NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047377

Metagenome / Metatranscriptome Family F047377

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047377
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 55 residues
Representative Sequence MSKETKETSTKDKIIKFIDAISGENYAAANKYLQSAVQDKIESRIRQAAEKPLF
Number of Associated Samples 117
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 24.00 %
% of genes from short scaffolds (< 2000 bps) 70.00 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (78.667 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(30.000 % of family members)
Environment Ontology (ENVO) Unclassified
(84.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF03420Peptidase_S77 44.67
PF07068Gp23 8.00
PF13884Peptidase_S74 2.00
PF07230Portal_Gp20 2.00
PF02502LacAB_rpiB 0.67
PF00294PfkB 0.67
PF13307Helicase_C_2 0.67
PF14819QueF_N 0.67
PF00365PFK 0.67
PF03567Sulfotransfer_2 0.67
PF00755Carn_acyltransf 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.67
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A78.67 %
All OrganismsrootAll Organisms21.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10121884Not Available1023Open in IMG/M
3300000116|DelMOSpr2010_c10014042Not Available4059Open in IMG/M
3300000116|DelMOSpr2010_c10095788Not Available1132Open in IMG/M
3300001450|JGI24006J15134_10000256Not Available36229Open in IMG/M
3300001460|JGI24003J15210_10012568All Organisms → cellular organisms → Bacteria3378Open in IMG/M
3300001460|JGI24003J15210_10112635Not Available757Open in IMG/M
3300001720|JGI24513J20088_1002208Not Available2909Open in IMG/M
3300001956|GOS2266_1047672All Organisms → Viruses → Predicted Viral1579Open in IMG/M
3300003478|JGI26238J51125_1027553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1291Open in IMG/M
3300003478|JGI26238J51125_1079905Not Available631Open in IMG/M
3300004448|Ga0065861_1193674Not Available1409Open in IMG/M
3300004457|Ga0066224_1165903Not Available611Open in IMG/M
3300005239|Ga0073579_1566709Not Available832Open in IMG/M
3300005747|Ga0076924_1085782Not Available20560Open in IMG/M
3300006025|Ga0075474_10000725Not Available13067Open in IMG/M
3300006029|Ga0075466_1057809Not Available1127Open in IMG/M
3300006750|Ga0098058_1038602Not Available1370Open in IMG/M
3300006752|Ga0098048_1000243Not Available27961Open in IMG/M
3300006789|Ga0098054_1046492Not Available1670Open in IMG/M
3300006789|Ga0098054_1089177Not Available1159Open in IMG/M
3300006789|Ga0098054_1131456Not Available928Open in IMG/M
3300006793|Ga0098055_1025215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2503Open in IMG/M
3300006793|Ga0098055_1094717Not Available1169Open in IMG/M
3300006793|Ga0098055_1107310Not Available1088Open in IMG/M
3300006916|Ga0070750_10000049Not Available47012Open in IMG/M
3300006916|Ga0070750_10000818Not Available17313Open in IMG/M
3300006916|Ga0070750_10019990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae3410Open in IMG/M
3300006919|Ga0070746_10248055Not Available832Open in IMG/M
3300006920|Ga0070748_1240601Not Available653Open in IMG/M
3300006921|Ga0098060_1002118Not Available7765Open in IMG/M
3300006921|Ga0098060_1092741Not Available859Open in IMG/M
3300006924|Ga0098051_1013130All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2476Open in IMG/M
3300006947|Ga0075444_10056425Not Available1835Open in IMG/M
3300006990|Ga0098046_1053260Not Available943Open in IMG/M
