| Basic Information | |
|---|---|
| Family ID | F047317 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYSIL |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 8.00 % |
| % of genes near scaffold ends (potentially truncated) | 46.67 % |
| % of genes from short scaffolds (< 2000 bps) | 76.67 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (22.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 2.67 |
| PF02511 | Thy1 | 2.67 |
| PF14572 | Pribosyl_synth | 2.00 |
| PF04404 | ERF | 2.00 |
| PF02562 | PhoH | 2.00 |
| PF01464 | SLT | 1.33 |
| PF00145 | DNA_methylase | 1.33 |
| PF08774 | VRR_NUC | 1.33 |
| PF03061 | 4HBT | 1.33 |
| PF10571 | UPF0547 | 0.67 |
| PF08299 | Bac_DnaA_C | 0.67 |
| PF14743 | DNA_ligase_OB_2 | 0.67 |
| PF02675 | AdoMet_dc | 0.67 |
| PF12684 | DUF3799 | 0.67 |
| PF03951 | Gln-synt_N | 0.67 |
| PF06739 | SBBP | 0.67 |
| PF02617 | ClpS | 0.67 |
| PF03851 | UvdE | 0.67 |
| PF00565 | SNase | 0.67 |
| PF01832 | Glucosaminidase | 0.67 |
| PF13585 | CHU_C | 0.67 |
| PF13155 | Toprim_2 | 0.67 |
| PF06356 | DUF1064 | 0.67 |
| PF03767 | Acid_phosphat_B | 0.67 |
| PF08719 | NADAR | 0.67 |
| PF13203 | DUF2201_N | 0.67 |
| PF00149 | Metallophos | 0.67 |
| PF01555 | N6_N4_Mtase | 0.67 |
| PF06941 | NT5C | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 2.67 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 2.00 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 2.00 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.33 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.67 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.67 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.67 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.67 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.67 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.67 |
| COG3236 | N-glycosidase YbiA/RibX (riboflavin biosynthesis, damage control), NADAR superfamily | Defense mechanisms [V] | 0.67 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.67 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.67 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.67 % |
| All Organisms | root | All Organisms | 43.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10207360 | Not Available | 652 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10276163 | Not Available | 514 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10093679 | Not Available | 1004 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10054474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1725 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10078163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10000320 | All Organisms → cellular organisms → Bacteria | 29369 | Open in IMG/M |
| 3300001450|JGI24006J15134_10049007 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300002231|KVRMV2_100439192 | All Organisms → cellular organisms → Bacteria | 34983 | Open in IMG/M |
| 3300004461|Ga0066223_1399274 | Not Available | 575 | Open in IMG/M |
| 3300005346|Ga0074242_10524322 | Not Available | 795 | Open in IMG/M |
| 3300005613|Ga0074649_1001310 | Not Available | 30291 | Open in IMG/M |
| 3300005837|Ga0078893_10901272 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 10045 | Open in IMG/M |
| 3300005941|Ga0070743_10133378 | Not Available | 828 | Open in IMG/M |
| 3300006164|Ga0075441_10020792 | All Organisms → Viruses → Predicted Viral | 2716 | Open in IMG/M |
| 3300006164|Ga0075441_10188490 | Not Available | 770 | Open in IMG/M |
| 3300006190|Ga0075446_10121656 | Not Available | 755 | Open in IMG/M |
| 3300006193|Ga0075445_10218146 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 661 | Open in IMG/M |
| 3300006734|Ga0098073_1006828 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2175 | Open in IMG/M |
| 3300006734|Ga0098073_1012056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300006752|Ga0098048_1124343 | Not Available | 774 | Open in IMG/M |
