| Basic Information | |
|---|---|
| Family ID | F047339 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLSIV |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.67 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (5.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 10.67 |
| PF16757 | Fucosidase_C | 4.00 |
| PF04237 | YjbR | 2.67 |
| PF13620 | CarboxypepD_reg | 2.67 |
| PF03938 | OmpH | 2.00 |
| PF12697 | Abhydrolase_6 | 2.00 |
| PF02230 | Abhydrolase_2 | 1.33 |
| PF02687 | FtsX | 1.33 |
| PF05036 | SPOR | 1.33 |
| PF13709 | DUF4159 | 1.33 |
| PF01161 | PBP | 1.33 |
| PF13172 | Obsolete Pfam Family | 1.33 |
| PF02548 | Pantoate_transf | 1.33 |
| PF04187 | Cofac_haem_bdg | 0.67 |
| PF08450 | SGL | 0.67 |
| PF02668 | TauD | 0.67 |
| PF00005 | ABC_tran | 0.67 |
| PF02979 | NHase_alpha | 0.67 |
| PF00313 | CSD | 0.67 |
| PF12897 | Asp_aminotransf | 0.67 |
| PF12704 | MacB_PCD | 0.67 |
| PF00753 | Lactamase_B | 0.67 |
| PF07690 | MFS_1 | 0.67 |
| PF00254 | FKBP_C | 0.67 |
| PF08447 | PAS_3 | 0.67 |
| PF12867 | DinB_2 | 0.67 |
| PF13590 | DUF4136 | 0.67 |
| PF08669 | GCV_T_C | 0.67 |
| PF07715 | Plug | 0.67 |
| PF01494 | FAD_binding_3 | 0.67 |
| PF03544 | TonB_C | 0.67 |
| PF00027 | cNMP_binding | 0.67 |
| PF04542 | Sigma70_r2 | 0.67 |
| PF01546 | Peptidase_M20 | 0.67 |
| PF00571 | CBS | 0.67 |
| PF00282 | Pyridoxal_deC | 0.67 |
| PF12695 | Abhydrolase_5 | 0.67 |
| PF12802 | MarR_2 | 0.67 |
| PF13687 | DUF4153 | 0.67 |
| PF03795 | YCII | 0.67 |
| PF00756 | Esterase | 0.67 |
| PF00072 | Response_reg | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 42.67 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 2.67 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 1.33 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.33 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.33 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.67 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.67 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.67 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.67 |
| COG3016 | Putative heme-binding protein PhuW | General function prediction only [R] | 0.67 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.67 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.67 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.67 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.67 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.67 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.67 % |
| Unclassified | root | N/A | 9.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101102695 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300000559|F14TC_103408867 | Not Available | 1318 | Open in IMG/M |
| 3300000955|JGI1027J12803_107152983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300002244|JGI24742J22300_10089042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300004157|Ga0062590_101190757 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300004480|Ga0062592_101851336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300004643|Ga0062591_102471617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300005093|Ga0062594_100966930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300005294|Ga0065705_10951356 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005328|Ga0070676_10563884 | Not Available | 817 | Open in IMG/M |
| 3300005329|Ga0070683_101905219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005332|Ga0066388_101118816 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300005332|Ga0066388_102643253 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005334|Ga0068869_100656767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300005335|Ga0070666_10957998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300005343|Ga0070687_100617659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300005364|Ga0070673_100377265 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300005444|Ga0070694_101079615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300005445|Ga0070708_100904033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300005456|Ga0070678_100509468 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005457|Ga0070662_101927681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005529|Ga0070741_10364578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1336 | Open in IMG/M |
