Metagenome Family F047344

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F047344
Family Type	Metagenome
Number of Sequences	150
Average Sequence Length	41 residues
Representative Sequence	MRKVDETKQPDLWTWIVIGVVFSAVTAALYGPFVWEHWVV
Number of Associated Samples	64
Number of Associated Scaffolds	150

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	64.00 %
% of genes near scaffold ends (potentially truncated)	24.00 %
% of genes from short scaffolds (< 2000 bps)	80.00 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (57.333 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (35.333 % of family members)
Environment Ontology (ENVO)	Unclassified (63.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (76.000 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 150 Family Scaffolds
PF13676	TIR_2	4.00
PF02518	HATPase_c	3.33
PF04392	ABC_sub_bind	2.67
PF01734	Patatin	2.67
PF00293	NUDIX	2.00
PF12802	MarR_2	2.00
PF12833	HTH_18	1.33
PF14559	TPR_19	1.33
PF00132	Hexapep	1.33
PF13185	GAF_2	1.33
PF13683	rve_3	0.67
PF01464	SLT	0.67
PF02543	Carbam_trans_N	0.67
PF00069	Pkinase	0.67
PF04955	HupE_UreJ	0.67
PF08241	Methyltransf_11	0.67
PF12395	DUF3658	0.67
PF00376	MerR	0.67
PF00083	Sugar_tr	0.67
PF00723	Glyco_hydro_15	0.67
PF01797	Y1_Tnp	0.67
PF01841	Transglut_core	0.67
PF13546	DDE_5	0.67
PF00239	Resolvase	0.67
PF01695	IstB_IS21	0.67
PF00589	Phage_integrase	0.67
PF00211	Guanylate_cyc	0.67
PF02371	Transposase_20	0.67
PF12796	Ank_2	0.67
PF04879	Molybdop_Fe4S4	0.67
PF12680	SnoaL_2	0.67
PF13474	SnoaL_3	0.67
PF01152	Bac_globin	0.67
PF00106	adh_short	0.67

COG ID	Name	Functional Category	% Frequency in 150 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.67
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	2.67
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.67
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	2.67
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	2.67
COG1484	DNA replication protein DnaC	Replication, recombination and repair [L]	0.67
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.67
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.67
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.67
COG2192	Predicted carbamoyl transferase, NodU family	General function prediction only [R]	0.67
COG2346	Truncated hemoglobin YjbI	Inorganic ion transport and metabolism [P]	0.67
COG2370	Hydrogenase/urease accessory protein HupE	Posttranslational modification, protein turnover, chaperones [O]	0.67
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.67
COG3387	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family	Carbohydrate transport and metabolism [G]	0.67
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.67

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.33 %
Unclassified	root	N/A	42.67 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	57.33 %
Unclassified	root	N/A	42.67 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	57.33 %
Unclassified	root	N/A	42.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	38.00 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	2.00 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	26.00 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	2.00 %
Candidatus Muproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria	0.67 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.67 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.67 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12.00 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	5.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.67 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.67 %
Candidatus Muproteobacteria bacterium RBG_16_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13	0.67 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.67 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.33 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	2.00 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.33 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.33 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.67 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.67 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.67 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.67 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.67 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.67 %