| 3300006752|Ga0098048_1146181 | Not Available | 705 | Open in IMG/M |
| 3300006793|Ga0098055_1005888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5863 | Open in IMG/M |
| 3300006793|Ga0098055_1322746 | Not Available | 576 | Open in IMG/M |
| 3300006802|Ga0070749_10285143 | Not Available | 929 | Open in IMG/M |
| 3300006802|Ga0070749_10463305 | Not Available | 693 | Open in IMG/M |
| 3300006802|Ga0070749_10778857 | Not Available | 508 | Open in IMG/M |
| 3300006803|Ga0075467_10246205 | Not Available | 972 | Open in IMG/M |
| 3300006803|Ga0075467_10732983 | Not Available | 503 | Open in IMG/M |
| 3300006874|Ga0075475_10103992 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300006916|Ga0070750_10000213 | All Organisms → cellular organisms → Bacteria | 30920 | Open in IMG/M |
| 3300006920|Ga0070748_1319056 | Not Available | 551 | Open in IMG/M |
| 3300006924|Ga0098051_1004221 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 4765 | Open in IMG/M |
| 3300006947|Ga0075444_10190563 | Not Available | 834 | Open in IMG/M |
| 3300007344|Ga0070745_1101761 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300007538|Ga0099851_1145066 | Not Available | 886 | Open in IMG/M |
| 3300007539|Ga0099849_1051947 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium | 1705 | Open in IMG/M |
| 3300007539|Ga0099849_1092373 | Not Available | 1212 | Open in IMG/M |
| 3300007542|Ga0099846_1243055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 626 | Open in IMG/M |
| 3300007554|Ga0102820_1134657 | Not Available | 595 | Open in IMG/M |
| 3300007681|Ga0102824_1156091 | Not Available | 600 | Open in IMG/M |
| 3300008012|Ga0075480_10194806 | Not Available | 1075 | Open in IMG/M |
| 3300008050|Ga0098052_1141585 | Not Available | 957 | Open in IMG/M |
| 3300008050|Ga0098052_1186265 | Not Available | 811 | Open in IMG/M |
| 3300008221|Ga0114916_1124074 | Not Available | 601 | Open in IMG/M |
| 3300009001|Ga0102963_1456987 | Not Available | 501 | Open in IMG/M |
| 3300009149|Ga0114918_10113542 | Not Available | 1663 | Open in IMG/M |
| 3300009149|Ga0114918_10149407 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium | 1396 | Open in IMG/M |
| 3300009149|Ga0114918_10596537 | Not Available | 584 | Open in IMG/M |
| 3300009428|Ga0114915_1028178 | Not Available | 1942 | Open in IMG/M |
| 3300009432|Ga0115005_10455332 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1018 | Open in IMG/M |
| 3300009434|Ga0115562_1038271 | All Organisms → Viruses → Predicted Viral | 2237 | Open in IMG/M |
| 3300010150|Ga0098056_1011672 | Not Available | 3210 | Open in IMG/M |
| 3300010300|Ga0129351_1092732 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300011258|Ga0151677_1004979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 533 | Open in IMG/M |
| 3300017704|Ga0181371_1015828 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300017706|Ga0181377_1000251 | Not Available | 20926 | Open in IMG/M |
| 3300017706|Ga0181377_1016494 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300017706|Ga0181377_1020415 | Not Available | 1456 | Open in IMG/M |
| 3300017706|Ga0181377_1021097 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
| 3300017706|Ga0181377_1028337 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300017708|Ga0181369_1125701 | Not Available | 517 | Open in IMG/M |
| 3300017721|Ga0181373_1000347 | Not Available | 10380 | Open in IMG/M |
| 3300017721|Ga0181373_1017396 | Not Available | 1343 | Open in IMG/M |
| 3300017729|Ga0181396_1073825 | Not Available | 686 | Open in IMG/M |
| 3300017743|Ga0181402_1015674 | All Organisms → Viruses → Predicted Viral | 2217 | Open in IMG/M |
| 3300017753|Ga0181407_1000126 | Not Available | 24422 | Open in IMG/M |