| 3300005539|Ga0068853_101123615 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005564|Ga0070664_101112337 | Not Available | 744 | Open in IMG/M |
| 3300005564|Ga0070664_101676461 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005577|Ga0068857_100575556 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005713|Ga0066905_101899844 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005719|Ga0068861_101291631 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005840|Ga0068870_11455304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005937|Ga0081455_11059839 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006028|Ga0070717_11624370 | Not Available | 585 | Open in IMG/M |
| 3300006046|Ga0066652_101225056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300006163|Ga0070715_10199997 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006175|Ga0070712_101159215 | Not Available | 672 | Open in IMG/M |
| 3300006178|Ga0075367_10469302 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006358|Ga0068871_100868929 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006800|Ga0066660_10562255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300006844|Ga0075428_101406256 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006844|Ga0075428_102503407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006871|Ga0075434_100700190 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006876|Ga0079217_11208101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300006881|Ga0068865_101522875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300006904|Ga0075424_102638766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300006954|Ga0079219_10460908 | Not Available | 872 | Open in IMG/M |
| 3300007253|Ga0075182_10035400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300009012|Ga0066710_104666346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009094|Ga0111539_13516915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300009111|Ga0115026_11888846 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009147|Ga0114129_10066760 | All Organisms → cellular organisms → Bacteria | 5016 | Open in IMG/M |
| 3300009147|Ga0114129_10085564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4374 | Open in IMG/M |
| 3300009148|Ga0105243_10114681 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300009174|Ga0105241_10830604 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300009174|Ga0105241_11578690 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300009176|Ga0105242_11439500 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300009177|Ga0105248_10015003 | All Organisms → cellular organisms → Bacteria | 8530 | Open in IMG/M |
| 3300009545|Ga0105237_10894560 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300010038|Ga0126315_11145678 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010047|Ga0126382_10602642 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010366|Ga0126379_11436448 | Not Available | 796 | Open in IMG/M |
| 3300010399|Ga0134127_11901264 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010400|Ga0134122_11925815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300010403|Ga0134123_10874991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 901 | Open in IMG/M |
| 3300010403|Ga0134123_12529346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 580 | Open in IMG/M |