Candidatus Muproteobacteria bacterium RBG_16_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.33 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.00 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.67 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.67 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.67 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.67 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.67 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.67 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.67 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.67 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.67 %
Candidatus Muproteobacteria bacterium RBG_16_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.33 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.00 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.67 %
unclassified Microvirga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga	0.67 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.67 %
Mesorhizobium sangaii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii	0.67 %
Rhodomicrobium vannielii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium → Rhodomicrobium vannielii	0.67 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.67 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.67 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.67 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.67 %
Candidatus Muproteobacteria bacterium RBG_16_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.33 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.00 %
Microvirga sp. KLBC 81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81	0.67 %
Bradyrhizobium sp. 62	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 62	0.67 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.67 %
Mesorhizobium sangaii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii	0.67 %
Rhodomicrobium vannielii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium → Rhodomicrobium vannielii	0.67 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.67 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.67 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.67 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.67 %
Candidatus Muproteobacteria bacterium RBG_16_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13	0.67 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000789\|JGI1027J11758_12844208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1412	Open in IMG/M
3300000789\|JGI1027J11758_12857684	Not Available	934	Open in IMG/M
3300004633\|Ga0066395_10047118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13	1890	Open in IMG/M
3300004633\|Ga0066395_10223854	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300004633\|Ga0066395_10780576	Not Available	572	Open in IMG/M
3300005332\|Ga0066388_100343723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2138	Open in IMG/M
3300005332\|Ga0066388_100416068	All Organisms → cellular organisms → Bacteria	1988	Open in IMG/M
3300005332\|Ga0066388_100651016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1668	Open in IMG/M
3300005332\|Ga0066388_100771609	All Organisms → cellular organisms → Bacteria → Proteobacteria	1558	Open in IMG/M
3300005332\|Ga0066388_101954296	Not Available	1049	Open in IMG/M
3300005332\|Ga0066388_106524131	Not Available	588	Open in IMG/M
3300005332\|Ga0066388_106855952	Not Available	573	Open in IMG/M
3300005332\|Ga0066388_107019412	Not Available	567	Open in IMG/M
3300005434\|Ga0070709_11125286	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300005439\|Ga0070711_100326639	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1227	Open in IMG/M
3300005441\|Ga0070700_100019754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3892	Open in IMG/M
3300005536\|Ga0070697_100311183	All Organisms → cellular organisms → Bacteria	1355	Open in IMG/M
3300005713\|Ga0066905_100047326	Not Available	2604	Open in IMG/M
3300005713\|Ga0066905_100055867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii	2448	Open in IMG/M
3300005713\|Ga0066905_100169238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1598	Open in IMG/M
3300005713\|Ga0066905_100213455	All Organisms → cellular organisms → Bacteria → Proteobacteria	1453	Open in IMG/M
3300005713\|Ga0066905_100241834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1380	Open in IMG/M
3300005713\|Ga0066905_100288166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1282	Open in IMG/M
3300005713\|Ga0066905_100425357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1085	Open in IMG/M
3300005713\|Ga0066905_100428034	Not Available	1082	Open in IMG/M
3300005713\|Ga0066905_100447857	Not Available	1061	Open in IMG/M