| 3300017758|Ga0181409_1041749 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300017763|Ga0181410_1018978 | All Organisms → Viruses → Predicted Viral | 2282 | Open in IMG/M |
| 3300017764|Ga0181385_1189983 | Not Available | 620 | Open in IMG/M |
| 3300017782|Ga0181380_1008531 | All Organisms → Viruses → Predicted Viral | 4035 | Open in IMG/M |
| 3300017818|Ga0181565_10119048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1861 | Open in IMG/M |
| 3300017824|Ga0181552_10025393 | Not Available | 3672 | Open in IMG/M |
| 3300017824|Ga0181552_10255905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300017824|Ga0181552_10494910 | Not Available | 576 | Open in IMG/M |
| 3300017949|Ga0181584_10379610 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300017951|Ga0181577_10051908 | Not Available | 2916 | Open in IMG/M |
| 3300017951|Ga0181577_10480924 | Not Available | 779 | Open in IMG/M |
| 3300017962|Ga0181581_10375741 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 898 | Open in IMG/M |
| 3300017967|Ga0181590_10056300 | All Organisms → Viruses → Predicted Viral | 3132 | Open in IMG/M |
| 3300017969|Ga0181585_11088120 | Not Available | 506 | Open in IMG/M |
| 3300017985|Ga0181576_10816251 | Not Available | 551 | Open in IMG/M |
| 3300017986|Ga0181569_10361514 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300017986|Ga0181569_11057742 | Not Available | 521 | Open in IMG/M |
| 3300017991|Ga0180434_10804599 | Not Available | 709 | Open in IMG/M |
| 3300018036|Ga0181600_10194242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1088 | Open in IMG/M |
| 3300018036|Ga0181600_10350585 | Not Available | 728 | Open in IMG/M |
| 3300018048|Ga0181606_10095086 | All Organisms → Viruses → Predicted Viral | 1888 | Open in IMG/M |
| 3300018049|Ga0181572_10409333 | Not Available | 846 | Open in IMG/M |
| 3300018416|Ga0181553_10000637 | Not Available | 30599 | Open in IMG/M |
| 3300018416|Ga0181553_10275179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 945 | Open in IMG/M |
| 3300018417|Ga0181558_10170524 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300018420|Ga0181563_10196258 | Not Available | 1234 | Open in IMG/M |
| 3300018420|Ga0181563_10366842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 828 | Open in IMG/M |
| 3300018426|Ga0181566_10016312 | Not Available | 5880 | Open in IMG/M |
| 3300018428|Ga0181568_10165085 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
| 3300018876|Ga0181564_10411411 | Not Available | 735 | Open in IMG/M |
| 3300018980|Ga0192961_10041556 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300019262|Ga0182066_1194764 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 658 | Open in IMG/M |
| 3300020055|Ga0181575_10356853 | Not Available | 815 | Open in IMG/M |
| 3300020055|Ga0181575_10423256 | Not Available | 729 | Open in IMG/M |
| 3300020182|Ga0206129_10019782 | Not Available | 5312 | Open in IMG/M |
| 3300020438|Ga0211576_10530578 | Not Available | 592 | Open in IMG/M |
| 3300020438|Ga0211576_10574478 | Not Available | 563 | Open in IMG/M |
| 3300020601|Ga0181557_1198388 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 752 | Open in IMG/M |
| 3300021957|Ga0222717_10388143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 775 | Open in IMG/M |
| 3300021958|Ga0222718_10006675 | Not Available | 9145 | Open in IMG/M |
| 3300021959|Ga0222716_10250025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1094 | Open in IMG/M |
| 3300021964|Ga0222719_10618391 | Not Available | 627 | Open in IMG/M |
| 3300022164|Ga0212022_1013262 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300022200|Ga0196901_1255975 | Not Available | 541 | Open in IMG/M |
| 3300022206|Ga0224499_10118582 | Not Available | 899 | Open in IMG/M |
| 3300022308|Ga0224504_10000585 | All Organisms → cellular organisms → Bacteria | 16234 | Open in IMG/M |