| 3300012022|Ga0120191_10067741 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012043|Ga0136631_10483072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012208|Ga0137376_11428649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012212|Ga0150985_101053054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
| 3300012897|Ga0157285_10320235 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012915|Ga0157302_10491295 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 528 | Open in IMG/M |
| 3300012923|Ga0137359_11762219 | Not Available | 506 | Open in IMG/M |
| 3300012948|Ga0126375_10747919 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300012957|Ga0164303_10581794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300012971|Ga0126369_11591045 | Not Available | 743 | Open in IMG/M |
| 3300012987|Ga0164307_10453326 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300013104|Ga0157370_11591517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300014968|Ga0157379_12115917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300014969|Ga0157376_12070416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300015200|Ga0173480_10082891 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300015371|Ga0132258_10139378 | All Organisms → cellular organisms → Bacteria | 5800 | Open in IMG/M |
| 3300015371|Ga0132258_12974476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1175 | Open in IMG/M |
| 3300015372|Ga0132256_100887861 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300015372|Ga0132256_101180652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300015372|Ga0132256_102896404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300015372|Ga0132256_103665542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300015373|Ga0132257_100435581 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300015373|Ga0132257_104176298 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300015374|Ga0132255_101147154 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300015374|Ga0132255_106248259 | Not Available | 504 | Open in IMG/M |
| 3300017959|Ga0187779_10601460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300018076|Ga0184609_10083522 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300018482|Ga0066669_11491154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 614 | Open in IMG/M |
| 3300019377|Ga0190264_12065351 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021067|Ga0196978_1123615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300021073|Ga0210378_10213421 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300021081|Ga0210379_10363318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300021559|Ga0210409_11310653 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300022737|Ga0247747_1026325 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300023263|Ga0247800_1039028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300024288|Ga0179589_10598042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300025315|Ga0207697_10245830 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300025907|Ga0207645_10629398 | Not Available | 729 | Open in IMG/M |
| 3300025907|Ga0207645_10692063 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 693 | Open in IMG/M |
| 3300025910|Ga0207684_11588810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300025911|Ga0207654_10905983 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025912|Ga0207707_10674955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300025918|Ga0207662_10389090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 943 | Open in IMG/M |