3300007276|Ga0070747_1003764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae7038Open in IMG/M
3300007557|Ga0102821_1192497Not Available520Open in IMG/M
3300008012|Ga0075480_10018774Not Available4256Open in IMG/M
3300008958|Ga0104259_1038133Not Available514Open in IMG/M
3300008993|Ga0104258_1014846Not Available1443Open in IMG/M
3300009002|Ga0102810_1037336All Organisms → Viruses → Predicted Viral1586Open in IMG/M
3300009002|Ga0102810_1074621All Organisms → Viruses → Predicted Viral1068Open in IMG/M
3300009149|Ga0114918_10201906Not Available1154Open in IMG/M
3300009409|Ga0114993_10892779Not Available637Open in IMG/M
3300009420|Ga0114994_10009662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae6886Open in IMG/M
3300009420|Ga0114994_10055738Not Available2721Open in IMG/M
3300009422|Ga0114998_10566031Not Available534Open in IMG/M
3300009543|Ga0115099_10786657Not Available824Open in IMG/M
3300009543|Ga0115099_10903835Not Available616Open in IMG/M
3300009592|Ga0115101_1391803Not Available2604Open in IMG/M
3300009606|Ga0115102_10180232All Organisms → Viruses → Predicted Viral1751Open in IMG/M
3300009606|Ga0115102_10525480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1541Open in IMG/M
3300009606|Ga0115102_10565420Not Available955Open in IMG/M
3300009606|Ga0115102_10649155Not Available628Open in IMG/M
3300009608|Ga0115100_10689205All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1889Open in IMG/M
3300009608|Ga0115100_11135178Not Available557Open in IMG/M
3300009786|Ga0114999_10886499Not Available653Open in IMG/M
3300010148|Ga0098043_1042707Not Available1404Open in IMG/M
3300010153|Ga0098059_1118765Not Available1047Open in IMG/M
3300010155|Ga0098047_10004298Not Available5824Open in IMG/M
3300010155|Ga0098047_10404340Not Available511Open in IMG/M
3300010883|Ga0133547_10434071Not Available2674Open in IMG/M
3300017706|Ga0181377_1004371All Organisms → cellular organisms → Bacteria3897Open in IMG/M
3300017706|Ga0181377_1024486Not Available1294Open in IMG/M
3300017706|Ga0181377_1033257All Organisms → Viruses → Predicted Viral1056Open in IMG/M
3300017717|Ga0181404_1154737Not Available553Open in IMG/M
3300017720|Ga0181383_1131908Not Available670Open in IMG/M
3300017724|Ga0181388_1027924Not Available1397Open in IMG/M
3300017724|Ga0181388_1129594Not Available601Open in IMG/M
3300017726|Ga0181381_1009713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2273Open in IMG/M
3300017727|Ga0181401_1014136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2462Open in IMG/M
3300017734|Ga0187222_1033485All Organisms → Viruses → Predicted Viral1223Open in IMG/M
3300017740|Ga0181418_1024377Not Available1567Open in IMG/M
3300017742|Ga0181399_1161021Not Available536Open in IMG/M
3300017746|Ga0181389_1028153All Organisms → Viruses → Predicted Viral1725Open in IMG/M
3300017749|Ga0181392_1246926Not Available503Open in IMG/M
3300017751|Ga0187219_1149570Not Available673Open in IMG/M
3300017753|Ga0181407_1070022Not Available901Open in IMG/M
3300017753|Ga0181407_1147519Not Available582Open in IMG/M
3300017755|Ga0181411_1190005Not Available579Open in IMG/M
3300017757|Ga0181420_1005542Not Available4453Open in IMG/M
3300017757|Ga0181420_1181246Not Available618Open in IMG/M
3300017757|Ga0181420_1203936Not Available573Open in IMG/M
3300017758|Ga0181409_1098164Not Available874Open in IMG/M
3300017764|Ga0181385_1028761Not Available1763Open in IMG/M