| 3300022925|Ga0255773_10055503 | All Organisms → Viruses → Predicted Viral | 2325 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10145723 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Roseivirgaceae → Roseivirga → Roseivirga spongicola | 777 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10311078 | Not Available | 549 | Open in IMG/M |
| 3300023087|Ga0255774_10327596 | Not Available | 721 | Open in IMG/M |
| 3300023105|Ga0255782_10025212 | Not Available | 3497 | Open in IMG/M |
| 3300023117|Ga0255757_10430417 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 597 | Open in IMG/M |
| 3300024235|Ga0228665_1029670 | Not Available | 1121 | Open in IMG/M |
| 3300024262|Ga0210003_1066293 | Not Available | 1760 | Open in IMG/M |
| 3300024262|Ga0210003_1082423 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium | 1511 | Open in IMG/M |
| 3300024262|Ga0210003_1328981 | Not Available | 576 | Open in IMG/M |
| 3300024346|Ga0244775_10031440 | Not Available | 4727 | Open in IMG/M |
| 3300025057|Ga0208018_105906 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1952 | Open in IMG/M |
| 3300025057|Ga0208018_130549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300025084|Ga0208298_1008620 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2620 | Open in IMG/M |
| 3300025098|Ga0208434_1060232 | Not Available | 809 | Open in IMG/M |
| 3300025168|Ga0209337_1058341 | All Organisms → Viruses → Predicted Viral | 1962 | Open in IMG/M |
| 3300025276|Ga0208814_1025570 | Not Available | 1924 | Open in IMG/M |
| 3300025508|Ga0208148_1055047 | Not Available | 970 | Open in IMG/M |
| 3300025543|Ga0208303_1005743 | All Organisms → Viruses → Predicted Viral | 4207 | Open in IMG/M |
| 3300025751|Ga0208150_1228820 | Not Available | 567 | Open in IMG/M |
| 3300025759|Ga0208899_1011253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4943 | Open in IMG/M |
| 3300025759|Ga0208899_1079400 | Not Available | 1285 | Open in IMG/M |
| 3300025889|Ga0208644_1135778 | Not Available | 1151 | Open in IMG/M |
| 3300026453|Ga0228644_1000153 | Not Available | 24021 | Open in IMG/M |
| 3300026504|Ga0247587_1182293 | Not Available | 513 | Open in IMG/M |
| 3300027188|Ga0208921_1008362 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300027522|Ga0209384_1087793 | Not Available | 759 | Open in IMG/M |
| 3300027525|Ga0208437_1072511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Roseivirgaceae → Roseivirga → Roseivirga spongicola | 807 | Open in IMG/M |
| 3300027672|Ga0209383_1002448 | Not Available | 10901 | Open in IMG/M |
| 3300027751|Ga0208304_10245299 | Not Available | 636 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10081169 | Not Available | 1051 | Open in IMG/M |
| 3300028125|Ga0256368_1001647 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2908 | Open in IMG/M |
| 3300031519|Ga0307488_10182526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1438 | Open in IMG/M |
| 3300031519|Ga0307488_10667453 | Not Available | 593 | Open in IMG/M |
| 3300031569|Ga0307489_10831175 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 652 | Open in IMG/M |
| 3300031688|Ga0308011_10159580 | Not Available | 683 | Open in IMG/M |
| 3300032073|Ga0315315_10000021 | All Organisms → cellular organisms → Bacteria | 119466 | Open in IMG/M |
| 3300032373|Ga0316204_10769354 | Not Available | 693 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 22.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.33% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.33% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 4.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.33% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.67% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.00% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.33% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.33% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.33% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.33% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.67% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.67% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.67% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.67% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.67% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.67% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023117 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102073603 | 3300000101 | Marine | NKEKLVGMICKERFETLEENHPFFGIKKVPTPYSINL* |