| 3300025930|Ga0207701_11446072 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300025932|Ga0207690_11031410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300025938|Ga0207704_10642082 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300025938|Ga0207704_10849883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300025940|Ga0207691_10636932 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300025944|Ga0207661_11722545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300025945|Ga0207679_11751386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300025961|Ga0207712_10278330 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300026023|Ga0207677_10611008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300026041|Ga0207639_12113166 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026089|Ga0207648_10662395 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300026089|Ga0207648_11088542 | Not Available | 749 | Open in IMG/M |
| 3300026307|Ga0209469_1018533 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
| 3300026327|Ga0209266_1054423 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300026330|Ga0209473_1155934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300027815|Ga0209726_10229056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300027821|Ga0209811_10031710 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027909|Ga0209382_12095173 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300028379|Ga0268266_11641963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300028380|Ga0268265_10138643 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300028381|Ga0268264_12025825 | Not Available | 585 | Open in IMG/M |
| 3300028592|Ga0247822_10806212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300028812|Ga0247825_10940065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300030002|Ga0311350_11570248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300031548|Ga0307408_101596059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031668|Ga0318542_10479516 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031720|Ga0307469_11543861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 637 | Open in IMG/M |
| 3300031740|Ga0307468_102133332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300031802|Ga0310123_10231038 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300031890|Ga0306925_10090454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3249 | Open in IMG/M |
| 3300031892|Ga0310893_10148763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300031892|Ga0310893_10208225 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300032000|Ga0310903_10824554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300032003|Ga0310897_10219342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300032009|Ga0318563_10675775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300032012|Ga0310902_10670721 | Not Available | 695 | Open in IMG/M |
| 3300032039|Ga0318559_10476804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300032044|Ga0318558_10092019 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300032063|Ga0318504_10602585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 528 | Open in IMG/M |
| 3300032076|Ga0306924_10100706 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300032180|Ga0307471_101185018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300032180|Ga0307471_101912052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300033412|Ga0310810_10033979 | All Organisms → cellular organisms → Bacteria | 6227 | Open in IMG/M |
| 3300033412|Ga0310810_11158477 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.67% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.67% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.67% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.67% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007253 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021067 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1011026951 | 3300000364 | Soil | MTYVDTALLNFTERLCRRFQTWTGRTNVWIAFQLTNLSIVV |
| F14TC_1034088671 | 3300000559 | Soil | MTYVDAALXXXTEWLCQRFQAWTGRTNVWLAFHLTNLSIVVY |
| JGI1027J12803_1071529831 | 3300000955 | Soil | MTYLDSAVLDFTEWMCRRFQALTGRTNVWLAFQLTNLSIVVYFTWV |
| JGI24742J22300_100890421 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSI |
| Ga0062590_1011907573 | 3300004157 | Soil | MIYIDLALLDLIESLCRRFQILTGRTNVWLAFQLTNLSIVVY |
| Ga0062592_1018513362 | 3300004480 | Soil | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVW |
| Ga0062591_1024716172 | 3300004643 | Soil | MTYVDSAVLNLTELMCQRFQVWTGRTNVWVAFQLTNLSIVVYFIWAAGLYVESEDLGL |
| Ga0062594_1009669301 | 3300005093 | Soil | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFF |
| Ga0065705_109513561 | 3300005294 | Switchgrass Rhizosphere | MTYVDSAVLDLTEQICRRFQAWTGRTNVWLAFQLTNLSIVVYFIWAAGLY |
| Ga0070676_105638842 | 3300005328 | Miscanthus Rhizosphere | MLSVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWAGMH |
| Ga0070683_1019052192 | 3300005329 | Corn Rhizosphere | MTYVDSALLDLTEWLCRRFQAWTGRTNVWLAFHLTNLSIVVYFTWVGALYWLSGQLA |
| Ga0066388_1011188161 | 3300005332 | Tropical Forest Soil | MTYVDLAALDVTERICRRFQAWTGRTNIWLAFQLTNLSVV |
| Ga0066388_1026432532 | 3300005332 | Tropical Forest Soil | MTYVDTAVLNLTEWICRRFQTASGRTNVWLAFQLTNLSIVLYFIWVA |
| Ga0068869_1006567671 | 3300005334 | Miscanthus Rhizosphere | MLHIDSALLDLTEQLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWA |
| Ga0070666_109579982 | 3300005335 | Switchgrass Rhizosphere | MTYVDSAVLDLTERLCRRFQTWTGRTNVWLAFQLTNLSIVCYFIWAAG |
| Ga0070687_1006176591 | 3300005343 | Switchgrass Rhizosphere | MTYVDSALLNLTERICRRFQRWTGRTNVWLAFQLTNLSIVVYFIWV |
| Ga0070673_1003772651 | 3300005364 | Switchgrass Rhizosphere | MLHIDSALLDLTERLCRRFQVLTGRTNVWLAFQLTNFSIV |
| Ga0070694_1010796152 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYVDSAVLNLTEQMCRRFQVWTGRTNVWLAFQLTNLSIVVYFIWAAGLYLES |
| Ga0070708_1009040332 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LTIDDALLNATEWFCRKFQVLTGRTNVWLAFQLTNLSIILYF |
| Ga0070678_1005094681 | 3300005456 | Miscanthus Rhizosphere | MLSVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVW |
| Ga0070662_1019276811 | 3300005457 | Corn Rhizosphere | MTYIDSALLNLTEAFCRKFQRLTGRTNVWLAFQLTNFSIVVYFI |
| Ga0070741_103645782 | 3300005529 | Surface Soil | VTVIDTAVLDFTEQVCRRFQWLTGRTNVWLAFQLTNLSIVVYFTWVITLYWLSAMFAVRV |
| Ga0068853_1011236152 | 3300005539 | Corn Rhizosphere | MTYLDSAVLNLTERICRRFQASTGRTNVWLAFQLTNLSIVVYFIWVANLY |
| Ga0070664_1011123371 | 3300005564 | Corn Rhizosphere | MILVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWA |
| Ga0070664_1016764611 | 3300005564 | Corn Rhizosphere | MTYVDSAVLNFTEQLCRRFQTWTGRTNVWLAFQLTNL |
| Ga0068857_1005755561 | 3300005577 | Corn Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIV |
| Ga0066905_1018998442 | 3300005713 | Tropical Forest Soil | VTQLDSAILNAAERACQKFQVLTGRTNVWLAVQLTNLSI |
| Ga0068861_1012916311 | 3300005719 | Switchgrass Rhizosphere | MTYVDSAVLDFTEWICRRFQAWTGRTNVWLAFQLTNLSIVVYF |
| Ga0068870_114553042 | 3300005840 | Miscanthus Rhizosphere | VTYIDSALLNLIERTCRRFQLLTGRTNVWLAIQLTNLS |
| Ga0081455_110598391 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MFYVDSAVLDVIERLCRRFQTWTGRTNVWLAFQLTNLSIVVYFIWVAGLYLMSASLVLRA |
| Ga0070717_116243702 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYVDSAVLNLTEWICRRFQTATGRTNVWLAFQLTNLSIVLYFI |
| Ga0066652_1012250561 | 3300006046 | Soil | MTYVDSAVLNLTERICRGFQTRTGRTNVWLAFQLTNLS |
| Ga0070715_101999971 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYVDSAVLDLTERLCRRFQTWTGRTNVWLAFQLTNLSIVMYFAWVA |
| Ga0070712_1011592151 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHVDSALLDLTEWLCRRFPVLTGRTNVWLAFQLTNFSIVVFFI |
| Ga0075367_104693021 | 3300006178 | Populus Endosphere | MTYLDSVVLNLVERMCRRFQTWTGRTNVWIAFQLTNLS |
| Ga0068871_1008689293 | 3300006358 | Miscanthus Rhizosphere | MLHVDSLLLDVTEWLCRRFQMLTGRTNVWLAFQLTNFSIVVF |
| Ga0066660_105622551 | 3300006800 | Soil | MLRVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNLSIVV |
| Ga0075428_1014062561 | 3300006844 | Populus Rhizosphere | MTYVDSAILDLTEQMCRRFQAWTGRTNVWLAFQLTNLSIVVYFIWAAGLYLV |