3300005713\|Ga0066905_100526531	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300005713\|Ga0066905_100631988	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	910	Open in IMG/M
3300005713\|Ga0066905_101008963	Not Available	734	Open in IMG/M
3300005713\|Ga0066905_101086184	Not Available	710	Open in IMG/M
3300005764\|Ga0066903_100232063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2816	Open in IMG/M
3300005764\|Ga0066903_100375707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2319	Open in IMG/M
3300005764\|Ga0066903_100503059	All Organisms → cellular organisms → Bacteria	2054	Open in IMG/M
3300005764\|Ga0066903_100510536	Not Available	2041	Open in IMG/M
3300005764\|Ga0066903_100635590	All Organisms → cellular organisms → Bacteria	1861	Open in IMG/M
3300005764\|Ga0066903_101431027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1300	Open in IMG/M
3300005764\|Ga0066903_103335206	Not Available	867	Open in IMG/M
3300005764\|Ga0066903_103431123	All Organisms → cellular organisms → Bacteria	855	Open in IMG/M
3300005764\|Ga0066903_103852992	Not Available	806	Open in IMG/M
3300005764\|Ga0066903_104984720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	704	Open in IMG/M
3300005764\|Ga0066903_105718553	Not Available	654	Open in IMG/M
3300005764\|Ga0066903_107439874	Not Available	565	Open in IMG/M
3300005937\|Ga0081455_10000053	All Organisms → cellular organisms → Bacteria → Proteobacteria	122071	Open in IMG/M
3300005937\|Ga0081455_10175440	All Organisms → cellular organisms → Bacteria	1628	Open in IMG/M
3300005983\|Ga0081540_1001740	All Organisms → cellular organisms → Bacteria → Proteobacteria	18326	Open in IMG/M
3300005983\|Ga0081540_1101738	Not Available	1236	Open in IMG/M
3300006058\|Ga0075432_10154866	All Organisms → cellular organisms → Bacteria	883	Open in IMG/M
3300006163\|Ga0070715_10063827	Not Available	1625	Open in IMG/M
3300006173\|Ga0070716_100441020	Not Available	947	Open in IMG/M
3300006173\|Ga0070716_100651522	Not Available	799	Open in IMG/M
3300006755\|Ga0079222_10824355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	762	Open in IMG/M
3300006755\|Ga0079222_11886202	Not Available	582	Open in IMG/M
3300006755\|Ga0079222_12379322	Not Available	530	Open in IMG/M
3300006854\|Ga0075425_100011773	All Organisms → cellular organisms → Bacteria → Proteobacteria	9369	Open in IMG/M
3300006871\|Ga0075434_100030908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5278	Open in IMG/M
3300010043\|Ga0126380_10063224	All Organisms → cellular organisms → Bacteria → Proteobacteria	2063	Open in IMG/M
3300010043\|Ga0126380_10391393	Not Available	1029	Open in IMG/M
3300010043\|Ga0126380_10705554	Not Available	812	Open in IMG/M
3300010043\|Ga0126380_11011489	Not Available	701	Open in IMG/M
3300010043\|Ga0126380_11726466	Not Available	563	Open in IMG/M
3300010046\|Ga0126384_10518943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1030	Open in IMG/M
3300010046\|Ga0126384_10538165	Not Available	1013	Open in IMG/M
3300010046\|Ga0126384_10736031	Not Available	877	Open in IMG/M
3300010047\|Ga0126382_10097886	Not Available	1886	Open in IMG/M
3300010047\|Ga0126382_10518405	Not Available	962	Open in IMG/M
3300010047\|Ga0126382_10746469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	827	Open in IMG/M
3300010047\|Ga0126382_10981505	All Organisms → cellular organisms → Bacteria → Proteobacteria	738	Open in IMG/M
3300010047\|Ga0126382_10988878	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300010048\|Ga0126373_12854619	All Organisms → cellular organisms → Bacteria → Proteobacteria	539	Open in IMG/M
3300010358\|Ga0126370_10041146	All Organisms → cellular organisms → Bacteria	2871	Open in IMG/M
3300010358\|Ga0126370_10087253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2117	Open in IMG/M
3300010358\|Ga0126370_10502916	Not Available	1024	Open in IMG/M
3300010358\|Ga0126370_11104333	Not Available	731	Open in IMG/M
3300010358\|Ga0126370_12494594	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300010359\|Ga0126376_10181073	All Organisms → cellular organisms → Bacteria	1725	Open in IMG/M
3300010359\|Ga0126376_10602974	Not Available	1039	Open in IMG/M
3300010360\|Ga0126372_12156268	Not Available	606	Open in IMG/M
3300010361\|Ga0126378_11508608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	762	Open in IMG/M
3300010362\|Ga0126377_10009901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7380	Open in IMG/M
3300010362\|Ga0126377_10111619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 62	2510	Open in IMG/M