3300017767|Ga0181406_1035464Not Available1558Open in IMG/M
3300017770|Ga0187217_1315615Not Available501Open in IMG/M
3300017775|Ga0181432_1167945Not Available680Open in IMG/M
3300017779|Ga0181395_1201649Not Available618Open in IMG/M
3300017782|Ga0181380_1164354Not Available753Open in IMG/M
3300017786|Ga0181424_10103231Not Available1231Open in IMG/M
3300017950|Ga0181607_10457039Not Available688Open in IMG/M
3300020175|Ga0206124_10401097Not Available510Open in IMG/M
3300020469|Ga0211577_10256880Not Available1123Open in IMG/M
3300021084|Ga0206678_10041970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2491Open in IMG/M
3300021084|Ga0206678_10248341Not Available869Open in IMG/M
3300021087|Ga0206683_10125311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1386Open in IMG/M
3300021169|Ga0206687_1601329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2028Open in IMG/M
3300021350|Ga0206692_1408406Not Available1193Open in IMG/M
3300021957|Ga0222717_10000684Not Available28959Open in IMG/M
3300021957|Ga0222717_10003072Not Available12692Open in IMG/M
3300021957|Ga0222717_10696474Not Available520Open in IMG/M
3300021960|Ga0222715_10314404Not Available885Open in IMG/M
3300022071|Ga0212028_1110731Not Available509Open in IMG/M
3300022074|Ga0224906_1000055Not Available58121Open in IMG/M
3300022074|Ga0224906_1195976Not Available552Open in IMG/M
3300022178|Ga0196887_1042657Not Available1196Open in IMG/M
(restricted) 3300023089|Ga0233408_10042001Not Available798Open in IMG/M
(restricted) 3300023109|Ga0233432_10071955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium HUM_182059Open in IMG/M
(restricted) 3300023109|Ga0233432_10093512All Organisms → Viruses → Predicted Viral1713Open in IMG/M
3300023685|Ga0228686_1018664Not Available934Open in IMG/M
3300023701|Ga0228685_1033713Not Available768Open in IMG/M
(restricted) 3300024258|Ga0233440_1137324Not Available735Open in IMG/M
3300024262|Ga0210003_1215161Not Available778Open in IMG/M
3300024293|Ga0228651_1035012Not Available1230Open in IMG/M
3300024326|Ga0228652_1108719Not Available631Open in IMG/M
3300025071|Ga0207896_1001054Not Available5460Open in IMG/M
3300025079|Ga0207890_1003455Not Available3830Open in IMG/M
3300025084|Ga0208298_1009809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2391Open in IMG/M
3300025099|Ga0208669_1004657All Organisms → Viruses4316Open in IMG/M
3300025103|Ga0208013_1075377Not Available878Open in IMG/M
3300025108|Ga0208793_1005284Not Available5837Open in IMG/M
3300025120|Ga0209535_1000122Not Available49247Open in IMG/M
3300025120|Ga0209535_1003830Not Available9497Open in IMG/M
3300025120|Ga0209535_1006380All Organisms → Viruses7103Open in IMG/M
3300025133|Ga0208299_1072379Not Available1233Open in IMG/M
3300025137|Ga0209336_10029767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium HUM_181844Open in IMG/M
3300025138|Ga0209634_1001839Not Available15171Open in IMG/M
3300025168|Ga0209337_1049376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2192Open in IMG/M
3300025168|Ga0209337_1142189Not Available1051Open in IMG/M
3300025508|Ga0208148_1042994Not Available1152Open in IMG/M
3300025759|Ga0208899_1016149Not Available3889Open in IMG/M
3300025770|Ga0209362_1116455Not Available978Open in IMG/M
3300027413|Ga0208950_1000807Not Available15390Open in IMG/M
3300027704|Ga0209816_1267281Not Available531Open in IMG/M
3300027788|Ga0209711_10084448Not Available1643Open in IMG/M