| Ga0075428_1025034071 | 3300006844 | Populus Rhizosphere | MLTVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVW |
| Ga0075434_1007001901 | 3300006871 | Populus Rhizosphere | MTYVDSAVLNLVERLCRRFQVWTGRTNVWLAFQLTNLSVIVYFIWV |
| Ga0079217_112081011 | 3300006876 | Agricultural Soil | MIYIDSALLDVTEWLCRRFQVLTGRTNVWLAFQLTNLSIIV |
| Ga0068865_1015228751 | 3300006881 | Miscanthus Rhizosphere | MLTVDSVLLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSI |
| Ga0075424_1026387662 | 3300006904 | Populus Rhizosphere | MTFLDTAILNLIEWICRRFQAWTGKTNVWLAFQLTNLS |
| Ga0079219_104609081 | 3300006954 | Agricultural Soil | MTYVDSAVLNLIECICRRFQTATGRTNVWLAFQLTNLSIVLYFIWV |
| Ga0075182_100354003 | 3300007253 | Wastewater Effluent | MSYLDSALLALVERACQRFQLWTGRTNVWLAFQLTNLSVVVYFGWVAVLYWLS |
| Ga0066710_1046663461 | 3300009012 | Grasslands Soil | MTYVDSAVLNLVERLCRRFQVWTGRTNVWLAFQLTNLSVIVYFI |
| Ga0111539_135169152 | 3300009094 | Populus Rhizosphere | MVYVDLALLDLIEGLCRRFQILTGRTNVWLAFQLTNLSIVVYSI |
| Ga0115026_118888462 | 3300009111 | Wetland | MMHLDAALLNLIEGLCRRFQAWTGRTNVWLAFHLTNLSIIVYFIWVAGL |
| Ga0114129_100667601 | 3300009147 | Populus Rhizosphere | MLTVDAALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFV |
| Ga0114129_100855645 | 3300009147 | Populus Rhizosphere | MLHIDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWAG |
| Ga0105243_101146811 | 3300009148 | Miscanthus Rhizosphere | MLHVDSALLDFTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFI |
| Ga0105241_108306041 | 3300009174 | Corn Rhizosphere | MTYVDSAVLDLTERMCRRFQVWTGRTNVWLAFQLTNLSI |
| Ga0105241_115786901 | 3300009174 | Corn Rhizosphere | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLSIVRYFVWVTVLYV |
| Ga0105242_114395001 | 3300009176 | Miscanthus Rhizosphere | MIFIDSAILNVIEWLCRRFQLLTGRTSVWLAFPLTTLSIV |
| Ga0105248_100150031 | 3300009177 | Switchgrass Rhizosphere | MMNDVDSAVLNLTERICRGFQTWTGRTNVWLAFHLTNLSIVIYF |
| Ga0105237_108945601 | 3300009545 | Corn Rhizosphere | MMYVDSALLDFTERLSQRFQTWCGRTNVWLAFQLTNLSIVV |
| Ga0126315_111456781 | 3300010038 | Serpentine Soil | MIFVDSAILNVTEWLCRRFQLLTGRTNVWLAFQLTNLSIV |
| Ga0126382_106026422 | 3300010047 | Tropical Forest Soil | MLHLDSALLDLTEWLCRRFQMLTGRTNVWLAFQLTNF |
| Ga0126379_114364481 | 3300010366 | Tropical Forest Soil | MTYVDAAVLTLTEWICRKFQILTGRTNVWLAFQLTNLSIVLY |
| Ga0134127_119012642 | 3300010399 | Terrestrial Soil | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLSIVRYFVWVTVLYVLSGDV |
| Ga0134122_119258152 | 3300010400 | Terrestrial Soil | MTYVDSAVLNLTERMCRWFQKWTGRTNVWLAFQLTNLSIVCYFIWAAGLYLLSV |
| Ga0134123_108749911 | 3300010403 | Terrestrial Soil | MTYLDSAVLNLTERVCQRFQRWTGRTNVWLAFQLTNLSVVVYFVWVAGLYVLSDDFTLR |
| Ga0134123_125293461 | 3300010403 | Terrestrial Soil | MTYVDSAVLNLTEQMCRRFQVWTGRTNVWLAFQLTNLSIVVYFIWAAGLYFESEDLAVR |
| Ga0120191_100677411 | 3300012022 | Terrestrial | MQYVDSAVLNLTERMCRRFQTWTGRTNVWLAFQLTNLSIVIYFIWVAALYW |
| Ga0136631_104830721 | 3300012043 | Polar Desert Sand | MTYVDSAVLDFTERWCRRFQTWTGRTNVWLAFQLTNLSIVCYFIW |
| Ga0137376_114286492 | 3300012208 | Vadose Zone Soil | MTYIDLAVLNLTEQMCRRIQTWTGRTNVWLAFQLRNLSVIVYFVWVANLYWLSG |
| Ga0150985_1010530541 | 3300012212 | Avena Fatua Rhizosphere | MTYIDSALLDFVERLCHRFQIMTGRTNLWLAFQLTNLSI |
| Ga0157285_103202352 | 3300012897 | Soil | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVLFFVWA |
| Ga0157302_104912951 | 3300012915 | Soil | MVYVDLALLDLIEGLCRRFQILTGRTNVWLAFQLTNLSIVVYFIWAGV |
| Ga0137359_117622192 | 3300012923 | Vadose Zone Soil | LNYIDDALLNATEWCCRRFQVLTGRTNVWLAFQLTN |
| Ga0126375_107479192 | 3300012948 | Tropical Forest Soil | MTYLDAVLLNLAEASCRSFQMLTGRTNVWLAVQLTNLS |
| Ga0164303_105817941 | 3300012957 | Soil | MTYVDSAVLDLVERLCRRFQVWTGRTNVWLAFQLTNLSVIVYFISVAGLYWL |
| Ga0126369_115910452 | 3300012971 | Tropical Forest Soil | MTYIDSAVLSLTERICRRFQTWTGRSNVWVAFQLTNLSIVVYFIWVTRLYFLSG |
| Ga0164307_104533262 | 3300012987 | Soil | MTYVDTAVLDLTEWICRRFQTATGRTNVWLAFQLTNL |