| DelMOSum2010_102761632 | 3300000101 | Marine | MNKEKLVGMICKEQFETLEENHPFFGIKKVLTPYSINL* |
| DelMOSum2011_100936794 | 3300000115 | Marine | MNKEKLVGMICKEQFETLEENHPFFGIKKVLTPYFINL* |
| DelMOSpr2010_100544746 | 3300000116 | Marine | MSKAKLVGMICKEQLQMLEENHPFFGIKKVLTPYSI* |
| DelMOSpr2010_100781635 | 3300000116 | Marine | MNKEKLVGMICKERFETLEENHPFFGIKKVLTLILLIFKTKKMGRKLK |
| DelMOWin2010_1000032017 | 3300000117 | Marine | MSKEKLVGMICKERLQTLEENPPRCPRSKGIKKVLTPYSFIKPKQI* |
| JGI24006J15134_100490076 | 3300001450 | Marine | MSKEKLVGMICKERLQTLEENHPFFGIKKVLTPYLFKPKQR* |
| KVRMV2_10043919231 | 3300002231 | Marine Sediment | MSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYLFKPKKDE* |
| Ga0066223_13992742 | 3300004461 | Marine | MNKEKLVGMICKERLQTLEENHPFFGIKKVLTLILLIIKQ |
| Ga0074242_105243224 | 3300005346 | Saline Water And Sediment | MGIKFNVVNKTKMGKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSLIKPK* |
| Ga0074649_100131015 | 3300005613 | Saline Water And Sediment | MSKEKLVGMICKERLQTLEENPPRCLYSKGIKKVLTPYLN* |
| Ga0078893_1090127213 | 3300005837 | Marine Surface Water | MSKEKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFNTKEK* |
| Ga0070743_101333782 | 3300005941 | Estuarine | MSKEKLVGMICKERFETLEENHPFFGIKKVLTPYLN* |
| Ga0075441_1002079210 | 3300006164 | Marine | MMSEEKLVGMICKERLQTLEENHPLFGIKKVLTPYLFKPKQRR* |
| Ga0075441_101884904 | 3300006164 | Marine | KLVGMICKERLQTLEENHPLFGIKKVLTPYLFKPKQRR* |
| Ga0075446_101216561 | 3300006190 | Marine | MMSEEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQRR* |
| Ga0075445_102181461 | 3300006193 | Marine | EKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQR* |
| Ga0098073_10068288 | 3300006734 | Marine | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSITFKTK* |
| Ga0098073_10120566 | 3300006734 | Marine | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSFIKPKQR* |
| Ga0098048_11243431 | 3300006752 | Marine | LVGMICKERLQTLEEVHPFFGIKKVLTPYSFLTFNTKER* |
| Ga0098048_11461812 | 3300006752 | Marine | MNKAKLVGMICKERLQTLEEVHPFFGIKKVLTPYSFLTFNTKER* |
| Ga0098055_100588817 | 3300006793 | Marine | MNKAKLVGMICKERLQTLEESHPFFGIKKVLTLILFNLVN |
| Ga0098055_13227462 | 3300006793 | Marine | MSKEKLVGMICKERFETLEENHPVAPYSKGIKKVLTPYSFIKPKQR* |
| Ga0070749_102851433 | 3300006802 | Aqueous | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTF |
| Ga0070749_104633051 | 3300006802 | Aqueous | EMSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFNTKEK* |
| Ga0070749_107788571 | 3300006802 | Aqueous | MSKAKLVGMICKERLQTLEENHPLFGIKKVLTPYSVLTFNTKEK* |
| Ga0075467_102462054 | 3300006803 | Aqueous | EKLVGMICKERFETLEENHPFFGIKKVLTPYFINL* |
| Ga0075467_107329832 | 3300006803 | Aqueous | MNKEKLVGMICKERFETLEENHPFFGIKKVLTPYFIN |
| Ga0075475_101039925 | 3300006874 | Aqueous | MNKEKLVGMICKEQFEMLEENHPFFGIKKVLTPYFINL* |
| Ga0070750_100002139 | 3300006916 | Aqueous | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSFIKAKQR* |
| Ga0070748_13190561 | 3300006920 | Aqueous | IMNKEKLVGMICKERFETLEENHPFFGIKKVLTPYFINL* |
| Ga0098051_10042211 | 3300006924 | Marine | ICKKRLQTLEENHPVAPYSKGIKKVLTPYSFIKPKQR* |
| Ga0075444_101905632 | 3300006947 | Marine | MSKEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQI* |
| Ga0070745_11017615 | 3300007344 | Aqueous | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSI* |