3300010362\|Ga0126377_10184036	All Organisms → cellular organisms → Bacteria	1990	Open in IMG/M
3300010362\|Ga0126377_10434901	All Organisms → cellular organisms → Bacteria → Proteobacteria	1331	Open in IMG/M
3300010362\|Ga0126377_10583542	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1160	Open in IMG/M
3300010362\|Ga0126377_12113393	Not Available	639	Open in IMG/M
3300010362\|Ga0126377_12929643	Not Available	551	Open in IMG/M
3300010362\|Ga0126377_13156128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532	Open in IMG/M
3300010366\|Ga0126379_10063916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3102	Open in IMG/M
3300010366\|Ga0126379_10618093	All Organisms → cellular organisms → Bacteria	1171	Open in IMG/M
3300010366\|Ga0126379_11033154	All Organisms → cellular organisms → Bacteria → Proteobacteria	927	Open in IMG/M
3300010366\|Ga0126379_11418038	Not Available	800	Open in IMG/M
3300010366\|Ga0126379_12315127	Not Available	637	Open in IMG/M
3300010376\|Ga0126381_100368808	Not Available	1990	Open in IMG/M
3300010398\|Ga0126383_10102243	Not Available	2565	Open in IMG/M
3300010398\|Ga0126383_10179999	Not Available	2008	Open in IMG/M
3300010398\|Ga0126383_10606826	Not Available	1166	Open in IMG/M
3300010398\|Ga0126383_11440183	Not Available	779	Open in IMG/M
3300010398\|Ga0126383_11467101	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300010398\|Ga0126383_12325108	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	622	Open in IMG/M
3300010400\|Ga0134122_10804556	Not Available	897	Open in IMG/M
3300012948\|Ga0126375_10093207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1761	Open in IMG/M
3300012948\|Ga0126375_11030193	Not Available	672	Open in IMG/M
3300012948\|Ga0126375_11539724	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300012971\|Ga0126369_10512776	Not Available	1259	Open in IMG/M
3300012971\|Ga0126369_12786403	Not Available	572	Open in IMG/M
3300015371\|Ga0132258_10069721	All Organisms → cellular organisms → Bacteria	8149	Open in IMG/M
3300015371\|Ga0132258_10078304	All Organisms → cellular organisms → Bacteria → Proteobacteria	7696	Open in IMG/M
3300015371\|Ga0132258_10079075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7663	Open in IMG/M
3300015371\|Ga0132258_10156514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5472	Open in IMG/M
3300015371\|Ga0132258_10311988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3873	Open in IMG/M
3300015372\|Ga0132256_101115672	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300015372\|Ga0132256_103548362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	524	Open in IMG/M
3300015373\|Ga0132257_101236493	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	946	Open in IMG/M
3300015374\|Ga0132255_102313606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	820	Open in IMG/M
3300016270\|Ga0182036_11073002	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	666	Open in IMG/M
3300016319\|Ga0182033_10680654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium → Rhodomicrobium vannielii	899	Open in IMG/M
3300016357\|Ga0182032_11270026	Not Available	635	Open in IMG/M
3300016445\|Ga0182038_10479779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1057	Open in IMG/M
3300017970\|Ga0187783_10866727	Not Available	651	Open in IMG/M
3300020581\|Ga0210399_10628318	Not Available	887	Open in IMG/M
3300021178\|Ga0210408_10122285	All Organisms → cellular organisms → Bacteria → Proteobacteria	2053	Open in IMG/M
3300021560\|Ga0126371_10200084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2092	Open in IMG/M
3300021560\|Ga0126371_10374803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1562	Open in IMG/M
3300021560\|Ga0126371_10871120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1045	Open in IMG/M
3300021560\|Ga0126371_12104506	Not Available	680	Open in IMG/M
3300021560\|Ga0126371_13322077	Not Available	544	Open in IMG/M
3300025972\|Ga0207668_10233257	All Organisms → cellular organisms → Bacteria	1485	Open in IMG/M
3300027775\|Ga0209177_10036270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81	1325	Open in IMG/M
3300027874\|Ga0209465_10038137	All Organisms → cellular organisms → Bacteria → Proteobacteria	2280	Open in IMG/M
3300027874\|Ga0209465_10452800	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300027874\|Ga0209465_10477287	Not Available	623	Open in IMG/M
3300027907\|Ga0207428_10579564	All Organisms → cellular organisms → Bacteria	810	Open in IMG/M
3300031545\|Ga0318541_10448758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	721	Open in IMG/M