3300028008|Ga0228674_1164643Not Available731Open in IMG/M
(restricted) 3300028045|Ga0233414_10545563Not Available547Open in IMG/M
3300028134|Ga0256411_1010392Not Available2558Open in IMG/M
3300028137|Ga0256412_1011686Not Available2558Open in IMG/M
3300029787|Ga0183757_1015727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1951Open in IMG/M
3300030715|Ga0308127_1039593Not Available580Open in IMG/M
3300031519|Ga0307488_10039384Not Available3726Open in IMG/M
3300031519|Ga0307488_10113954Not Available1949Open in IMG/M
3300031569|Ga0307489_10358861Not Available960Open in IMG/M
3300031602|Ga0307993_1147713Not Available590Open in IMG/M
3300031629|Ga0307985_10042134Not Available1944Open in IMG/M
3300031774|Ga0315331_10356636All Organisms → Viruses → Predicted Viral1073Open in IMG/M
3300032011|Ga0315316_10671532Not Available862Open in IMG/M
3300032047|Ga0315330_10432335Not Available806Open in IMG/M
3300032088|Ga0315321_10181381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1393Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater18.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.67%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.67%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.67%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.67%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.33%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.33%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.67%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine2.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.33%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.33%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.33%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.67%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.67%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300001956Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021084Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024258 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_120_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025770Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1012188423300000101MarineMAEENTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
DelMOSpr2010_1001404233300000116MarineMSIETKETSTKDKIIKFIDAISGENYATANKYLQSAVQDKIESRIRQAAEKPLF*
DelMOSpr2010_1009578823300000116MarineMSEKPNKNNAKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF*
JGI24006J15134_10000256473300001450MarineMSEKPNKNNEKDKIVKFIDAISGENYAAANKYLQSAVEDKLEARIRQAAEKPIF*
JGI24003J15210_1001256833300001460MarineMSKETKKTSTKDKIIKFIDAISGENYATANKYLQSAVQDKIESRIRQAAEKPLF*
JGI24003J15210_1011263523300001460MarineNMPKETTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
JGI24513J20088_100220823300001720MarineLINLQPLINKNMSEKPNKNNEKDKIVKFIDAISGENYAAANKYLQSAVEDKLEARIRQAAEKPIF*
GOS2266_104767223300001956MarineMSEEQKQESTENFENLSTKAKIVKFIDQLSDENYATANKYLQSAVEDKVTDRIRQATEKPLF*
JGI26238J51125_102755333300003478MarineMAQKDTTKLKISKFIDAISDKNYAVANKYLQSAVNDKLEARIKQAAEKPLF*
JGI26238J51125_107990523300003478MarineMSDEQKLEPTEENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0065861_119367423300004448MarineMAKESTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0066224_116590313300004457MarineMSEEQTNGSNGDLTTKAKIVKFIDAISDEKYASANKYLQAAVDDKIEDKIRQAAEQPIFK
Ga0073579_156670923300005239MarineMSNENTTEESTKDKIVKFIDAISGENYADANKYLQSAVEDKLEAKIRQAAEKPLF*
Ga0076924_1085782243300005747MarineMSEETKKISTKDKIIKFIDAISGENYATANKYLQSAVQDKIEARIRQAAEKPLF*
Ga0075474_10000725123300006025AqueousMPTKSNTDSTKSKIIKFIDAISAKNYATANKYLQSAVQDKLEARIRQAAQKSLF*
Ga0075466_105780923300006029AqueousSNKNNTKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF*
Ga0098058_103860223300006750MarineMSEEQKIEPIDKSSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF*
Ga0098048_100024373300006752MarineMSKETKETSTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF*
Ga0098054_104649233300006789MarineMSEEQKIEPIEDSSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF*
Ga0098054_108917713300006789MarineSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0098054_113145623300006789MarineMSQEQKLEPTKESSTKAKIVKFIDALSDENYERANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0098055_102521533300006793MarineMSQEQKLEPTKESSTKAKIVKFIDALSDENYARANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0098055_109471723300006793MarineMSEEQKLKPTDEGSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0098055_110731023300006793MarineMSEEQEQGSLDDLTTKAKIVKFIDAISDEKYASANKYLQSAVDDKLENRIRQAAENPIFK
Ga0070750_10000049623300006916AqueousMSEKSNKNNTKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF*
Ga0070750_1000081833300006916AqueousMSEENKEMSTKDKIIKFIDAISGENYATANKYLQSAVQDKIEARIRQAAEKPLF*
Ga0070750_1001999033300006916AqueousMSEENKKISTKDKIIKFIDAISGENYATANKYLQSAVQDKIEARIRQAAEKPLF*
Ga0070746_1024805523300006919AqueousMSEEQKQESTENFENLSVKAKIVKFIDQLSDENYATANKYLQSAVEDKVADRIRQAAEKPLF*
Ga0070748_124060123300006920AqueousMAQKDATKLKISKFIDAISDKNYAVANKYLQSAVNDKLEARIKQAAEKPLF*
Ga0098060_100211863300006921MarineMSDEQKLEPTKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRQAAEKPLF*
Ga0098060_109274123300006921MarineMSEEQNQGSLEDLTTKAKIVKFIDAISDEKYATANKYLQSAVDDKLEDRIRKAAEKPIF*
Ga0098051_101313033300006924MarineMSQEQKLEPTKESSTKAKIVKFIDALSDENYACANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0075444_1005642523300006947MarineMSNKKTQEQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF*
Ga0098046_105326023300006990MarineMSEEQKLKPTDEGSTKAKIVKFIDALSDENYARANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0070747_100376473300007276AqueousLILKKTLINNNMAEENTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0102821_119249723300007557EstuarineMAEKNTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0075480_1001877423300008012AqueousLNNIEYRINNNMPTKSNTDSTKSKIIKFIDAISAKNYATANKYLQSAVQDKLEARIRQAAQKSLF*
Ga0104259_103813313300008958Ocean WaterKKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAETPIFK*
Ga0104258_101484633300008993Ocean WaterMSEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKPEDRIRQAAEKPIFK
Ga0102810_103733633300009002EstuarineMSDEQKLEPTEENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRKAAEKQHF*
Ga0102810_107462123300009002EstuarineMSEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAETPIFK
Ga0114918_1020190623300009149Deep SubsurfaceMSKKTKEARENSTKDKITKFINAISGENYAIANKYLQSAVQDKIEARIRQAAEKTLF*
Ga0114993_1089277923300009409MarineMSNNKTQKQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF*
Ga0114994_1000966273300009420MarineMAKKDATKLKISKFIDAISDKNYAAANKYLQSAVNNKLESRIKQAAEKPLF*
Ga0114994_1005573853300009420MarineLILKKTLINKNMAKESTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0114998_1056603113300009422MarineKTQKQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF*
Ga0115099_1078665713300009543MarineTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0115099_1090383523300009543MarineMSDEQKLEPTEENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF*
Ga0115101_139180323300009592MarineMPKETTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0115102_1018023223300009606MarineMADKNTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0115102_1052548023300009606MarineMSDDQNVDSTENLSTKAKIVKFIDSLSDENYASANKYLQSAVDDKLEDRIRQAAETPIFK
Ga0115102_1056542023300009606MarineMSDEQKLEPTKESSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF*
Ga0115102_1064915513300009606MarineTTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0115100_1068920533300009608MarineNKNMSEKPNKNNAKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF*
Ga0115100_1113517813300009608MarineKNTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF*
Ga0114999_1088649923300009786MarineNTYMSNNKTQKQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF*
Ga0098043_104270723300010148MarineMSEVQTQEPMEDLSTKAKIVKFIDALSDEKYASANKYLQSAVEDKLTDKIRQAAGKPIFK
Ga0098059_111876533300010153MarineMSEEQNQEPTQDISTKAKIVKFIDALSDEKYATANKYLQSVVDDKLTDKIRQAAETPIFTK*
Ga0098047_1000429813300010155MarineKPTDEGSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRQAAEKPLF*
Ga0098047_1040434013300010155MarineKPTDEGSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF*
Ga0133547_1043407123300010883MarineMSNNKTQKQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRISQATEQPLF*
Ga0181377_100437143300017706MarineMAQKDATKLKISKFIDAISDKNYAVANKYLQSAVNDKLQARIKQAAEKPLF
Ga0181377_102448623300017706MarineMSEEQNQGSLEDLTTKAKIVKFIDAISDEKYATANKYLQSAVDDKLEDRIRQAAEKPIF
Ga0181377_103325723300017706MarineMSKETKETSTKDKIIKFIDAISGENYATANKYLQSAVQDKIKSRISQAAEKPLF
Ga0181404_115473713300017717SeawaterMSEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVNDKLQARIKQAAEKPLF
Ga0181383_113190823300017720SeawaterMSEEQNQDSTTDLSTKSKIVKFIDAISDEKYATANKYLQSAVDDKITDKIRQAAEKPIFK
Ga0181388_102792423300017724SeawaterMAQKDATKLKISKFIDAISDKNYAVANKYLQSPVNDKLQARIKQAAEKPLF
Ga0181388_112959423300017724SeawaterMSEEQKLKPTDEGSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0181381_100971323300017726SeawaterMSEKPIKTNTKDKIVKFIDAISGENYAAANKYLQSAVQDKIEARIRQAAEKPIF
Ga0181401_101413633300017727SeawaterMSEEQKLEPAKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTNRIRKAAEKPLF
Ga0187222_103348533300017734SeawaterMSEEQKLKPTDEGSTKAKIVNFIDALSDENYAQAHKYLQSAVEDKLTDRIRKAAEKPLF
Ga0181418_102437733300017740SeawaterMSEEQNQESLENLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAEKPIFK
Ga0181399_116102123300017742SeawaterMSEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLED
Ga0181389_102815323300017746SeawaterMSDEQKLEPTKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0181392_124692623300017749SeawaterMSEEQNQDSTTDLSTKSKIVKFIDAISDEKYATANKYLQSAVDDKITDKIRQAAE
Ga0187219_114957023300017751SeawaterTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAEKPIFK
Ga0181407_107002223300017753SeawaterMSEEQKLEPAKESSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0181407_114751923300017753SeawaterKEQKLEPTKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTNRIRKAAEKPLF
Ga0181411_119000513300017755SeawaterMSKETKETSTKDKIIKFIDAISGENYAAANKYLQSAVQDKIESRIRQAAEKPLF
Ga0181420_100554263300017757SeawaterMSKEQKLEPTKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0181420_118124613300017757SeawaterMSEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAFDDKLENRIRQAAEKPTFK
Ga0181420_120393623300017757SeawaterMSEEQNQEPTKDLTTKAKIVKFIDALSDEKYASAHKYLQSAVEDKLTDRIRQAAGKPIFK
Ga0181409_109816423300017758SeawaterDLTTKAKIVKFIDALSDEKYASAHKYLQSAVEDKLTDRIRQAAGKPIFK
Ga0181385_102876123300017764SeawaterLINLKPLINKNMSEKPIKTNTKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF
Ga0181406_103546433300017767SeawaterMSEEQKQEPTQDLTTKAKIVKFIDALSDEKYASANKYLQSAVEDKLTDKIRQAAGKPIFK
Ga0187217_131561523300017770SeawaterMAEENTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLL
Ga0181432_116794513300017775SeawaterSSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTNRIRKAAEKPLF
Ga0181395_120164923300017779SeawaterMAEENTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAE
Ga0181380_116435413300017782SeawaterNTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF
Ga0181424_1010323113300017786SeawaterNNNMSKETKETSTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF
Ga0181607_1045703923300017950Salt MarshMSEENKKISTKDKIIKFIDAISGENYATANKYLQSAVQDKIEARIRQAAEKPLF
Ga0206124_1040109713300020175SeawaterMAEENTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF
Ga0211577_1025688023300020469MarineMSKETKETSTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF
Ga0206678_1004197033300021084SeawaterMSEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAEKPIFK
Ga0206678_1024834123300021084SeawaterMSDEQKLEPTEENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0206683_1012531133300021087SeawaterMSDEQKLEPTEENSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0206687_160132913300021169SeawaterKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0206692_140840613300021350SeawaterQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAEKPIFK
Ga0222717_10000684243300021957Estuarine WaterMSDDKSQEKETKAKIIKFIDAISGENYADANKYLQSAVEDKLETRIRQAAEKPLF
Ga0222717_1000307243300021957Estuarine WaterMSEKPNKNNAKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF
Ga0222717_1069647423300021957Estuarine WaterMPKETTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF
Ga0222715_1031440423300021960Estuarine WaterMSDEQKLEPTEENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF
Ga0212028_111073113300022071AqueousMPTKSNTDSTKSKIIKFIDAISAKNYATANKYLQSAVQDKLEARIRQAAQKSLF
Ga0224906_1000055633300022074SeawaterLINLKPLINKNMSEKPIKTNTKDKIVKFIDAISGENYAAANKYLQSAVQDKIEARIRQAAEKPIF
Ga0224906_119597613300022074SeawaterMSEEQKLKPTDEGSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0196887_104265723300022178AqueousMSEKSNKNNTKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF
(restricted) Ga0233408_1004200123300023089SeawaterMSDDQKLEPTEENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRKAAEKPLF
(restricted) Ga0233432_1007195543300023109SeawaterMSIETKETSTKDKIIKFIDAISGENYATANKYLQSAVQDKIESRIRQAAEKPLF
(restricted) Ga0233432_1009351223300023109SeawaterMSEEQKLEPAKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0228686_101866413300023685SeawaterKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF
Ga0228685_103371313300023701SeawaterTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF
(restricted) Ga0233440_113732423300024258SeawaterMAQKDTTKLKISKFIDAISDKNYAVANKYLQSAVNDKLEARIKQAAEKPLF
Ga0210003_121516123300024262Deep SubsurfaceMSKKTKEARENSTKDKITKFINAISGENYAIANKYLQSAVQDKIEARIRQAAEKTLF
Ga0228651_103501233300024293SeawaterNMSKETKETSTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF
Ga0228652_110871923300024326SeawaterMADKNTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF
Ga0207896_100105433300025071MarineMSEKPNKNNEKDKIVKFIDAISGENYAAANKYLQSAVEDKLEARIRQAAEKPIF
Ga0207890_100345523300025079MarineMSEKPKKNNEKDKIVKFIDAISGENYAAANKYLQSAVEDKLEARIRQAAEKPIF
Ga0208298_100980933300025084MarineMSQEQKLEPTKESSTKAKIVKFIDALSDENYACANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0208669_100465743300025099MarineMSDEQKLEPTKESSTKAKIVKFIDALSDENYAQANKYLQSAVEDKLTDRIRQAAEKPLF
Ga0208013_107537723300025103MarineMSEEQKIEPIEDSSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF
Ga0208793_100528453300025108MarineMSQEQKLEPTKESSTKAKIVKFIDALSDENYARANKYLQSAVEDKLTDRIRKAAEKPLF
Ga0209535_1000122623300025120MarineMSKETKKTSTKDKIIKFIDAISGENYATANKYLQSAVQDKIESRIRQAAEKPLF
Ga0209535_100383083300025120MarineLINLQPLINKNMSEKPKKNNEKDKIVKFIDAISGENYAAANKYLQSAVEDKLEARIRQAAEKPIF
Ga0209535_100638063300025120MarineMAKESTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF
Ga0208299_107237923300025133MarineMSEEQKIEPIDKSSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF
Ga0209336_1002976723300025137MarineMAEKNTTKNKIVRFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEKPLF
Ga0209634_1001839153300025138MarineLINLQPLINKNMSEKPNKNNEKDKIVKFIDAISGENYAAANKYLQSAVEDKLEARIRQAAEKPIF
Ga0209337_104937623300025168MarineMPEEQNQESLESLTTKSKIVKFIDAISDEKYASANKYLQSAVDDKLEDRIRQAAEKPIFK
Ga0209337_114218913300025168MarineMSEEQKQEPTQDISTKAKIVKFIDALSDEKYASANKYLQSAVEDKLTDRIRQAAGNPIFK
Ga0208148_104299413300025508AqueousEKSNKNNTKDKIVKFIDAISGENYAAANKYLQSAVQDKLEARIRQAAEKPIF
Ga0208899_101614963300025759AqueousMSEENKEMSTKDKIIKFIDAISGENYATANKYLQSAVQDKIEARIRQAAEKPLF
Ga0209362_111645513300025770MarineENSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF
Ga0208950_100080733300027413MarineMSDEQKLEPTKESSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQAAEKPLF
Ga0209816_126728123300027704MarineMSNKKTQEQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF
Ga0209711_1008444833300027788MarineMAKKDATKLKISKFIDAISDKNYAAANKYLQSAVNNKLESRIKQAAEKPLF
Ga0228674_116464313300028008SeawaterMADKNTTKTKIVKFIDAISDKNYAAANKYLQSAVNDKLESRIKQAAEK
(restricted) Ga0233414_1054556313300028045SeawaterMSDEQKLEPTKESSTKAKIVKFIDALSDENYASANKYLQSAVEDKLTDRIRQ
Ga0256411_101039213300028134SeawaterKETSTKDKIIKFIDAISGENYSVANKYLQSAVQDNIESRIRQAAEKPLF
Ga0256412_101168613300028137SeawaterTSTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF
Ga0183757_101572733300029787MarineLINKNMSEKPIKTNTKDKIVKFIDAISGENYAAANKYLQSAVQDKIEARIRQAAEKPIF
Ga0308127_103959313300030715MarineIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF
Ga0307488_1003938453300031519Sackhole BrineMSNNKTQKQATKAKIIKFIDAVSGENYAAANKYLQSAIKDKLETRIRQATEQPLF
Ga0307488_1011395423300031519Sackhole BrineMSDENTKEQATKAKIIKFIDAVSGENYAAANKYLQSAVKDKLETRIRQATEKPLF
Ga0307489_1035886123300031569Sackhole BrineDATKLKISKFIDAISDKNYAAANKYLQSAVNNKLESRIKQAAEKPLF
Ga0307993_114771323300031602MarineMSDKKSREQSTKAKIIKFIDNISGENYAAANKYLQSAVQDKLKTRIRQATDQPLF
Ga0307985_1004213423300031629MarineMSNEKSRERATKAKIIKFIDNISGENYAAANKYLQSAVQDKLKTRIRQATEQPLF
Ga0315331_1035663623300031774SeawaterMSEEQNQDSIEGLSTKSKIVKFIDAISDEKYATANKYLQSAVDDKITDKIRQAAEKPIFN
Ga0315316_1067153223300032011SeawaterMSEEQNQDSTTDLSTKSKIVKFIDAISDEKYATANKYLQSAVDDKITDKIRQAAEKPIFN
Ga0315330_1043233523300032047SeawaterMSEEQNQDSIEGLSTKSKIVKFIDAISDEKYATANKYLQSAVDDKITDKIRQAAEKPNFN
Ga0315321_1018138133300032088SeawaterINNNMSKETKETSTKDKIIKFIDAISGENYAVANKYLQSAVQDKIESRIRQAAEKPLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.