668_1022802231 | 3300005347 | Switchgrass Rhizosphere | MFLLHFIMFGCIYDHFVTALNSVQMGQSGATNAKVHVTKSRLNLSLRTCPI |
| Ga0070669_1014385121 | 3300005353 | Switchgrass Rhizosphere | IWDHFVTALNSMQMGQSITINAKVRVKKSHSNLSLRTRLIHTIGP* |
| Ga0070671_1013617341 | 3300005355 | Switchgrass Rhizosphere | DPKLMFLLHFVMFECIYDHFVTALNSAQMGQSGAINAKVRATKSRLNFSLRTRPIHTIGP |
| Ga0070671_1015154991 | 3300005355 | Switchgrass Rhizosphere | DPKLMFLLHFVMFECIYDHFVTALNSAQMGQSGAINAKVHATKSRLNFSL* |
| Ga0070667_1021433181 | 3300005367 | Switchgrass Rhizosphere | CIWDRFVTALNSMQMGQSIAINAKVRVKKSRLNLSLRTRLIHKIGP* |
| Ga0070703_102095791 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLLHFVMFGCIYDCFVTALNSVQMGQSGAINVKVRATKS |
| Ga0070708_1020630042 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LLHFVMFGCIWDRFVTALNSMQLDQSGAINVKVRATKLRLNLSQRMRPIHTIGP* |
| Ga0068859_1021666221 | 3300005617 | Switchgrass Rhizosphere | MFWGIWERFVTALNSMQMGQSGAINAKVRVTKSRLNLSPRTRP |
| Ga0068863_1026669591 | 3300005841 | Switchgrass Rhizosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATKSRLNLSLRT |
| Ga0068858_1020227792 | 3300005842 | Switchgrass Rhizosphere | MFECIYDHFVTALNSAQMGQSGAINAKVRATKSRLNFSLRT |
| Ga0068858_1022133311 | 3300005842 | Switchgrass Rhizosphere | FGCIWERFVTALNSMQMGQSGAINAKVRVTMSRLNLSLQTRPIHTIGP* |
| Ga0068858_1025442171 | 3300005842 | Switchgrass Rhizosphere | FGCIWDRFVTALNSMQMGQSIAINAKVRVTKSRLNLSLRTRPIHTIGP* |
| Ga0068860_1009377881 | 3300005843 | Switchgrass Rhizosphere | VFLLHFVTFGCIYDHFVTAPNLVQMGHSGAINAKFRATKSRLNLSLR |
| Ga0068860_1019964541 | 3300005843 | Switchgrass Rhizosphere | TNAREPHHGTLNHVLLHFVMFGCIWERFITALNSMQMGQSSPINAKVRVTKSRLNLSLRTCPIHTIGP* |
| Ga0068860_1027794011 | 3300005843 | Switchgrass Rhizosphere | MFLLHFVMFGCLYYHFVATLNSVQMGQSGAINAKVRATKSHM |
| Ga0105250_103666621 | 3300009092 | Switchgrass Rhizosphere | MYLLHFVMFECIYDCFVTALNSVQMGHSGAINGKVRATKSRLNLSLRTHPLNTVG |
| Ga0105137_1094411 | 3300009972 | Switchgrass Associated | MFGCIWDRFITALNSVKMSQSVAINAKVRATKSPLNMSLRT |
| Ga0105136_1039771 | 3300009973 | Switchgrass Associated | MFLLHFVMFGCIYDRFVTTLNSVQMGQSGAINAKVHATKSRRNFSLRTHPIHTMGP |
| Ga0105128_1110081 | 3300009976 | Switchgrass Associated | MFLLHFVMFGCIYDHFVTTLNSVQMGQSGAINAKVRATKLHLNLSL |
| Ga0105135_1114431 | 3300009980 | Switchgrass Associated | MFLLHFVMFVCIYDHFVTTLNSVQMGQSGAINAKVRATKLHLNL |
| Ga0105035_1225411 | 3300009988 | Switchgrass Rhizosphere | LMFLLHFVMFGCIYDCFVTALNSVQMGQSGAINAKVRATKSRRDFLQ* |
| Ga0105131_1218661 | 3300009989 | Switchgrass Associated | MFGCIYDYFVATLNSVQMGQSGEINAKVRATKSHMN |
| Ga0105132_1106741 | 3300009990 | Switchgrass Associated | FGCIYDRFVTALNTVQMGQSGAINAKVCVTKSRLNFSL* |
| Ga0105126_10562261 | 3300009994 | Switchgrass Associated | MFLLHFLMFECIYDHFVTALNSTQMGQSGAINAKVRATKSRLNFSLRTRPIH |
| Ga0105139_10121641 | 3300009995 | Switchgrass Associated | MFGCIWDRFVTALNSMEMGQSIAINAKVRVTKSRLNLSLRTRPIHTIGP |
| Ga0105139_10315131 | 3300009995 | Switchgrass Associated | MFGCIWDRFVTALNSVQMGQSGAINAKVRVTMSRL |
| Ga0105139_10889551 | 3300009995 | Switchgrass Associated | MFGCIYDYFVATLNSVQMGQSGEINAKVRATKSHMNLSLRMRPIHTIGPK |
| Ga0105139_11190451 | 3300009995 | Switchgrass Associated | MFLLHFVMFGCIDGRFVTALNSVQMGQSGAINAKVRATKSRLNLSL |
| Ga0105139_11236541 | 3300009995 | Switchgrass Associated | MFLLHLVMFGCIYDRFVTALNSVQMGQSGSTNAKVRATKLHLNLSLRTRPIH |
| Ga0134128_123283851 | 3300010373 | Terrestrial Soil | MFGCIWDRFVTAPNSVQMGQSGAINAKVRVTKSRLNL |
| Ga0134126_116640181 | 3300010396 | Terrestrial Soil | MFLLHFVIFGCIYDRFVTALNSVQMGQFGAINAKVRATKSHLNLSLRTRPIHTIG |
| Ga0134126_127666891 | 3300010396 | Terrestrial Soil | MFLLHFVMFGCIYDCFVTALNSVQMGQSGAINAKVRATKSRL |
| Ga0134121_117526222 | 3300010401 | Terrestrial Soil | TMGPKTHVLLHFVMFGCIWDRFVTALNSMQLDQSGAINVKVRATKLRLNLSQRMRPIHTIGP* |
| Ga0163163_131186511 | 3300014325 | Switchgrass Rhizosphere | MFFLHFVMFGCIYDRFVTTLNSVQMGQSGAINAKVR |
| Ga0157379_117646841 | 3300014968 | Switchgrass Rhizosphere | MFLLHFVIFGCIYDRFVTALNSVQMGQFGAINAKVRATK |
| Ga0157379_123152251 | 3300014968 | Switchgrass Rhizosphere | MYLLHFVMFECIYDCFVTALNSVQMGHSGAINGKVRATKSRLNLSLRTHPINTVGPKT |
| Ga0182099_10267781 | 3300015278 | Switchgrass Phyllosphere | MFGCIYYRFVATLNSVQMGQSGAINAKVRATKSHMNLSLRMRPIHTI |
| Ga0182104_10953281 | 3300015297 | Switchgrass Phyllosphere | MFGCIYDRFVTTLNSVQMDQSGAINVKVRATKSHLNWSLQTRPIHTIGPKHM |
| Ga0182104_11128231 | 3300015297 | Switchgrass Phyllosphere | MFLLHFVIFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLRTRPIHTIGPQTHVLVCFI |
| Ga0182180_10938461 | 3300015306 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLRTRPIHTIGPQTH |
| Ga0182182_10383132 | 3300015311 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLRTRPIH |
| Ga0182182_10420351 | 3300015311 | Switchgrass Phyllosphere | MFLLHFVMFGCLYYRFVATLNSVQMGQSGAINAKVRATKSHMNLSL |
| Ga0182168_11362411 | 3300015312 | Switchgrass Phyllosphere | MFECIYDHFVTALNSAQMGQSGAINAKVRATKSRL |
| Ga0182164_10637701 | 3300015313 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDHFVTALNSAQMGQSGAINAKVRAT |
| Ga0182136_11356031 | 3300015317 | Switchgrass Phyllosphere | MFGCIYDRFVTTLNSVQMDQSGAINVKVRATKSHLNWSL |
| Ga0182181_11090751 | 3300015318 | Switchgrass Phyllosphere | VFLLHYVMFGCIYDRFVTTLNSVQMDQSGAINVKVRATKSHLNWSLQT |
| Ga0182134_11469431 | 3300015324 | Switchgrass Phyllosphere | MFLLHFVMFGCIYYRFIATLNSVQMGQSGAINAKVCAT |
| Ga0182148_10790571 | 3300015325 | Switchgrass Phyllosphere | MFGCIWERFVTALNSMQMGQSGAINAKVRVTMSRLN |
| Ga0182166_10481821 | 3300015326 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATNS |
| Ga0182166_10595791 | 3300015326 | Switchgrass Phyllosphere | TLWDPKLMFLLHFVMFGCIYDCFVTALNSVQMGPFGAINAKVRATKSRLNL* |
| Ga0182166_10742981 | 3300015326 | Switchgrass Phyllosphere | MFGSIWDRFATALNSVQMGQSGAINAKVRATKSRLNLSLRTHPIHT |
| Ga0182166_11345411 | 3300015326 | Switchgrass Phyllosphere | MFGSIWDRFPTALNSVQMGQSGAINAKVRATKSRL |
| Ga0182114_11629421 | 3300015327 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDSFVTALNSVQMGQSGAINVKV |
| Ga0182153_11542181 | 3300015328 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDHYVTALNSAQMGQSGAINAKVRATKSRLNFSLRTRPIH |
| Ga0182135_11026661 | 3300015329 | Switchgrass Phyllosphere | MVLLHFVMFGCIYYHFVATLNLVQMGQFGAINAKVRITKSRLNLSLRTR |
| Ga0182135_11276031 | 3300015329 | Switchgrass Phyllosphere | MFLLHFVMFGCIWDRFVTALNSMQMGQSIAINAKVRVTKSHLNLSLQTC |
| Ga0182152_10661921 | 3300015330 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDHFVTALNSAQMGQSGAINAKVRATKSR |
| Ga0182152_11305991 | 3300015330 | Switchgrass Phyllosphere | MFLLHFVMFECIYDHFVTALNSAQMGQSGAINAKVRATKSRLNFSLRTR |
| Ga0182147_10899351 | 3300015333 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATNSRLNLSLR |
| Ga0182147_11166131 | 3300015333 | Switchgrass Phyllosphere | MQNFMFWCIWDHFVCALNSMQMGQSGAINAKDRAANSR |
| Ga0182147_11219931 | 3300015333 | Switchgrass Phyllosphere | MFLLHFVIFGCIYDCFVTALNSVQMGQSGAINAKVRATKS |
| Ga0182147_11349481 | 3300015333 | Switchgrass Phyllosphere | MFLLHFIMFGCIYDHFVTALNSVQMGQSGATNAKVHVTKSRLNLSLR |
| Ga0182116_11081561 | 3300015335 | Switchgrass Phyllosphere | MFGCIWDHFIAALDSVKMSQSVAINAKVRATKSRLNL |
| Ga0182116_11617321 | 3300015335 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATNSRLNLSLRTRPIH |
| Ga0182116_11735691 | 3300015335 | Switchgrass Phyllosphere | MFLLHFVMFGCIYYRFVATLNLVQMGQFGAINAKVRIT |
| Ga0182150_11585221 | 3300015336 | Switchgrass Phyllosphere | MFLFHFVMFRCIYDYFVTALNSVQMGQSGAINAKVRATKSRLNL |
| Ga0182137_11325921 | 3300015338 | Switchgrass Phyllosphere | MFGSIWDRFATALNSVQMGQSGAIKAKVRATKSRLNLSLRKRPIHTIEP* |
| Ga0182149_10584851 | 3300015339 | Switchgrass Phyllosphere | MFLLHFVTFGCIYDHFVTALNLVQMDHSGAINAKVRA |
| Ga0182149_10878271 | 3300015339 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQFGAINAKVRATKSHLNLSLRTRPIHTIGP |
| Ga0182133_10943921 | 3300015340 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATKSRLNLSLRTRP |
| Ga0182133_11039061 | 3300015340 | Switchgrass Phyllosphere | MFECISDRFVSALNSMQMGQSGAINAKVRATKSRLNFSLRMRPIHTIGP |
| Ga0182133_11373501 | 3300015340 | Switchgrass Phyllosphere | HVLLHFVMFGCIWERFVTALNSMQMGQSGAINAKVRVTMSRLNLSLQTHPIHTIGP* |
| Ga0182115_12883661 | 3300015348 | Switchgrass Phyllosphere | VFLLHYVMLGCIYDRFVTTLNSVQMDQSGAINVKVRATKSHLNWSLQTR |
| Ga0182163_11337931 | 3300015350 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATNSRL |
| Ga0182169_13165711 | 3300015352 | Switchgrass Phyllosphere | MFGSIWDRFATALNSVQMGQSGAIKAKVRATKSRLNLSL |
| Ga0182179_11498321 | 3300015353 | Switchgrass Phyllosphere | MFGSIWDRFVTALNSVQMGQSSAINAKVRVTMSRLN |
| Ga0182167_10956971 | 3300015354 | Switchgrass Phyllosphere | MFGCIYDRFVIALNSVQMGQSGAINAKVRATKSRLNLSLRTRPIH |
| Ga0182167_13651881 | 3300015354 | Switchgrass Phyllosphere | MFLLHFIMFGCIYDHFVTALNSVQMGQSGATNAKVHVTKSRLNLSLRTCPIH |
| Ga0182195_11593321 | 3300017414 | Switchgrass Phyllosphere | MFGCIWDRFVTALNSVQVGQSGAINAKVRVTKSRLNL |
| Ga0182213_11525801 | 3300017421 | Switchgrass Phyllosphere | KLKFLLHFLKFGCIYDRFVIALNLVQMGHSGAIKAKVRATKTHLNLSLQTLSIHTIGP |
| Ga0182213_11525802 | 3300017421 | Switchgrass Phyllosphere | MFGCIYDRFVTALNSVQMGQSGAINAKDRAANSRQFFSQRTHP |
| Ga0182213_12475101 | 3300017421 | Switchgrass Phyllosphere | MFGSIWDRFATVLNSVQMGQSGAINAKVCATKSRLNLSLR |
| Ga0182201_11034451 | 3300017422 | Switchgrass Phyllosphere | MFLLHLVMFGCIWDRFVTALNSVQMGQSGATNAKV |
| Ga0182214_11007181 | 3300017440 | Switchgrass Phyllosphere | MFWCIWDRFVTALNSVQMGQSGAINAKVRVTKSRLNL |
| Ga0182216_11438291 | 3300017693 | Switchgrass Phyllosphere | MFLLHFIMFGCIYDRFVATLNSVQMGQSGEINAKVR |
| Ga0182211_11667281 | 3300017694 | Switchgrass Phyllosphere | MFLLHFVIFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLRTRPIHTIGPQTHVLVCFIMF |
| Ga0182178_10069281 | 3300020023 | Switchgrass Phyllosphere | MFGCIWDRFVTALNSVQMGQSGAINAKVRVTMSRLNLSLRTCQIH |
| Ga0182178_10083591 | 3300020023 | Switchgrass Phyllosphere | MFLLHFVIFGCIYDRFVTALNSVQMGQFGAINAKVRATKSHLNLSLRTRP |
| Ga0182178_10155811 | 3300020023 | Switchgrass Phyllosphere | MFLLHFVMFGCIYDCFVTALNSVQMGQSGAINAKV |
| Ga0182146_1038351 | 3300020033 | Switchgrass Phyllosphere | MFGCIYDCFVTALNSVQMGQSGAINAKVRATKSRLNL |
| Ga0207670_102966582 | 3300025936 | Switchgrass Rhizosphere | GCIRDHFVTALNSVQMGQSGATNAKVRVTKSRLNL |
| Ga0207668_103666021 | 3300025972 | Switchgrass Rhizosphere | MFLLHFVMFGCIYYRFVATLNLVQMGQFGAINAKVRITKSRLNLSLRTH |
| Ga0207668_118066461 | 3300025972 | Switchgrass Rhizosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLSLSLRTRPIHTN |
| Ga0207703_123351781 | 3300026035 | Switchgrass Rhizosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLRT |
| Ga0207641_109084211 | 3300026088 | Switchgrass Rhizosphere | TRPIHTMGPKTHVLLHFVMFGCIWDRFVTALNSMQLDQSGAINVKVRATKLRLNLSQRMRPIHTIGP |
| Ga0207675_1023203711 | 3300026118 | Switchgrass Rhizosphere | MFLLHFVTFGCIYDHFVTARNLVQMGHSGAINAKVRATKSRLNLSL |
| Ga0207439_1019442 | 3300026740 | Soil | MFLLHFVMFGCIYDHFVTALNSAQMGQSGAINAKVRATKSRL |
| Ga0268322_10018611 | 3300028049 | Phyllosphere | MFLLHFVMFGCIYYRFVATLNSVQMGQSGAINAKVRATKSHMNLSLRMRPIHT |
| Ga0268322_10024351 | 3300028049 | Phyllosphere | MFGCIWDRFVTALNSVQMGQSGAINAKVRVTMSRLN |
| Ga0268322_10155201 | 3300028049 | Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATNSRLNLSLRTRPIHTN |
| Ga0268322_10511851 | 3300028049 | Phyllosphere | MFLLHFVMFGCLYYRFVATLNSVQMGQSGAINAKVRATKSHMNLSLRMRPIHT |
| Ga0268322_10514861 | 3300028049 | Phyllosphere | MFLMHFVTFGCIYDRFVTELNLVQMGHSCAINAKVCATKSRLNLSQR |
| Ga0268328_10031371 | 3300028050 | Phyllosphere | MFLLHFVMFGCLYYHFVATLNSVQMGQSGAINAKVRATKSHMNLS |
| Ga0268328_10639981 | 3300028050 | Phyllosphere | MFLLHLVMFGCIWDRFVTALNSVQMGQSGATNAKVCVTKSRLNLSLRT |
| Ga0268344_10094201 | 3300028051 | Phyllosphere | MFLLHFVMFGCIYDRFVATLNSVQMGQSGEINAKVRATKSHLNLSLRMCPIHTIG |
| Ga0268346_10330981 | 3300028053 | Phyllosphere | MFLLHFIMFGCIYDHFVTALNSVQMGQSGATNAKVHVTKSRLNLSLRTCPIHTIG |
| Ga0268338_10021511 | 3300028055 | Phyllosphere | MFGCIWDRFVTALNSVQMGQSGAINAKVRVTMSRLNLSLR |
| Ga0268352_10365301 | 3300028057 | Phyllosphere | MFLLHFVMFGCIDGRFVTALNSVQMGQSGAINAKVRATKLRLNLSLRTRLIHTIGP |
| Ga0268332_10111481 | 3300028058 | Phyllosphere | MPWDPKLMFLMHFVMFGCIYDRFVATLNSVQMGRTGVINAKVHATK |
| Ga0268314_10162891 | 3300028061 | Phyllosphere | MFLLHFVTFGCIYDRFVTALNLVQMGHSGAINAKVRATKSRLNF |
| Ga0268314_10293161 | 3300028061 | Phyllosphere | MFLLHFVIFGCIYDRFVTALNSVQMGQFGAINAKVRATKSHLN |
| Ga0268340_10541801 | 3300028064 | Phyllosphere | MFLLHFVMFGCLYYHFVATLNSVQMGQSGAINAKVRATKSHMNLSLRM |
| Ga0268355_10116391 | 3300028139 | Phyllosphere | MFLLHFVMFGCIYYRFVATLNSVQMGQSGAINAKV |
| Ga0268347_10016741 | 3300028142 | Phyllosphere | MFLLHFVMFGCLYYRFVATLNSVQMGQSGAINAKVRATKSHMNFSLRMR |
| Ga0268347_10065001 | 3300028142 | Phyllosphere | MFLLHLVMFGCIWDRFVTALNSVQMGQSGATNAKVRVTKSRLNLS |
| Ga0268348_10127211 | 3300028143 | Phyllosphere | MFWCIWERFVTALNSMQMGQSGAINAKVRVTKSRLNL |
| Ga0268354_10230311 | 3300028148 | Phyllosphere | MFLLHFVMLGCIYYCFVATLNSVQMGQSGAINAKVRITK |
| Ga0268354_10236521 | 3300028148 | Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATK |
| Ga0268353_1083811 | 3300028149 | Phyllosphere | MFLLHFVMFGCLYYRFVATLNSVQMGQSGAINAKVRATKSHM |
| Ga0268343_10066151 | 3300028150 | Phyllosphere | VLFHFVMFGSIWDRFATALNSVQMGQSGAIKAKVRATKSRLNLSLRTRPMHTIGP |
| Ga0268308_10028431 | 3300028151 | Phyllosphere | MFLLHFVMFGCIYYRFVATLNLVQMGQFGAINAKVRITKSRLNLSLRTRPIHTIGP |
| Ga0268320_10301551 | 3300028153 | Phyllosphere | MFGCIYDRFVATLNSVQMGQSGEINAKVRATKSHLNLSLRMRP |
| Ga0268341_10010501 | 3300028154 | Phyllosphere | HVLLHFVMFGCIWDRFITALNSVKMSQSVAINAKVGATKSRLNLSLRTRPIHTNGP |
| Ga0268318_1006041 | 3300028157 | Phyllosphere | MFLLHFVMFGCIYDHFVTALNSAQMGQSGAINAKVRATKSRLNFSLRTH |
| Ga0268312_10039471 | 3300028248 | Phyllosphere | HVLFLFIMFGCIWDRFVTALNSVQMGQSGATNAKVRATKSRLNLSL |
| Ga0268324_10073951 | 3300028251 | Phyllosphere | MFLLHFVMFGCIYDCFVTALNSVQMGQSGAINVKV |
| Ga0268325_1022081 | 3300028463 | Phyllosphere | MFLLHFVMFECIYDHFVTALNSAQMGQSGAINAKVRATKSRLN |
| Ga0268325_1037541 | 3300028463 | Phyllosphere | MFLLHFVMFGCIYYRFVATLNLVQMGQFGAINAKVRITKSRLNFS |
| Ga0268317_10007981 | 3300028468 | Phyllosphere | MFGCIYDRFVIALNSVQMGQSGAINAKVRATKSRWNFSLRTH |
| Ga0268317_10028221 | 3300028468 | Phyllosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLR |
| Ga0268337_10052891 | 3300028469 | Phyllosphere | MFLLHFVMFGCIYDRFVTALNSVQMGQSGAINAKVRATKSHLNLSLRTRPIHTIGPQTHV |
| Ga0268323_10099191 | 3300028471 | Phyllosphere | MFLLHFVMFGCIYDRFVATLNSLQMGQSGAINAKVRATKSHMNLSLQTRPIHTIGP |
| Ga0268315_10078171 | 3300028472 | Phyllosphere | MFLLHFVIFGCIYDRFVTALNSVQMGQSGAINAKVRATKSRLNLSLRTRPIHTIGS |
| Ga0268319_10101541 | 3300028473 | Phyllosphere | MFLLHFVMFGCIYDYFVTALNSVQMGQSGAINAKVRATNSRLNL |
| Ga0268327_10007141 | 3300028475 | Phyllosphere | TMGPQTHVLLHFVMFGCIWERFVTALNSMQMGQSGAINAKVRVTMSRLNLSLQTRPIHTIGP |
| Ga0268327_10219811 | 3300028475 | Phyllosphere | LFHFVMFGSIWDRFATALNTVQMGQSGAINAKVRATWSRLNLTLRTRPIHTIGP |
| Ga0268329_10239101 | 3300028476 | Phyllosphere | MFVCIWDRFVTALNSVQMGQSGAIHAKVRVTKSRLNLSL |
| Ga0268329_10296381 | 3300028476 | Phyllosphere | VFLLHYVMFGCIYDRFVATLNLVQMGQSGAINAKVCVTMSCL |
| Ga0268313_10122671 | 3300028523 | Phyllosphere | MFGCIYDRFVATLNSVQMGQSGEINAKVRATKSCRN |
| Ga0268339_10087752 | 3300028526 | Phyllosphere | MFGCIYDYFVATLNSVQMGQSGEINAKVRATKSHM |
| Ga0268339_10191791 | 3300028526 | Phyllosphere | VFLFHYVMFGCIYDRFVTTLNSVQMDQSGAINVKVCATKSHRNW |
| Ga0268335_10039341 | 3300028527 | Phyllosphere | MFLLHFVMFGCIYDCFVTALNSVQTGQSGAINVKVRA |
| Ga0268335_10111591 | 3300028527 | Phyllosphere | MVGCIWDRFVTALNSMEMGQSIAINAKVRVTKSRLNLSLRTHSIHT |
| Ga0214493_11564112 | 3300032465 | Switchgrass Phyllosphere | MFGCIWERFLTALNSMQMGQSGPINAKVRVTNSRMNLS |
| ⦗Top⦘ |