3300031573\|Ga0310915_10361377	All Organisms → cellular organisms → Bacteria	1030	Open in IMG/M
3300031573\|Ga0310915_10749060	Not Available	688	Open in IMG/M
3300031719\|Ga0306917_11021830	Not Available	645	Open in IMG/M
3300031740\|Ga0307468_101573238	Not Available	613	Open in IMG/M
3300031744\|Ga0306918_10363739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1124	Open in IMG/M
3300031782\|Ga0318552_10146964	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300031890\|Ga0306925_10481215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1324	Open in IMG/M
3300031890\|Ga0306925_11958436	Not Available	555	Open in IMG/M
3300031897\|Ga0318520_11013811	Not Available	525	Open in IMG/M
3300031912\|Ga0306921_10082148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3713	Open in IMG/M
3300031912\|Ga0306921_11791980	Not Available	660	Open in IMG/M
3300031941\|Ga0310912_11156632	Not Available	590	Open in IMG/M
3300031947\|Ga0310909_10238316	All Organisms → cellular organisms → Bacteria	1518	Open in IMG/M
3300032001\|Ga0306922_10709520	All Organisms → cellular organisms → Bacteria → Proteobacteria	1058	Open in IMG/M
3300032180\|Ga0307471_101553283	Not Available	819	Open in IMG/M
3300032261\|Ga0306920_100360809	Not Available	2161	Open in IMG/M
3300034817\|Ga0373948_0056001	Not Available	857	Open in IMG/M
3300034819\|Ga0373958_0050785	Not Available	875	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	86.67%
Host-Associated	Host-Associated	13.33%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	86.67%
Plants	Host-Associated → Plants	13.33%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	86.67%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.00%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	55.33%
Loam	Environmental → Terrestrial → Soil → Loam	30.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.67%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.33%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.67%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	36.00%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	26.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	15.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.33%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.33%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	35.33%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	26.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.67%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	2.67%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.33%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.33%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	1.33%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.33%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.67%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.67%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J11758_128442082	3300000789	Soil	MHKVDESKHADLWTWIVIGLVFSAMTVALYGPFVWEHWVV*
JGI1027J11758_128576842	3300000789	Soil	MPKDETKQTDLWTWIVIGLVFSAVTVALYGPFVWEHWAT*
Ga0066395_100471182	3300004633	Tropical Forest Soil	MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0066395_102238542	3300004633	Tropical Forest Soil	MRKVDESKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV*
Ga0066395_107805762	3300004633	Tropical Forest Soil	MKVGRQMHKVNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA*
Ga0066388_1003437234	3300005332	Tropical Forest Soil	MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0066388_1004160682	3300005332	Tropical Forest Soil	MRKVDETKQPDLWTWIVIGIVFSAVTAALYGPFVWEYWVV*
Ga0066388_1006510164	3300005332	Tropical Forest Soil	MRKVDESKQPDLWTWVVLGLVFSAVTAALYGPFVWEHWVI*
Ga0066388_1007716093	3300005332	Tropical Forest Soil	MRKVDETKQWDLWTWIVIGVVFGAVTAALYGPFVWEHWVV*
Ga0066388_1019542962	3300005332	Tropical Forest Soil	MRKVDQSKQPDLLTWIVIGIAFSVVTAALYGPFVWEHWVV*
Ga0066388_1065241312	3300005332	Tropical Forest Soil	MRKVDDSKQPDLWTWVVLGLVFSAVTAALYGPFVWEHWAI*
Ga0066388_1068559522	3300005332	Tropical Forest Soil	MRMMDEPKQADLWTWIVIGIVFSAVTAALYGPFVWEHWVL*
Ga0066388_1070194121	3300005332	Tropical Forest Soil	MRKVDEVKQPDLWTWIVIGIVFGAVTAALYVPFVWEHWAV*
Ga0070709_111252861	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MMHKVDESKRVDLWTWIVIGLVFSAVTVALYGPFVWEHWVV*
Ga0070711_1003266392	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MRTEIETKQPEADVWTWIVIDLVFSAVTAALYGPFVWEHLVT*
Ga0070700_1000197544	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MAGSTMHTVNDTKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA*