| Ga0157370_115915171 | 3300013104 | Corn Rhizosphere | MTYLDSAVLNLTERICRRFQASTGRTNVWLAFQLTNLSI |
| Ga0157379_121159171 | 3300014968 | Switchgrass Rhizosphere | MTYVDTAILNLIEWICRRFQTWTGRTNVWLAFQLTNLSVVVYFVWVGVLYWLT |
| Ga0157376_120704161 | 3300014969 | Miscanthus Rhizosphere | MTYVDSAVLNFTEGLCRRFQALTGRTNVWLAFQLTNLSIV |
| Ga0173480_100828911 | 3300015200 | Soil | MVYVDLALLDLIEGLCRRFQILTGRTNVWLAFQLTNLSIVVYF |
| Ga0132258_101393789 | 3300015371 | Arabidopsis Rhizosphere | MTYVDAVLLDLTEWLCRRFQAWTGRTNVWLAFHLT |
| Ga0132258_129744761 | 3300015371 | Arabidopsis Rhizosphere | MTYVDSAVLDFTEWMCRRFQVLTGRTNVWLAFQLTNLSIVVYFTWAATLYF |
| Ga0132256_1008878612 | 3300015372 | Arabidopsis Rhizosphere | MTYVDSAVLNLVERLCRRFQVWTGRTNVWLAFQLTNL |
| Ga0132256_1011806522 | 3300015372 | Arabidopsis Rhizosphere | MTYVDTAILNLIEWICRRFQTWTGRTNVWLAFQLT |
| Ga0132256_1028964041 | 3300015372 | Arabidopsis Rhizosphere | MIFVDRAVLNFTERFCHRFQMWTGRTNVWLAFQLPN |
| Ga0132256_1036655421 | 3300015372 | Arabidopsis Rhizosphere | MTYVDSAVLNLVERLCRRFQVWTGRTNVWLAFQLTNLSVIVYFISVAGLYWL |
| Ga0132257_1004355811 | 3300015373 | Arabidopsis Rhizosphere | MTYVDSAVLNLVERLCRRFQVWTGRTNVWLAFQLTNLSVIVYFISVAGLYWLSG |
| Ga0132257_1041762982 | 3300015373 | Arabidopsis Rhizosphere | MIYVDSALLNLIEAACRQFQVLTGRTNVWLAFQLTNLSIVVYFVLA |
| Ga0132255_1011471542 | 3300015374 | Arabidopsis Rhizosphere | MPYVDAAVLDFTERICRRFQTWTWRTNVWVAFHLTNLSI |
| Ga0132255_1062482593 | 3300015374 | Arabidopsis Rhizosphere | MTYVDTAVLNLMERLCRRFQVWTGRTNVWVAFHLTNLSIVLYFVWVTV |
| Ga0187779_106014602 | 3300017959 | Tropical Peatland | MMHVDSTVLTLAERLCRRFQYWTGRTNVWLAFQLTNLSIV |
| Ga0184609_100835221 | 3300018076 | Groundwater Sediment | MTYVDSAVLDLTEQMCRRFQALTGRTNVWLAFQLTNLSIVIYFIWAAG |
| Ga0066669_114911541 | 3300018482 | Grasslands Soil | MTYVDSAVLVLTEQICRRFQAWTGRTNVWLAFQLTNLSIVIYF |
| Ga0190264_120653511 | 3300019377 | Soil | MTYVDSAVLNFTEWMCRRFQTWTGRTNVWLAFQLTNLSIVI |
| Ga0196978_11236151 | 3300021067 | Soil | MTSVDAAILDLTESLCRRFQRLTGRTNVWLAVQLTNLSI |
| Ga0210378_102134211 | 3300021073 | Groundwater Sediment | MTYVDSAVLDLTEQICRRFQAWTGRTNVWLAFQLTNLS |
| Ga0210379_103633181 | 3300021081 | Groundwater Sediment | MMFIDETVLNFTERMCHRFQSWTGRTNVWLAFQLTNLSIVLYFIWIADLYVLAGDGVSR |
| Ga0210409_113106531 | 3300021559 | Soil | MTYVDSAVLDLTERMCSRFQAWTGRTNVWLAFQLTNLSIVVYFIWAAGLY |
| Ga0247747_10263252 | 3300022737 | Soil | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLSIV |
| Ga0247800_10390281 | 3300023263 | Soil | MTYLDTAILNLIEWICRRFQAWTGKTNVWLAFQLTNLSVVVYFVW |
| Ga0179589_105980422 | 3300024288 | Vadose Zone Soil | MTYVDSAVLDLTERVCRWFQTWTGRTNVWLAFQLTNLSIVCY |
| Ga0207697_102458303 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MMYVDSALLDFTERLCRHFQSWSRRTNVWLAFQLTNLSIIVYF |
| Ga0207645_106293982 | 3300025907 | Miscanthus Rhizosphere | MTYVDSAVLDLTERLCRRFQTWTGRTNVWLAFQLTNL |
| Ga0207645_106920632 | 3300025907 | Miscanthus Rhizosphere | MVYVDLALLDLIEGLCRRFQILTGRTNVWLAFQLTN |
| Ga0207684_115888101 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWA |
| Ga0207654_109059831 | 3300025911 | Corn Rhizosphere | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLSIVLYFVWVTVLYVL |
| Ga0207707_106749552 | 3300025912 | Corn Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFLVWA |
| Ga0207662_103890902 | 3300025918 | Switchgrass Rhizosphere | MTYVDSALLNLTERICRRFQRWTGRTNVWLAFQLTNLSIVVYFIWVGG |
| Ga0207701_114460721 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLSIVLY |
| Ga0207690_110314101 | 3300025932 | Corn Rhizosphere | MLHIDSALLDLTEQLCRRFQVLTGRTNVWLAFQLTNFSIVVFF |
| Ga0207704_106420822 | 3300025938 | Miscanthus Rhizosphere | MTYVDSAVLNFTEQLCRRFQTWTGRTNVWLAFQLTNLSIVVYFTW |
| Ga0207704_108498832 | 3300025938 | Miscanthus Rhizosphere | MTYVDSALLDFTERLCRRFQTWSGRTNVWLAFQLTNLSIVVYFTWVAVLYWLTGM |
| Ga0207691_106369321 | 3300025940 | Miscanthus Rhizosphere | MTYVDTAVLDLTEQICRRFQTWTGRTNVWLAFQLTNLS |
| Ga0207661_117225452 | 3300025944 | Corn Rhizosphere | MTYVDSALLDLTEWLCRRFQAWTGRTNVWLAFHLTNLSIVVYFTWVGALYWL |
| Ga0207679_117513861 | 3300025945 | Corn Rhizosphere | VTYVDSAVLDFTERMCRQFQVWTGRTNVWLAFQLTNLSIVVYFIWAAGLYFASGDLALRV |
| Ga0207712_102783302 | 3300025961 | Switchgrass Rhizosphere | MTYVDSAVLDLTERICRRFQTWTGRTNVWLAFQLTNLS |
| Ga0207677_106110083 | 3300026023 | Miscanthus Rhizosphere | MLHIDSALLDLTEQLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWAGMHF |
| Ga0207639_121131662 | 3300026041 | Corn Rhizosphere | MTYLDSAVLNLTERICRRFQASTGRTNVWLAFQLTNLS |
| Ga0207648_106623952 | 3300026089 | Miscanthus Rhizosphere | MTYVDSAVLNFTEQLCRRFQTWTGRTNVWLAFQLT |
| Ga0207648_110885422 | 3300026089 | Miscanthus Rhizosphere | MTYVDSALLDFTERLCRRFQTWSGRTNVWLAFQLTNLSIVIYFTWVAVLYWLTG |
| Ga0209469_10185331 | 3300026307 | Soil | MTHVDSAVLNLTERICRRFQTWTGRTNVWLAFQLTNLSIIVYFIWVGHLYWLS |
| Ga0209266_10544231 | 3300026327 | Soil | MTHVDSAVLNLTERICRRFQTWTGRTNVWLAFQLT |
| Ga0209473_11559343 | 3300026330 | Soil | LNYIDDALLNATEWCCRRFQVLTGRTNVWLAFQFT |
| Ga0209726_102290562 | 3300027815 | Groundwater | MTYVDSAVLDLTEQMCRRFQAWTGRTNVWLAFQLTN |
| Ga0209811_100317101 | 3300027821 | Surface Soil | MVYVDLALLDLIEGLCRRFQILTGRTNVWLAFQLTNLSIVVY |
| Ga0209382_120951732 | 3300027909 | Populus Rhizosphere | MGGIDSAVLDFTELLCRRFQLLTGRTNVWLAVQVTNLS |
| Ga0268266_116419633 | 3300028379 | Switchgrass Rhizosphere | MMYVDSALLDFTERLCRHFQSWSGRTNVWLAFQLTNLSIIVYFAWVAVLYWLTGMLA |
| Ga0268265_101386431 | 3300028380 | Switchgrass Rhizosphere | MVYVDLALLDLIEGLCRRFQILTGRTNVWLAFQLTNLSIVV |
| Ga0268264_120258252 | 3300028381 | Switchgrass Rhizosphere | MLTLDSVLLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWA |
| Ga0247822_108062122 | 3300028592 | Soil | MSYIDSIVLDLTERVCRQFQMLTGRTNVWLAVQLTNLS |
| Ga0247825_109400651 | 3300028812 | Soil | MLYVDSILLDLTEWGCRKFQVLTGRTNVWLAFQLTNLSIIVYFVSAALFF |
| Ga0311350_115702482 | 3300030002 | Fen | MTFIDSAIVDWTEVLCRRFQVLTGRTNVWLAIQLTNLSIVVY |
| Ga0307408_1015960592 | 3300031548 | Rhizosphere | MLYIDAALLNAIERLCRRFQVLTGRTNVWLAFQLTNLSI |
| Ga0318542_104795162 | 3300031668 | Soil | MTYVDAAVLNLTERICRRFQTWTGRTNVWLAFQLTNLSIVMYFTWVAGLYL |
| Ga0307469_115438612 | 3300031720 | Hardwood Forest Soil | MTYVDSAVLDLTERLCRRFQTWTGRTNVWLAFQLTNLSIVLYFAWVAGLYLLSADVTL |
| Ga0307468_1021333321 | 3300031740 | Hardwood Forest Soil | MTYVDSAVLDVTEQMCRRFQAWTGRTNVWLAFQLTNLSIV |
| Ga0310123_102310383 | 3300031802 | Marine | MGIDSALLDLTERICHKIQTLTGRTNVWLAFQLTNLS |
| Ga0306925_100904545 | 3300031890 | Soil | MTYIDSAVLSLTERICRRFQTWTGRSNVWVAFQLTNLSI |
| Ga0310893_101487631 | 3300031892 | Soil | VTYIDAALLNLIEWFCRKMQLLTGWTNVWLAFQLTNLSVIVY |
| Ga0310893_102082252 | 3300031892 | Soil | MTFIDEAVLNFTERMCRRFQTWTGRTNVWLAFQLTNLSIVLYFIWVADLYFL |
| Ga0310903_108245541 | 3300032000 | Soil | MTYVDTAILNLIEWICRRFQTWTGRTNVWLAFQLTNLSVVVYFVWVGVLYWLTGDL |
| Ga0310897_102193421 | 3300032003 | Soil | MIFVDRAVLNFTERFCHRFQMWTGRTNVWLAFQLTNLSIVLYFIWVADLYVLAGDRA |
| Ga0318563_106757751 | 3300032009 | Soil | VTQLDSAILNAAERACQKFQVLTGRTNVWLAVQLTNLSIV |
| Ga0310902_106707211 | 3300032012 | Soil | MSFIDRTLLDATEYLCRRFQALTGRTNVWIAVQLTNLSIVVYF |
| Ga0318559_104768042 | 3300032039 | Soil | MMYVDLAVLNLTERICRWFQVWTGRTNVWLAFQLTNLG |
| Ga0318558_100920192 | 3300032044 | Soil | MTYVDAAVLNLTERICRRFQTWTGRTNVWLAFQLTNLSIVMYFTWVAGLYLL |
| Ga0318504_106025851 | 3300032063 | Soil | MTYVDAAVLNLTERICRRFQTWTGRTNVWLAFQLTNLSIVMYFTWVA |
| Ga0306924_101007064 | 3300032076 | Soil | MTYVDAAVLNLTERICRRFQTWTGRTNVWLAFQLTNLSIVMYFTWVAG |
| Ga0307471_1011850181 | 3300032180 | Hardwood Forest Soil | MLHVDSALLDLAEWLCRRFQLLTGRTNVWLAFQMTNF |
| Ga0307471_1019120522 | 3300032180 | Hardwood Forest Soil | VLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVW |
| Ga0310810_100339791 | 3300033412 | Soil | MLYVDSALLDFTEWLCRRFQVLTGRTNVWLAFQLT |
| Ga0310810_111584772 | 3300033412 | Soil | MTYVDSVVLNFTERLCRRFQTWTGRTNVWLAFQLTNLSIVMYFTWV |
| ⦗Top⦘ |