| Ga0099851_11450664 | 3300007538 | Aqueous | MNKEKLVGMICKEQLQMLEETHPFVGIKKVLTPYSITFNTKEI* |
| Ga0099849_10519476 | 3300007539 | Aqueous | MSKEKLVGMICKERLQTLEENPPRCPRSKGIKKVLTPYSN* |
| Ga0099849_10923734 | 3300007539 | Aqueous | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFNTKEK* |
| Ga0099846_12430553 | 3300007542 | Aqueous | EKLVGMICKERLQTLEENPPRCLYSKGIKKVLTPYSLVKTKQR* |
| Ga0102820_11346572 | 3300007554 | Estuarine | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYLN* |
| Ga0102824_11560911 | 3300007681 | Estuarine | TKMSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYLN* |
| Ga0075480_101948061 | 3300008012 | Aqueous | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSI |
| Ga0098052_11415853 | 3300008050 | Marine | MSKEKLVGMICKKRLQTLEENHPFFGIKKVLTPYSFFKQNKDE* |
| Ga0098052_11862653 | 3300008050 | Marine | MNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYSFLTFNTKER* |
| Ga0114916_11240743 | 3300008221 | Deep Ocean | MMSEEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQR* |
| Ga0102963_14569872 | 3300009001 | Pond Water | MSKAKLVGMICKEQLQMLEESHPFVGIKKVLTPYSITFNTNKK* |
| Ga0114918_101135424 | 3300009149 | Deep Subsurface | MSSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYL |
| Ga0114918_101494071 | 3300009149 | Deep Subsurface | MLTAKYMSSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYL |
| Ga0114918_105965371 | 3300009149 | Deep Subsurface | MSSKEKLVGMICKERLQTLEENHPLFGIKKVLTPY |
| Ga0114915_10281784 | 3300009428 | Deep Ocean | MNKEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQI* |
| Ga0115005_104553323 | 3300009432 | Marine | MSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYFLNQNKEDERLHSR* |
| Ga0115562_10382717 | 3300009434 | Pelagic Marine | MNKEKLVGMICKEQFETLEENHPFFGIKKVLTPDFINL* |
| Ga0098056_10116721 | 3300010150 | Marine | MNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYS |
| Ga0129351_10927327 | 3300010300 | Freshwater To Marine Saline Gradient | MSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYSIL |
| Ga0151677_10049792 | 3300011258 | Marine | MNKEKLVGMICKEQLQMLEETHPFVGIKKVLTPYSITFNTKEK* |
| Ga0181371_10158282 | 3300017704 | Marine | MSKEKLVGMICKKRLQTLEENHPFFGIKKVLTPYSFFKQNKDG |
| Ga0181377_10002511 | 3300017706 | Marine | NKAKLVGMICKERLQTLEEVHPFFGIKKVLTPYSFLTFNTKER |
| Ga0181377_10164944 | 3300017706 | Marine | NKAKLVGMICKERLQTLEESHPFFGIKKVLTPYSF |
| Ga0181377_10204151 | 3300017706 | Marine | EMNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYSFLKRINEQV |
| Ga0181377_10210974 | 3300017706 | Marine | MNKAKLVGMICKERLQTLEEVHPFFGIKKVLTPYSFLTFN |
| Ga0181377_10283373 | 3300017706 | Marine | MNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYSF |
| Ga0181369_11257011 | 3300017708 | Marine | MKMNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYS |
| Ga0181373_10003474 | 3300017721 | Marine | MSKEKLVGMICKERFETLEENHPVAPYSKGIKKVLTPYSFIKPKQR |
| Ga0181373_10173961 | 3300017721 | Marine | MNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYSFLII |
| Ga0181396_10738252 | 3300017729 | Seawater | MSKEKLVGMICKERFETLEENPPRCPRSKGIKKVLTPYSFIKPKQR |
| Ga0181402_10156742 | 3300017743 | Seawater | MSKEKLVGTICKERLQTLEENHPFFGIKKVLTPYLFKPKQR |
| Ga0181407_10001267 | 3300017753 | Seawater | MSKEKLVGMICKKRLQTLEENHPFFGIKKVLTPKFIF |
| Ga0181409_10417491 | 3300017758 | Seawater | KTKMSKEKLVGMICKKRLQTLEENHPFFGIKKVLTPYSFFKQNKDE |
| Ga0181410_10189787 | 3300017763 | Seawater | MSKEKLVGTICKERLQTLEENHPFFGIKKVLTPYLFKPKQRR |
| Ga0181385_11899831 | 3300017764 | Seawater | MSKEKLVGTICKERLQTLEENHPFFGIKKVLTPYSFFKQNKDE |
| Ga0181380_10085316 | 3300017782 | Seawater | MSKEKLVGMICKERLQTLEENHPFFGIKKVLTPYLFKPKQRR |
| Ga0181565_101190486 | 3300017818 | Salt Marsh | MSKEKLVGMICKERLQTLEENPPCCPRSKGIKKVLTPYSSIKQII |
| Ga0181552_100253931 | 3300017824 | Salt Marsh | MSKEKLVGMICKERLQTLEETPPRCPYSKGIKKVLTPYSFIKQNKDK |