Ga0070697_1003111833	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MHTVNDTKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA*
Ga0066905_1000473267	3300005713	Tropical Forest Soil	MHRLDEPKQADLWTWIVLGLVFGAVTAALYGPFVWEHWVV*
Ga0066905_1000558676	3300005713	Tropical Forest Soil	MRKVDETKQPDLWTWIVIGIVFSAVAAALYGPFVWEHWVV*
Ga0066905_1001692383	3300005713	Tropical Forest Soil	MRKVDEAKQPDLWTWVVIGLVFSAVTAALYGPFVWEHWAI*
Ga0066905_1002134552	3300005713	Tropical Forest Soil	MRTVDETKQPEADLWTWIVIGLVFSAVTAALYGPFVWERWVA*
Ga0066905_1002418342	3300005713	Tropical Forest Soil	MDKVDEPKQPDLWTWVVIGIVISAVMAALYGPFVWERWVI*
Ga0066905_1002881664	3300005713	Tropical Forest Soil	MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0066905_1004253572	3300005713	Tropical Forest Soil	MHTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA*
Ga0066905_1004280343	3300005713	Tropical Forest Soil	MRKVDEPKQPDLWTWVVIGIAFGAVMAALYGPFVWEHWVV*
Ga0066905_1004478572	3300005713	Tropical Forest Soil	MAGSTMRTVNETKQSEVDLWTWIVIGLVFSAVTAALYGPFVWERWAA*
Ga0066905_1005265312	3300005713	Tropical Forest Soil	MRKMDEPKQADLWTWTVIGVVFSAVMAALYGPLVWEHWVL*
Ga0066905_1006319882	3300005713	Tropical Forest Soil	MRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWERWVA*
Ga0066905_1010089631	3300005713	Tropical Forest Soil	MRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPF
Ga0066905_1010861841	3300005713	Tropical Forest Soil	MRKVDEPEQPDLWTWVVIGIAFSAVMAALYGPFVWEHWVV*
Ga0066903_1002320631	3300005764	Tropical Forest Soil	MHKADKSKHADLWTWIVIGLVFGAVTVALYGPFVWEHWVA*
Ga0066903_1003757074	3300005764	Tropical Forest Soil	KMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0066903_1005030593	3300005764	Tropical Forest Soil	MHKVNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA*
Ga0066903_1005105363	3300005764	Tropical Forest Soil	MKVDRQMHNVNETKQPEADVWTWVVIGLVFGAVTVALYGPFVWEHLA*
Ga0066903_1006355905	3300005764	Tropical Forest Soil	MRTVNETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0066903_1014310273	3300005764	Tropical Forest Soil	MRKVDESKQPDLWTWVVIGLVFGAVTAALYGPFVWEHWAI*
Ga0066903_1033352062	3300005764	Tropical Forest Soil	MRKVDEAKQWDLWTWIVIGVVFGAVTAALYGPFVWEHW
Ga0066903_1034311232	3300005764	Tropical Forest Soil	MRKVDEIKQPDLWTWIVIGIVFSAVMTALYGPFIWEHWAV*
Ga0066903_1038529922	3300005764	Tropical Forest Soil	MRKVDESKQPDLWTWVVIGLVFSAVTAALYGPFLWEHWVI*
Ga0066903_1049847201	3300005764	Tropical Forest Soil	MRKVEESKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV*
Ga0066903_1057185532	3300005764	Tropical Forest Soil	MHKVDEEKQADLLTWILIGVVFSFVTAALYGPFVWEHWVA*
Ga0066903_1074398742	3300005764	Tropical Forest Soil	MRKVDETKQPDLWTWIVIGVVFSAVTAALYGPFVWEHWVV*
Ga0081455_1000005326	3300005937	Tabebuia Heterophylla Rhizosphere	MRKLDETKQPDLWTWIVIGIVFSAVAAALYGPFVWEHWVV*
Ga0081455_101754403	3300005937	Tabebuia Heterophylla Rhizosphere	MRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWAV*
Ga0081540_10017409	3300005983	Tabebuia Heterophylla Rhizosphere	MHKVEETKQADLWTWIVIGIVFSAVTAALYGPFVWEHWLV*
Ga0081540_11017382	3300005983	Tabebuia Heterophylla Rhizosphere	MRKVDEPKQLDLWTWVVIGIVFSAVMVALYGPFVWEHWVV*
Ga0075432_101548662	3300006058	Populus Rhizosphere	MRNADEIKQPDLWTWIVIGIVFGAVTAALYGPFIWEHWVV*
Ga0070715_100638273	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MHKVDESKHADLWTWIVIGLVFSAVTVALYGPFVWEHWVV*
Ga0070716_1004410202	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MMHKVDESKHADLWTWIVIGLVFSAVTVALYGPFVWEHWVV*
Ga0070716_1006515222	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MHKVDESKRVDLWTWIVIGLVFSAVTVALYGPFVWEHWVV*
Ga0079222_108243552	3300006755	Agricultural Soil	MHKVDESKHADLWTWIVIGLVFGAVTVALYGPFVWEHWVV*
Ga0079222_118862022	3300006755	Agricultural Soil	LTMRKVDENKPPDLLTWIVIGIVFSAVVTVLYAPFIWEHWAV*
Ga0079222_123793221	3300006755	Agricultural Soil	MGPVNEMEQPEPDLWTWIVIGFVFSAVSAALYGPFVWEHWAP*
Ga0075425_10001177310	3300006854	Populus Rhizosphere	MPKDETKQTDLWTWIVIGVVFSLVTAALYGPFVWEHWVT*
Ga0075434_1000309086	3300006871	Populus Rhizosphere	MRTEIETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHFVT*
Ga0126380_100632242	3300010043	Tropical Forest Soil	MAGSTMRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWERWVA*
Ga0126380_103913931	3300010043	Tropical Forest Soil	MRKVDETRQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV*
Ga0126380_107055542	3300010043	Tropical Forest Soil	MRKMDESKQPDLWTWIVIGLVFSAVTIALYGPFVWERSVI*
Ga0126380_110114891	3300010043	Tropical Forest Soil	TKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0126380_117264661	3300010043	Tropical Forest Soil	MKVGRQMHKVNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEH
Ga0126384_105189431	3300010046	Tropical Forest Soil	MRKVDETKQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV*
Ga0126384_105381652	3300010046	Tropical Forest Soil	MRKMDEPKQADLWTWTAIGVVFSAVMAALYGPFVWEHWVL*
Ga0126384_107360311	3300010046	Tropical Forest Soil	MRKVDESKQPDLWTWVVIGLVFSAVTAALYGPFVWEHWVI*
Ga0126382_100978861	3300010047	Tropical Forest Soil	MRKVDEIKHPDLWTWIAIGIAFSAVMAVLYGPFIWEHWAV*
Ga0126382_105184052	3300010047	Tropical Forest Soil	MRKVDEVKQPDLWTWVVIGIVFSAVMVALYGPFVWEHWVV*
Ga0126382_107464691	3300010047	Tropical Forest Soil	MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0126382_109815051	3300010047	Tropical Forest Soil	PKQPDLWPWVVIGIVVRAVMAALYGPFVWERWVV*
Ga0126382_109888781	3300010047	Tropical Forest Soil	MAGSTMRTVKETKQPEADLWTWIVIGLVFSAVTAALYAPFIWEHWVA*
Ga0126373_128546191	3300010048	Tropical Forest Soil	MRKVDESEQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV*
Ga0126370_100411462	3300010358	Tropical Forest Soil	MPKDKTPQTDLWTWIVIGLVFSAVTVALYGPFVWEHWVT*
Ga0126370_100872534	3300010358	Tropical Forest Soil	MRKVDQSKQPDLWTWIVIGIAFGVVTAALYGPFVWEHWVV*
Ga0126370_105029162	3300010358	Tropical Forest Soil	MHKLDEPKQADLWTWIVLGLVFGAVTAALYGPFVWEHWVM*
Ga0126370_111043331	3300010358	Tropical Forest Soil	MEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0126370_124945942	3300010358	Tropical Forest Soil	DQSKQPDLWTWIVIGIAFSVVTAALYGPFVWEHWVV*
Ga0126376_101810733	3300010359	Tropical Forest Soil	MRKVTESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0126376_106029741	3300010359	Tropical Forest Soil	MRKVDETKQPDLWTWIVIGIVFSAVTAALYGPLVWEHWVV*
Ga0126372_121562682	3300010360	Tropical Forest Soil	MAGSTMRSLNETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0126378_115086083	3300010361	Tropical Forest Soil	MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWE
Ga0126377_100099018	3300010362	Tropical Forest Soil	MAGSTMRTVNETKQPEADLWTWIVIGLVFSAVTAALYAPFVWEHWA*
Ga0126377_101116193	3300010362	Tropical Forest Soil	MDETNQPDLWTWIVIGIVFGAVAAALYGPFVWEYWVV*
Ga0126377_101840363	3300010362	Tropical Forest Soil	MAGSTMRTANEKKQPEADLWTWIVIGLVFGVVTAALYAPFVWEHWVA*
Ga0126377_104349011	3300010362	Tropical Forest Soil	MRTVDEPKQPDLWTWVVIGIVFSAVMAALYGPFVWEHWVVV*
Ga0126377_105835422	3300010362	Tropical Forest Soil	MRTVKETKQPEADLWTWIVIGLVFSAVTAALYAPFIWEHWVA*
Ga0126377_121133931	3300010362	Tropical Forest Soil	PKQSDLWTWIVIGIVLSAVMAALYGPFVWEHWVVV*
Ga0126377_129296432	3300010362	Tropical Forest Soil	VDESKQPDLWTWIVIGIVFSAVMAALYGPFVWEHWVV*
Ga0126377_131561281	3300010362	Tropical Forest Soil	LTMRKMDETNQPDLWTWIVIGVVFSTVTAALYGPFVWEHWVV*
Ga0126379_100639162	3300010366	Tropical Forest Soil	MDKMEETKQADPWTWIVIGLVFSAVTAALYCPFVWEHWVI*
Ga0126379_106180934	3300010366	Tropical Forest Soil	DKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0126379_110331541	3300010366	Tropical Forest Soil	MRKVDESKQRDLWTWIVIGIVFSAVTAALYGPFVWEHWVV*
Ga0126379_114180381	3300010366	Tropical Forest Soil	VNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA*
Ga0126379_123151271	3300010366	Tropical Forest Soil	MRMMDEPKQADLWTWIVIGIVFSAVTAALYGPFVW
Ga0126381_1003688081	3300010376	Tropical Forest Soil	MPKDKTKQTDLWTWIVIGLVFSAVTVALYGPFVWEHWVT*
Ga0126383_101022431	3300010398	Tropical Forest Soil	MKVGRQMHKVNVTKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA*
Ga0126383_101799991	3300010398	Tropical Forest Soil	KGRQTMDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0126383_106068261	3300010398	Tropical Forest Soil	ETKQPDLWTWIVIGIVFSAVTAALYGPLVWEHWVV*
Ga0126383_114401832	3300010398	Tropical Forest Soil	EFTMHKVDEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVA*
Ga0126383_114671011	3300010398	Tropical Forest Soil	GRQTMDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVV*
Ga0126383_123251082	3300010398	Tropical Forest Soil	TESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0134122_108045561	3300010400	Terrestrial Soil	MRKMDEPKQADLWTWTVIGVVFSAVLAALYGPFVWEHWVL*
Ga0126375_100932071	3300012948	Tropical Forest Soil	MRKVDEIKHPDLWTWIAIGIVFSAVMAVLYGPFIWEHWAV*
Ga0126375_110301932	3300012948	Tropical Forest Soil	MRKMDESKQPDLWTWIVIGLVFSAVTIALYGPFVWERWVI*
Ga0126375_115397241	3300012948	Tropical Forest Soil	MHTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEH
Ga0126369_105127761	3300012971	Tropical Forest Soil	MAGSTMRSVNETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHWVT*
Ga0126369_127864031	3300012971	Tropical Forest Soil	MRKVTESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVV*