| Ga0181552_102559052 | 3300017824 | Salt Marsh | MSKEKLVGMICKERLQTLEENPHCCPRSKVIKKVLTPYSFIKPKI |
| Ga0181552_104949103 | 3300017824 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKEK |
| Ga0181584_103796104 | 3300017949 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFNTKEK |
| Ga0181577_100519081 | 3300017951 | Salt Marsh | LVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKEK |
| Ga0181577_104809242 | 3300017951 | Salt Marsh | MSKEKLVGMICKEQLQMLEENHPFFGIKKVLTPYSFIKPKQR |
| Ga0181581_103757411 | 3300017962 | Salt Marsh | EMSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKSKTT |
| Ga0181590_100563001 | 3300017967 | Salt Marsh | MSKAKLVGMICKEQLQILEDNHPLFGIKKVLTPYSILTFKTKEK |
| Ga0181585_110881201 | 3300017969 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILT |
| Ga0181576_108162511 | 3300017985 | Salt Marsh | ICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKEK |
| Ga0181569_103615141 | 3300017986 | Salt Marsh | EMSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTK |
| Ga0181569_110577423 | 3300017986 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFNT |
| Ga0180434_108045991 | 3300017991 | Hypersaline Lake Sediment | TKMSKEKLVGMICKERLQTLEKNPPRCPYSKGIKKVLTPYSFIKTKQR |
| Ga0181600_101942424 | 3300018036 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKT |
| Ga0181600_103505852 | 3300018036 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKER |
| Ga0181606_100950866 | 3300018048 | Salt Marsh | KLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKER |
| Ga0181572_104093336 | 3300018049 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSIL |
| Ga0181553_100006371 | 3300018416 | Salt Marsh | MSKEKLVGMICKERLQTLEETPPRCPYSKVIKKVLTPYSFIKQNKDK |
| Ga0181553_102751791 | 3300018416 | Salt Marsh | SKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKQK |
| Ga0181558_101705245 | 3300018417 | Salt Marsh | VGMICKERLQTLEETPPRCPYSKGIKKVLTPYSFIKQNKDK |
| Ga0181563_101962581 | 3300018420 | Salt Marsh | AKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKEK |
| Ga0181563_103668421 | 3300018420 | Salt Marsh | KLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKQK |
| Ga0181566_1001631219 | 3300018426 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTLTT |
| Ga0181568_101650851 | 3300018428 | Salt Marsh | KENLVGVLCTERMQTLEATPPSSAARKGIKKVLTPYLVK |
| Ga0181564_104114115 | 3300018876 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTK |
| Ga0192961_100415567 | 3300018980 | Marine | MEIKMSKEKLVGMICKERFETLEENHPFFGIKKVLTPYLN |
| Ga0182066_11947642 | 3300019262 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFNTKER |
| Ga0181575_103568534 | 3300020055 | Salt Marsh | NKEKLVGMICKERLQTLEETPPRCSASKGIKKVLTPYLVK |
| Ga0181575_104232562 | 3300020055 | Salt Marsh | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSFIKSKQR |
| Ga0206129_1001978212 | 3300020182 | Seawater | MNKEKLVGMICKERFETLKEIHPFFGMKKVLTPYSIINTFEI |
| Ga0211576_105305783 | 3300020438 | Marine | MSKEKLVGTICKERLQTLEENHPFFGIKKVLTPYLFKPK |
| Ga0211576_105744784 | 3300020438 | Marine | MSKEKLVGMICKKRLQTLEENHPFFGIKKVLTPYSFFKQNKDE |
| Ga0181557_11983883 | 3300020601 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYS |
| Ga0222717_103881431 | 3300021957 | Estuarine Water | NEMSKAKLVGMICKEQLQMLEENHPFFGIKKVLTPYSI |
| Ga0222718_100066755 | 3300021958 | Estuarine Water | MNKEKLVGMICKEQLQMLEENPPRCPRSKGIKKVLTPYSFIKQNKDE |
| Ga0222716_102500255 | 3300021959 | Estuarine Water | MSKAKLVGMICKEQLQMLEENHPFFGIKKVLTPYSI |
| Ga0222719_106183913 | 3300021964 | Estuarine Water | MNKEKLVGMICKELFETLEENHPFFGIKKVLTPYFINL |
| Ga0212022_10132624 | 3300022164 | Aqueous | HQKCSKLKDIMNKEKLVGMICKERFETLEENHPFFGIKKVLTPYFINL |
| Ga0196901_12559752 | 3300022200 | Aqueous | MSKAKLVGMICKERLQTLEENHPLFGIKKVLTPYSILNL |
| Ga0224499_101185824 | 3300022206 | Sediment | NYEAKTKMSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYS |
| Ga0224504_1000058518 | 3300022308 | Sediment | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYS |
| Ga0255773_100555031 | 3300022925 | Salt Marsh | KEKLVGMICKERLQTLEENPPRCPRSKGIKKVLTPYSN |
| (restricted) Ga0233409_101457233 | 3300022938 | Seawater | SKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYLN |
| (restricted) Ga0233409_103110783 | 3300022938 | Seawater | MNKEKLVGMICKEQLQMLEETHPFVGIKKVLTPYSITFKTKDNG |
| Ga0255774_103275961 | 3300023087 | Salt Marsh | VGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKEK |
| Ga0255782_100252127 | 3300023105 | Salt Marsh | GMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTKEK |
| Ga0255757_104304173 | 3300023117 | Salt Marsh | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTL |
| Ga0228665_10296701 | 3300024235 | Seawater | ICKKRLQTLEENPPCCPYSKGIKKVLTPYSFIKTKQR |
| Ga0210003_10662931 | 3300024262 | Deep Subsurface | MSSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYLN |
| Ga0210003_10824231 | 3300024262 | Deep Subsurface | MLTAKYMSSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYLN |
| Ga0210003_13289813 | 3300024262 | Deep Subsurface | YMSSKEKLVGMICKERLQTLEENHPLFGIKKVLTPYLN |
| Ga0244775_100314409 | 3300024346 | Estuarine | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYLN |
| Ga0208018_1059062 | 3300025057 | Marine | MSKAKLVGMICKEQLQMLEENHPLFGIKKVLTPYSITFKTK |
| Ga0208018_1305492 | 3300025057 | Marine | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSFIKPKQR |
| Ga0208298_10086201 | 3300025084 | Marine | ICKERFETLEENHPVAPYSKGIKKVLTPYSFIKPKQR |
| Ga0208434_10602321 | 3300025098 | Marine | EMNKAKLVGMICKERLQTLEESHPFFGIKKVLTPYSFHIN |
| Ga0209337_10583416 | 3300025168 | Marine | MSKEKLVGMICKERLQTLEENHPFFGIKKVLTPYLFKPKQR |
| Ga0208814_10255704 | 3300025276 | Deep Ocean | MNKEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQI |
| Ga0208148_10550473 | 3300025508 | Aqueous | MNKEKLVGMICKEQFETLEENHPFFGIKKVLTPYFINL |
| Ga0208303_100574310 | 3300025543 | Aqueous | MNKEKLVGMICKERFETLEENHPFFGIKKVPTPYSINL |
| Ga0208150_12288201 | 3300025751 | Aqueous | NVTPNEMSKAKLVGMICKEQLQMLEENHPFFGIKKVLTPYSI |
| Ga0208899_101125312 | 3300025759 | Aqueous | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSFIKAKQR |
| Ga0208899_10794003 | 3300025759 | Aqueous | VGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTK |
| Ga0208644_11357784 | 3300025889 | Aqueous | AKLVGMICKEQLQMLEENHPLFGIKKVLTPYSILTFKTK |
| Ga0228644_100015334 | 3300026453 | Seawater | MSKEKLVGMICKKRLQTLEENPPCCPYSKGIKKVLTPYSFIKTKQR |
| Ga0247587_11822933 | 3300026504 | Seawater | MNKEKLVGMICKERLQTLEEVHPFFGIKKVLTPYSFLTFNTKD |
| Ga0208921_10083623 | 3300027188 | Estuarine | MSKEKLVGMICKERFETLEENHPFFGIKKVLTPYLN |
| Ga0209384_10877933 | 3300027522 | Marine | MMSEEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQRR |
| Ga0208437_10725113 | 3300027525 | Estuarine | KEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYLN |
| Ga0209383_10024487 | 3300027672 | Marine | MMSEEKLVGMICKERLQTLEENHPLFGIKKVLTPYLFKPKQRR |
| Ga0208304_102452993 | 3300027751 | Estuarine | MSKEKLVGMICKERFETLEENHPSFGIKKVLTPYLN |
| (restricted) Ga0255041_100811691 | 3300027837 | Seawater | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLT |
| Ga0256368_10016477 | 3300028125 | Sea-Ice Brine | MNKEKLVGMICKERFETLEENHPFFGIKKVLTPYSFIKII |
| Ga0307488_101825264 | 3300031519 | Sackhole Brine | MSKEKLVGMICKERLQTLEENHPFFGIKKVLTPYLF |
| Ga0307488_106674533 | 3300031519 | Sackhole Brine | MSKEKLVGMICKERLQTLEENHPFFGIKKVLTPYFLKPKQR |
| Ga0307489_108311751 | 3300031569 | Sackhole Brine | MNKEKLVGMICKERFETLEENHPFFGIKKVLTPYSFIKI |
| Ga0308011_101595802 | 3300031688 | Marine | MMSEEKLVGMICKERLQTLEENHPLFGIKKVLTPYLFKPKQIKFN |
| Ga0315315_1000002176 | 3300032073 | Seawater | MSKEKLVGMICKERLQTLEENPPRCPYSKGIKKVLTPYSFIKTKQR |
| Ga0316204_107693541 | 3300032373 | Microbial Mat | MSKAKLVGMICKERLQTLEENHPLFGIKKVLTPYSILN |
| ⦗Top⦘ |