Ga0132258_100697211	3300015371	Arabidopsis Rhizosphere	MQKVDESKRADLWTWIVIGLVFSAVTVALYGPFVWEHWVV*
Ga0132258_100783049	3300015371	Arabidopsis Rhizosphere	MRTVNQPKQSEQADLWTWFVIGLVFSAVTVALYGTFIWEHWVT*
Ga0132258_100790753	3300015371	Arabidopsis Rhizosphere	MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHYVI*
Ga0132258_101565142	3300015371	Arabidopsis Rhizosphere	MRKMDETKPANLWTWIVIGIVFSAVTVALYGPFVWEHWVA*
Ga0132258_103119883	3300015371	Arabidopsis Rhizosphere	MMDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI*
Ga0132256_1011156722	3300015372	Arabidopsis Rhizosphere	MQKADESKRADLWTWIVIGLVFSAVTVALYGPFVWEHWVV*
Ga0132256_1035483622	3300015372	Arabidopsis Rhizosphere	MMHKVDESKRVDLWTWIVIGLVFSTVTVALYGPFVWEHWVV*
Ga0132257_1012364931	3300015373	Arabidopsis Rhizosphere	MRKMDETKPANLWTWIVIGIVFSAVTVALYGPFVWEDWVA
Ga0132255_1023136061	3300015374	Arabidopsis Rhizosphere	QTMRKMDETKPANLWTWIVIGIVFSAVTVALYGPFVWEHWVA*
Ga0182036_110730021	3300016270	Soil	TPAAKKNELTMRKVAESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI
Ga0182033_106806543	3300016319	Soil	ERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT
Ga0182032_112700262	3300016357	Soil	MPKDKTKQTDLWTWIVIGLVFSAVTVALYGPFVWEHWGDL
Ga0182038_104797792	3300016445	Soil	MHKLEETQQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI
Ga0187783_108667271	3300017970	Tropical Peatland	MDKMEETKQADPWTWIVIGLVFSAVTAALYGSFVWEHWVV
Ga0210399_106283181	3300020581	Soil	MRTEIETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHLVT
Ga0210408_101222852	3300021178	Soil	MHKVDESKHADLWTWIVIGLVFGAVTVALYGPFVWEHWVV
Ga0126371_102000841	3300021560	Tropical Forest Soil	MRKVDETKQWDLWTWIVIGVVFGAVTAALYGPFVWEHWVV
Ga0126371_103748033	3300021560	Tropical Forest Soil	MRKVDESKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV
Ga0126371_108711202	3300021560	Tropical Forest Soil	MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT
Ga0126371_121045062	3300021560	Tropical Forest Soil	MRKVDQSKQPDLLTWIVIGIAFSVVTAALYGPFVWEHWVV
Ga0126371_133220772	3300021560	Tropical Forest Soil	MRKVDESKQPDLWTWVVLGLVFSAVTAALYGPFVWEHWVI
Ga0207668_102332573	3300025972	Switchgrass Rhizosphere	MHTVNDTKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA
Ga0209177_100362702	3300027775	Agricultural Soil	MGPVNEMEQPEPDLWTWIVIGFVFSAVSAALYGPFVWEHWAP
Ga0209465_100381374	3300027874	Tropical Forest Soil	MRKVDETRQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV
Ga0209465_104528001	3300027874	Tropical Forest Soil	MHKVDEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVA
Ga0209465_104772871	3300027874	Tropical Forest Soil	PKKNELTMRKVDETKQWDLWTWIVIGVVFSTVTAALYGPFVWEHWVV
Ga0207428_105795642	3300027907	Populus Rhizosphere	MRNADEIKQPDLWTWIVIGIVFGAVTAALYGPFIWEHWVV
Ga0318541_104487582	3300031545	Soil	MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI
Ga0310915_103613772	3300031573	Soil	KVNEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVV
Ga0310915_107490601	3300031573	Soil	MEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI
Ga0306917_110218302	3300031719	Soil	TMRKVDEFKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV
Ga0307468_1015732381	3300031740	Hardwood Forest Soil	MRKMDEPKQADLWTWTVIGVVFSAVMAALYGPFVWAHWVL
Ga0306918_103637391	3300031744	Soil	MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI
Ga0318552_101469642	3300031782	Soil	MDKVNEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVV
Ga0306925_104812153	3300031890	Soil	MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT
Ga0306925_119584361	3300031890	Soil	AAKKNELTMRKVDESKQPDLWTWIVIGIVFSAVTPALYGPFVWEHWVV
Ga0318520_110138111	3300031897	Soil	MRKVDESKQPDLWTWIVIGIVFSSVMAALYGPFVWEHWVV
Ga0306921_100821481	3300031912	Soil	MPKDKTKQTDLWTWIVIGLVFSAVTVALYGPFVWE
Ga0306921_117919802	3300031912	Soil	MRKVAESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI
Ga0310912_111566321	3300031941	Soil	MRKVDETKQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV
Ga0310909_102383161	3300031947	Soil	TMDKVNEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVV
Ga0306922_107095202	3300032001	Soil	MRKVDESKQPDLWTWIVIGIVFSAVTPALYGPFVWEHWVV
Ga0307471_1015532831	3300032180	Hardwood Forest Soil	MHTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA
Ga0306920_1003608093	3300032261	Soil	MRKVDEFKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV
Ga0373948_0056001_667_789	3300034817	Rhizosphere Soil	MRKMDEPKQADLWTWTVIGVVFSAVMAALYGPFVWEHWVL
Ga0373958_0050785_39_161	3300034819	Rhizosphere Soil	MRNADDIKQPDLWTWIVIGIVFGAVTAALYGPFIWEHWVV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F047344

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences