| Basic Information | |
|---|---|
| Family ID | F047275 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LREPVARFTAVYESARFGNSPDDAQRLPELYEEVELATRTR |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.67 % |
| % of genes near scaffold ends (potentially truncated) | 96.67 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| f.5.1.1: Outer membrane efflux proteins (OEP) | d1ek9a_ | 1ek9 | 0.77282 |
| a.216.1.1: I/LWEQ domain | d1r0da_ | 1r0d | 0.75784 |
| a.26.1.2: Short-chain cytokines | d1v7mv_ | 1v7m | 0.75036 |
| a.2.8.1: Eukaryotic DNA topoisomerase I, dispensable insert domain | d1k4ta1 | 1k4t | 0.75017 |
| a.25.1.2: Ribonucleotide reductase-like | d1za0a1 | 1za0 | 0.74425 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 12.67 |
| PF00919 | UPF0004 | 10.67 |
| PF13505 | OMP_b-brl | 8.67 |
| PF04055 | Radical_SAM | 2.67 |
| PF13559 | DUF4129 | 2.67 |
| PF07642 | BBP2 | 2.00 |
| PF00294 | PfkB | 1.33 |
| PF14691 | Fer4_20 | 1.33 |
| PF04608 | PgpA | 1.33 |
| PF03884 | YacG | 1.33 |
| PF04237 | YjbR | 0.67 |
| PF08447 | PAS_3 | 0.67 |
| PF02834 | LigT_PEase | 0.67 |
| PF08244 | Glyco_hydro_32C | 0.67 |
| PF00291 | PALP | 0.67 |
| PF00069 | Pkinase | 0.67 |
| PF00677 | Lum_binding | 0.67 |
| PF01609 | DDE_Tnp_1 | 0.67 |
| PF13620 | CarboxypepD_reg | 0.67 |
| PF00578 | AhpC-TSA | 0.67 |
| PF01493 | GXGXG | 0.67 |
| PF00582 | Usp | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 10.67 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.67 |
| COG1267 | Phosphatidylglycerophosphatase A | Lipid transport and metabolism [I] | 1.33 |
| COG3024 | Endogenous inhibitor of DNA gyrase, YacG/DUF329 family | Replication, recombination and repair [L] | 1.33 |
| COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 0.67 |
| COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG1621 | Sucrose-6-phosphate hydrolase SacC, GH32 family | Carbohydrate transport and metabolism [G] | 0.67 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.67 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10439625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 779 | Open in IMG/M |
| 3300001686|C688J18823_10886911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 566 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10030636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1958 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10054100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1532 | Open in IMG/M |
| 3300004082|Ga0062384_100888373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 629 | Open in IMG/M |
| 3300004091|Ga0062387_100450675 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300004139|Ga0058897_11144441 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300004152|Ga0062386_100094730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2290 | Open in IMG/M |
| 3300004152|Ga0062386_100698073 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005435|Ga0070714_102343778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 519 | Open in IMG/M |
| 3300005529|Ga0070741_10505850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300005542|Ga0070732_10800654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 575 | Open in IMG/M |
| 3300005569|Ga0066705_10738364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 591 | Open in IMG/M |
| 3300005602|Ga0070762_10095889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1709 | Open in IMG/M |
| 3300005602|Ga0070762_11028852 | Not Available | 566 | Open in IMG/M |
| 3300005712|Ga0070764_10145088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300005764|Ga0066903_103755200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 816 | Open in IMG/M |
| 3300005764|Ga0066903_104846875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 715 | Open in IMG/M |
| 3300006050|Ga0075028_100647830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300006162|Ga0075030_100442713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300006173|Ga0070716_100365532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300006176|Ga0070765_100446114 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300006176|Ga0070765_100462378 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300006176|Ga0070765_101228387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300006358|Ga0068871_100886558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300009143|Ga0099792_10088652 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300009522|Ga0116218_1323547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300009683|Ga0116224_10196647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300009700|Ga0116217_10194721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300009759|Ga0116101_1094443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300009764|Ga0116134_1187693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300010048|Ga0126373_11359735 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010398|Ga0126383_13098793 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300011120|Ga0150983_10055539 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300011120|Ga0150983_10162077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300011120|Ga0150983_10528458 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300011120|Ga0150983_12890605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300011120|Ga0150983_13122112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300011120|Ga0150983_14382834 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300011271|Ga0137393_10016507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5286 | Open in IMG/M |
| 3300011271|Ga0137393_11207718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300012201|Ga0137365_10930373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300012683|Ga0137398_10665814 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012929|Ga0137404_10786023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300012955|Ga0164298_10634588 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012988|Ga0164306_11428198 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300013307|Ga0157372_13346316 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300014201|Ga0181537_10071014 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
| 3300014495|Ga0182015_10344172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300014657|Ga0181522_10530615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300016371|Ga0182034_11229772 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300016750|Ga0181505_10792783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300017943|Ga0187819_10408489 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300017948|Ga0187847_10497124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300017959|Ga0187779_10230536 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300017972|Ga0187781_10337472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300017975|Ga0187782_10761726 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300017975|Ga0187782_10823581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300018006|Ga0187804_10479561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 557 | Open in IMG/M |
| 3300018038|Ga0187855_10158432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
| 3300018038|Ga0187855_10565230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300018042|Ga0187871_10039952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2879 | Open in IMG/M |
| 3300018062|Ga0187784_10287599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300018085|Ga0187772_11339603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300018086|Ga0187769_11386440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300018088|Ga0187771_10900631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 750 | Open in IMG/M |
| 3300018090|Ga0187770_11007792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300019278|Ga0187800_1810226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300021168|Ga0210406_11300374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300021171|Ga0210405_10759253 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300021401|Ga0210393_10233361 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300021401|Ga0210393_10283259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300021401|Ga0210393_10605761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300021406|Ga0210386_10182990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1767 | Open in IMG/M |
| 3300021420|Ga0210394_11440368 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300021432|Ga0210384_10898695 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300021433|Ga0210391_10503015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300021475|Ga0210392_10062919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2330 | Open in IMG/M |
| 3300021478|Ga0210402_10437049 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300021479|Ga0210410_11661384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300021560|Ga0126371_11392188 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300022502|Ga0242646_1010881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300022521|Ga0224541_1006205 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300022525|Ga0242656_1025090 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300022528|Ga0242669_1035314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300022532|Ga0242655_10163555 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300022715|Ga0242678_1018242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300022716|Ga0242673_1084960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300022721|Ga0242666_1069490 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300022722|Ga0242657_1115899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300022734|Ga0224571_102537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300023012|Ga0228597_100846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300025604|Ga0207930_1076082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300025929|Ga0207664_10783740 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300025929|Ga0207664_10924352 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300026294|Ga0209839_10005790 | All Organisms → cellular organisms → Bacteria | 5622 | Open in IMG/M |
| 3300026529|Ga0209806_1327274 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027070|Ga0208365_1050304 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300027660|Ga0209736_1023409 | Not Available | 1879 | Open in IMG/M |
| 3300027768|Ga0209772_10179547 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027842|Ga0209580_10156059 | Not Available | 1124 | Open in IMG/M |
| 3300027869|Ga0209579_10107437 | Not Available | 1480 | Open in IMG/M |
| 3300027879|Ga0209169_10121131 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300027879|Ga0209169_10352044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300027905|Ga0209415_10600907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300027908|Ga0209006_10558013 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300028036|Ga0265355_1012704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300028560|Ga0302144_10298799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300028731|Ga0302301_1075022 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300028747|Ga0302219_10417199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300028780|Ga0302225_10027232 | All Organisms → cellular organisms → Bacteria | 2876 | Open in IMG/M |
| 3300028871|Ga0302230_10311253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300028906|Ga0308309_10177475 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300028906|Ga0308309_10405768 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300029908|Ga0311341_10096907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2013 | Open in IMG/M |
| 3300029913|Ga0311362_10100168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3846 | Open in IMG/M |
| 3300029918|Ga0302143_1174712 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300029999|Ga0311339_11502243 | Not Available | 600 | Open in IMG/M |
| 3300030629|Ga0210268_1093342 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300030706|Ga0310039_10176652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300030707|Ga0310038_10167482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300031090|Ga0265760_10255036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300031122|Ga0170822_14730377 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031231|Ga0170824_106372103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031231|Ga0170824_107756495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2741 | Open in IMG/M |
| 3300031231|Ga0170824_128202564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
| 3300031247|Ga0265340_10488271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 542 | Open in IMG/M |
| 3300031258|Ga0302318_10019874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2302 | Open in IMG/M |
| 3300031474|Ga0170818_102952184 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300031525|Ga0302326_12615007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300031708|Ga0310686_100194989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300031715|Ga0307476_10008058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6470 | Open in IMG/M |
| 3300031715|Ga0307476_10996666 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031720|Ga0307469_10745582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300031753|Ga0307477_10585026 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031753|Ga0307477_10984906 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031754|Ga0307475_10759636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300031754|Ga0307475_11130071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300031754|Ga0307475_11313413 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031823|Ga0307478_10847114 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031938|Ga0308175_101276767 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031962|Ga0307479_10969042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300032515|Ga0348332_11179708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300032515|Ga0348332_11788405 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300032515|Ga0348332_12199325 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032828|Ga0335080_12289493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032896|Ga0335075_10613035 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300032954|Ga0335083_10327132 | Not Available | 1336 | Open in IMG/M |
| 3300033134|Ga0335073_10786142 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300034195|Ga0370501_0400744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 502 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.33% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.33% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.67% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.67% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.67% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_104396252 | 3300001593 | Forest Soil | ASKFTEHYESARFGGSAEDAQRLPELYEEILTTAREK* |
| C688J18823_108869112 | 3300001686 | Soil | REPVARFTSVYESARFGNSPGDASRLPELYEEVQAATRDR* |
| JGIcombinedJ51221_100306361 | 3300003505 | Forest Soil | EFVRKIEDNRLRLPVAQFTNVYESARFGNSADDARQLPRLFGEVEAAMRSE* |
| JGIcombinedJ51221_100541003 | 3300003505 | Forest Soil | IEDSRLREPVARFTEVYESARFGNSIDDAQRLPELYEEVELATRTR* |
| Ga0062384_1008883732 | 3300004082 | Bog Forest Soil | RFSVGRFTNAYESARFGNSSDDARRLPELYEEVETAAKK* |
| Ga0062387_1004506751 | 3300004091 | Bog Forest Soil | RTQVGRFTDAYESARFGNSSDDARRLPELYEEVELATRK* |
| Ga0058897_111444412 | 3300004139 | Forest Soil | RVIQNEQLRSRVGRFTDAYESARFGNSADDALLLPELFEEVESATKK* |
| Ga0062386_1000947301 | 3300004152 | Bog Forest Soil | DSRLREPVARFTQVYESARFGNSIDDAQRLPELYEEVEMATRAR* |
| Ga0062386_1006980731 | 3300004152 | Bog Forest Soil | DSRLREPVARFTQVYESARFGNSADDALRLPGLYQEVESAARAR* |
| Ga0070714_1023437781 | 3300005435 | Agricultural Soil | QRLREPVARFTAVYESARFGNSGEDAQRLPELYEEVEAATRSE* |
| Ga0070741_105058501 | 3300005529 | Surface Soil | VAAFTNSYEQARFADSPDDARQLPELYEQISSAPKS* |
| Ga0070732_108006541 | 3300005542 | Surface Soil | PVARFTEVYESARFGNSIEDAQRLPELFAEVELATRTR* |
| Ga0066705_107383642 | 3300005569 | Soil | EFLKKIPDNQLREPVARFTEVYESARFGNSIEDAQRLPELFEEVEIASRSH* |
| Ga0070762_100958893 | 3300005602 | Soil | QEFVRAIRDEPLRLRVGQFTDAYESARFGNSSEDAVRLPELLEEVESATRK* |
| Ga0070762_110288521 | 3300005602 | Soil | VARFTNAYEAARFGSSPDHARQLPELYEEVELAAKN* |
| Ga0070764_101450882 | 3300005712 | Soil | VARFTNAYEAARFGSSPDHARQLPELYEEVQLAAKN* |
| Ga0066903_1037552002 | 3300005764 | Tropical Forest Soil | EFVARIDDAALRQRAARFTRVYEAARFGNSSEEAARLPELYDELANMR* |
| Ga0066903_1048468751 | 3300005764 | Tropical Forest Soil | RLREPIARFTQVYESARFGNSAEDAQRLPELYGEVELATRFE* |
| Ga0075028_1006478302 | 3300006050 | Watersheds | EPVARFTQVYESARFGNSSEDAQRLPELCEEVELAAKK* |
| Ga0075030_1004427131 | 3300006162 | Watersheds | DRLREPVARFTNAYEAARFGDSAEDVKRLPELFEEVESATRTR* |
| Ga0070716_1003655321 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AEFTRNYESARFGNSAEAAQYLPELYEEVLSATPSR* |
| Ga0070765_1004461141 | 3300006176 | Soil | GLRAQVGRFTDAYESARFGNSADDALRLPQLYEEMESAGRLR* |
| Ga0070765_1004623781 | 3300006176 | Soil | ERLRTKVGQFTDAYESARFGNSGDDARRLPELFEEVESATKK* |
| Ga0070765_1012283871 | 3300006176 | Soil | DNRLREPVARFTDVYESARFGNSVADAQRLAELYAEVESATRGR* |
| Ga0068871_1008865583 | 3300006358 | Miscanthus Rhizosphere | LRDRVSDFTNAYEAARFGESPDHAQRLPELYEEIVAVETRD* |
| Ga0099792_100886523 | 3300009143 | Vadose Zone Soil | AQEFVGVIEDVRLRTQVGKFTDAYESARFGNSPDDAVRLPELYEAVEAATRK* |
| Ga0116218_13235471 | 3300009522 | Peatlands Soil | QEFVKKIEDSRLREPVARFTAVYESARFGNSVDDAQRLPELYEEVESAARTR* |
| Ga0116224_101966473 | 3300009683 | Peatlands Soil | RFTAVYESARFGNSVDDAQRLPELYEEVETATRAR* |
| Ga0116217_101947213 | 3300009700 | Peatlands Soil | TAQEFVRVIGDERIRIPVGRFTDAYESARFGNSPDDAQRLPELYEEVELATRK* |
| Ga0116101_10944432 | 3300009759 | Peatland | IPDNDLRIPIEKFTDAYESARFGNSAENAQRLPELFEEVELVSKK* |
| Ga0116134_11876932 | 3300009764 | Peatland | DERLRTPVGRFTDAYESARFGNSSEDAMRLPELYEDVQLATKK* |
| Ga0126373_113597352 | 3300010048 | Tropical Forest Soil | QEFLKKIDDDRLREPIARFTRVYESARFGNSANDAQRLPALYEAVELATRME* |
| Ga0126383_130987932 | 3300010398 | Tropical Forest Soil | EPVARFTQVYESARFGNSAEDAQRLPELYQKVELATRFE* |
| Ga0150983_100555392 | 3300011120 | Forest Soil | RVGRFTDAYESARFGNSPDDALRLPELFEEVELASKK* |
| Ga0150983_101620771 | 3300011120 | Forest Soil | ARFTDAYESARFGDSAEDVKRLPELYEEVESATRTR* |
| Ga0150983_105284582 | 3300011120 | Forest Soil | VEKIDNATLREPVARFTRVYESARFGNSTDDAQRLPELCEEVEVASKK* |
| Ga0150983_128906051 | 3300011120 | Forest Soil | RFTAVYESARFGNCAEDAQRLPELYEEVELATRTR* |
| Ga0150983_131221121 | 3300011120 | Forest Soil | PVARFTQVYESARFGDSADDAKRLPALYEEVEQATRTR* |
| Ga0150983_143828341 | 3300011120 | Forest Soil | GRFTNAYESARFGNSAEDAQRLPGLYEEVETATRK* |
| Ga0137393_100165077 | 3300011271 | Vadose Zone Soil | EDERLRIQVARFTDAYESARFGNSPDDALRLPDLYEEVEGATKK* |
| Ga0137393_112077181 | 3300011271 | Vadose Zone Soil | KIEDSRLREPVARFTAVYESARFGNSPDDAQRLPELYEEVELATRSR* |
| Ga0137365_109303731 | 3300012201 | Vadose Zone Soil | RIEDTRLREPVARFTTVYESARFGNSPEDAQRLPELYEEVESATRTR* |
| Ga0137398_106658143 | 3300012683 | Vadose Zone Soil | ADERLRERVATFTEAYESARFGNSVDDAERLPELYEEVELASRR* |
| Ga0137404_107860231 | 3300012929 | Vadose Zone Soil | EPVARFTVVYESARFGNSADDAQRLPELYEEVELATRRR* |
| Ga0164298_106345881 | 3300012955 | Soil | EFVQKIEDDRLRVPVARFTDVYESARFGNSAEDALRLPDLYEEVEAAMQSD* |
| Ga0164306_114281981 | 3300012988 | Soil | DQRLRQPVARFTAVYESARFGNSVEDASRLPELYAEVAAATRDR* |
| Ga0157372_133463162 | 3300013307 | Corn Rhizosphere | QDPVARFTRVYESARFGNSVEDASRLPELYAEVAAATRDR* |
| Ga0181537_100710141 | 3300014201 | Bog | LRTRVGEFTDAYESARFGNSADDALRLPELYGEVELATKK* |
| Ga0182015_103441721 | 3300014495 | Palsa | EFVGVIEDERLRTQVERFTVAYESARFGNSAEDALRLPELYGEVELATKK* |
| Ga0181522_105306152 | 3300014657 | Bog | ERLRLRVGRFTDAYESARFGNSSNDAQRLPELYEEVELASKK* |
| Ga0182034_112297722 | 3300016371 | Soil | SEAETPQEFVCKIPHIRLRLPVEHFTNVYESARFGNSSQDAGRLPELYEEVEAATRSE |
| Ga0181505_107927832 | 3300016750 | Peatland | PVARFTQVYESARFGNSIDDAQRLPELYEEVELATRTR |
| Ga0187819_104084892 | 3300017943 | Freshwater Sediment | AKFTQHYESARFGGSAEDAQRLPELYEEVLATVRR |
| Ga0187847_104971241 | 3300017948 | Peatland | RVGRFTDAYESARFGNSSNDAQRLPELYEEVESAVQK |
| Ga0187779_102305362 | 3300017959 | Tropical Peatland | KIQDRRLREPVSRFTDVYESARFGNSVEDAQRLPELYEEVEAATRSE |
| Ga0187781_103374722 | 3300017972 | Tropical Peatland | VARFTDAYEVARFGNSADDALRLPELYEAVELAMKE |
| Ga0187782_107617261 | 3300017975 | Tropical Peatland | ISDEQLRSRVGNFTDAYEAARFGNSPRQAQQLPRLYEEVALAARK |
| Ga0187782_108235811 | 3300017975 | Tropical Peatland | KIDNTHLREPVERFTEVYESARFGNSAEAAQRLPELYEEVVSAARER |
| Ga0187804_104795611 | 3300018006 | Freshwater Sediment | QEFVKKIEDSRLREPVARFTQVYESARFGNSAEDVKRLPELYEEVETAARTR |
| Ga0187855_101584321 | 3300018038 | Peatland | KIEDTRLREPVSRFTDVYESARFGNSAEDAQRLPELYEEVELAAKGR |
| Ga0187855_105652301 | 3300018038 | Peatland | EFVRVITDERLRGRVERFTDAYESARFGNSTEDALRLPELCEEVELATRK |
| Ga0187871_100399521 | 3300018042 | Peatland | RGRVERFTDAYESARFGNSTEDALRLPELCEEVELATRK |
| Ga0187784_102875993 | 3300018062 | Tropical Peatland | DDARLRGPVAHFTEVYESARFGNSPEDVQRLPELYEAVESATRD |
| Ga0187772_113396031 | 3300018085 | Tropical Peatland | SQINDARLRIPVAHFTEVYESARFGNSPEHVRQLPELYEAVELAIKE |
| Ga0187769_113864402 | 3300018086 | Tropical Peatland | EPVARFTRVYESARFGNSAEDAQRLPQLCEEVELATRKR |
| Ga0187771_109006312 | 3300018088 | Tropical Peatland | FVRNIEDARLRAPVARFTQVYESARFGNSADDALKLPELCEEVESATRA |
| Ga0187770_110077922 | 3300018090 | Tropical Peatland | QRIEDARLREPVARFTDAYEAARFGESADEIRRLPELYEDVELAARK |
| Ga0187800_18102261 | 3300019278 | Peatland | PRLREPVARFTEVYESARFGNSAEAVQCLPELYKQIELATREG |
| Ga0210406_113003741 | 3300021168 | Soil | SRLREPVARFTAVYESARFGNSVDDAQRLPELYEEVESATRSR |
| Ga0210405_107592531 | 3300021171 | Soil | GEFTDAYESARFGNSSEDAVRLPELYEEVELATKK |
| Ga0210393_102333611 | 3300021401 | Soil | RLRTPVRRFTDAYESARFGNSSDDALRLPELFEEVELATKK |
| Ga0210393_102832591 | 3300021401 | Soil | VARFTAVYESARFGNSVDDAQRLPELYEEVESATRSR |
| Ga0210393_106057612 | 3300021401 | Soil | KIEDTRLREPVARFTQVYESARFGNSLDDAQRLPELYEEVELATRNR |
| Ga0210386_101829901 | 3300021406 | Soil | QEFVKKIEDSRLREPVARFTEVYESARFGNSIDDAQRLPELYEEVELATRTR |
| Ga0210394_114403682 | 3300021420 | Soil | TQVERFTEAYESARFGNSAEDALRLPELYQEVELATKK |
| Ga0210384_108986952 | 3300021432 | Soil | VIEDERLRTKVGQFTEAYESARFGNSGDDAQRLPALFEEVESATKQ |
| Ga0210391_105030152 | 3300021433 | Soil | VHQFTEAYESARFGQSQEDVQRLPELYEEVELATRK |
| Ga0210392_100629191 | 3300021475 | Soil | FVEKIEDKSLREPVARFTAVYESARFGNSADDAQRLPELYEEVELATRFR |
| Ga0210402_104370491 | 3300021478 | Soil | VARFTYVYESARFGNSTEDAQRLPDLFEEVELASKK |
| Ga0210410_116613842 | 3300021479 | Soil | QRVAQFTAAYESARFGNSTDDARRLSELYEEVESETQR |
| Ga0126371_113921882 | 3300021560 | Tropical Forest Soil | LKKIDDDRLREPIARFTQIYESARFGNSAEDAQRLPELYEEVELATRFE |
| Ga0242646_10108812 | 3300022502 | Soil | EDTRLREPVARFTQVYESARFGNSLDDAQRLPELYEEVELATRNR |
| Ga0224541_10062052 | 3300022521 | Soil | RLRKRVSRFTDAYESARFGNSADDAVQLPELYDDVEAAAKK |
| Ga0242656_10250901 | 3300022525 | Soil | KIEDNRLRLLVTQFTSVYESARFGNSADDARQLPRLFGEVEAAMRSE |
| Ga0242669_10353141 | 3300022528 | Soil | KKIEDSRLREPVARFTEVYESARFGNSIDDAQRLPELYEEVELATRTR |
| Ga0242655_101635552 | 3300022532 | Soil | VRVIQNEQLRSRVGRFTDAYESARFGNSADDALLLPELFEEVESATKK |
| Ga0242678_10182421 | 3300022715 | Soil | SRLREPVARFTEVYESARFGNSIDDAQRLPELYEEVELATRTR |
| Ga0242673_10849602 | 3300022716 | Soil | VQKIEDTRLREPVARFTQVYESARFGNSLDDAQRLPELYEEVELATRNQ |
| Ga0242666_10694901 | 3300022721 | Soil | ARVGRFTDAYESARFGNSPDDALRLPELFEEVELGSKK |
| Ga0242657_11158991 | 3300022722 | Soil | ARFTAVYESARFGNSVDDAQRLPELYEEVESAARSR |
| Ga0224571_1025373 | 3300022734 | Rhizosphere | ERLRTRVGRFTDAYESARFGNSSDDAQRLPELYEDVELATKK |
| Ga0228597_1008463 | 3300023012 | Plant Litter | EPVARFTQVYESARFGDSADDAKRLPELYEEVEQATRTR |
| Ga0207930_10760821 | 3300025604 | Arctic Peat Soil | ARFTEAYEAARFGDSAEDVKRLPELYEEVESATRTR |
| Ga0207664_107837402 | 3300025929 | Agricultural Soil | RLRQPVARFTEVYESARFGNSVEDASRLPELYAEVAAATRDR |
| Ga0207664_109243522 | 3300025929 | Agricultural Soil | RFTEVYESARFGNSVEDASRLPELYAEVAAATRDR |
| Ga0209839_100057906 | 3300026294 | Soil | PQEFVKKIEDNRLREPVARFTDVYESARFGNSVEDAQRLAELYEEVESATRGR |
| Ga0209806_13272742 | 3300026529 | Soil | IEDNRLRLLVTQFTSVYESARFGNSADDARELPRLFGEVEAAMRSE |
| Ga0208365_10503041 | 3300027070 | Forest Soil | KIEDNRLRLPVAQFTNVYESARFGNSADDARQLPRLFGEVEAAMRSE |
| Ga0209736_10234091 | 3300027660 | Forest Soil | EPVARFTQVYESARFGNSVDDALRLPELYEEVESATRSR |
| Ga0209772_101795472 | 3300027768 | Bog Forest Soil | VGRFTDAYESARFGNSSDGALRLPELYEEVELAAKK |
| Ga0209580_101560591 | 3300027842 | Surface Soil | RVKVERFTEAYESARFGNSSPDAQRLPELYDQVELTTKQ |
| Ga0209579_101074371 | 3300027869 | Surface Soil | QIEDTRLRQPVARFTDVYESARFGNCAEDARRLGDLYQEVEAATRDR |
| Ga0209169_101211311 | 3300027879 | Soil | EGLRAQVGRFTDAYESARFGNSADDALRLPQLYEEMESAGRLR |
| Ga0209169_103520441 | 3300027879 | Soil | QEFVKNIEDARLRAPVARFTDVYESARFGNSTDDAQKLPELFEEVEVAAREK |
| Ga0209415_106009072 | 3300027905 | Peatlands Soil | QEFVKKIDDPRLREPVARFTNVYESARFGNSAQDVQRLPELYEEVELATRK |
| Ga0209006_105580132 | 3300027908 | Forest Soil | RLREPVARFTQVYESARFGNSAEDVQRLPELYEEVESATRTR |
| Ga0265355_10127041 | 3300028036 | Rhizosphere | ERLRVRVGRFTDAYESARFGNSSNDAQRLPELYDEVELASKK |
| Ga0302144_102987992 | 3300028560 | Bog | VSRFTDAYESARFGNSADDAMQLPELYEEVEAAAKK |
| Ga0302301_10750222 | 3300028731 | Palsa | VSRFTDAYESARFGNSADDAVQLPELYDDVEAAAKK |
| Ga0302219_104171992 | 3300028747 | Palsa | GKFTDAYESARFGNSSDDARRLPELYEEVELAAKK |
| Ga0302225_100272324 | 3300028780 | Palsa | ERLRKRVSRFTDAYESARFGNSADDAVQLPELYDDVEAAAKK |
| Ga0302230_103112531 | 3300028871 | Palsa | PVARFTEVYESARFGDSADDVKRLPELYEEVEQATRTR |
| Ga0308309_101774751 | 3300028906 | Soil | GLRAQVGRFTDAYESARFGNSADDALRLPQLYEEMESAGRLR |
| Ga0308309_104057681 | 3300028906 | Soil | RVGQFTDAYESARFGNSSEDAVRLPELLEEVESATRK |
| Ga0311341_100969071 | 3300029908 | Bog | IADEPLRARVGRFTNAYESARFGDSSEEARRLPELFEEVEMATKK |
| Ga0311362_101001681 | 3300029913 | Bog | RVGRFTNAYESARFGDSSEEARRLPELFEEVEMATKK |
| Ga0302143_11747122 | 3300029918 | Bog | QEFVRVIEDDRLRAPVGRFTDAYESARFGNSSDDALRLPELYEEVELAAKK |
| Ga0311339_115022432 | 3300029999 | Palsa | SLRQRVERFTVVYESARFGHSAEDAGKLEECFDEVELAARR |
| Ga0210268_10933421 | 3300030629 | Soil | HTRVGQFTDAYESARFGNSSEDAVRLPELLEAVESATKK |
| Ga0310039_101766521 | 3300030706 | Peatlands Soil | RFTQVYESARFGNSIDDAQRLPELYEEVEMATRTR |
| Ga0310038_101674821 | 3300030707 | Peatlands Soil | DERIRIPVGRFTDAYESARFGNSPDDAQRLPELYEEVELATRK |
| Ga0265760_102550361 | 3300031090 | Soil | EQVARFTQVYESARFGNSAEDVKRLPELYEEVETAARGR |
| Ga0170822_147303772 | 3300031122 | Forest Soil | RNRVEAFTEAYESARFGDSPDDARRLPELYGEVEAANKK |
| Ga0170824_1063721032 | 3300031231 | Forest Soil | VKKIEDTRLREPVARFTQVYESARFGNSVDDAQRLPELYEEVESATRSR |
| Ga0170824_1077564951 | 3300031231 | Forest Soil | IEDARLREPVARFTQVYESARFGNSVDDAQRLPELYEEVELATKTR |
| Ga0170824_1282025642 | 3300031231 | Forest Soil | ERFTSAYESARFGNSANDALRLPELYEEVEAAGKK |
| Ga0265340_104882711 | 3300031247 | Rhizosphere | EPVTRFTEIYESARFGNSPDDAKRLPELYEAVETATRPQK |
| Ga0302318_100198744 | 3300031258 | Bog | LRARVGRFTNAYESARFGDSSEEARRLPELFEEVEMATKK |
| Ga0170818_1029521842 | 3300031474 | Forest Soil | QEFVRKIEDNRLRLLVTQFTSVYESARFGNSAEDACQLPRLFGEVEAAMRSE |
| Ga0302326_126150071 | 3300031525 | Palsa | DEQLRKLVGRFTDAYESARFGNSSDDARRLPELYEEVELVAKK |
| Ga0310686_1001949893 | 3300031708 | Soil | RLPVARFTDVYESARFGNSADDAQKLPELFEEVELATRER |
| Ga0307476_100080581 | 3300031715 | Hardwood Forest Soil | RFTAVYESARFGNSPDDAQRLPELYEEVELATRTR |
| Ga0307476_109966661 | 3300031715 | Hardwood Forest Soil | QEFARQIDDARLRQPVARFTDVYESARFGNSSEDARRLEELYQEVEAATRDR |
| Ga0307469_107455821 | 3300031720 | Hardwood Forest Soil | EDGRLRTQVARFTEAYESARFGNSPEDALRLPELYEEVEASIRR |
| Ga0307477_105850261 | 3300031753 | Hardwood Forest Soil | VEQFTNVYESARFGNSAEDARQLPRLFGEVEAAMRSE |
| Ga0307477_109849061 | 3300031753 | Hardwood Forest Soil | EDQRLRTRVGRFTDAYESARFGNSADDALRLPELFEQVELATKK |
| Ga0307475_107596361 | 3300031754 | Hardwood Forest Soil | LREPVARFTAVYESARFGNSPDDAQRLPELYEEVELATRTR |
| Ga0307475_111300711 | 3300031754 | Hardwood Forest Soil | AHFTDVYESARFGNSAEDARRLPELYEVVESATKG |
| Ga0307475_113134132 | 3300031754 | Hardwood Forest Soil | RVIPEETLRVRVQQFTEAYESARFGQSQEDVQRLPELFAGVELATRK |
| Ga0307478_108471141 | 3300031823 | Hardwood Forest Soil | GDERLRLRVGRFTDAYESARFGNSSNDAQRLPELYEEVELASKK |
| Ga0308175_1012767672 | 3300031938 | Soil | VARFTSVYESARFGNSPGDASRLPELYEEVQAATRDR |
| Ga0307479_109690421 | 3300031962 | Hardwood Forest Soil | SLRARVESFTAAYESARFGNSADDALRLPELYEEVELASRK |
| Ga0348332_111797082 | 3300032515 | Plant Litter | QQFTEAYESARFGQSQEDVRRLPELYEEVELATKK |
| Ga0348332_117884052 | 3300032515 | Plant Litter | LRARVGRFTDAYESARFGNSPDDALRLPELFEEVELGSKK |
| Ga0348332_121993252 | 3300032515 | Plant Litter | VHRIEDVRLRLRVEEFTKAYESARFGNSSQDALRLSELFEEVELATRK |
| Ga0335080_122894932 | 3300032828 | Soil | LRVPVGLFTEVYESARFGNSAEDVQRLPELYEAVELAARE |
| Ga0335075_106130351 | 3300032896 | Soil | PLRRFTSTYESARFGNSSEAAKRLPELLEEVETATK |
| Ga0335083_103271322 | 3300032954 | Soil | VARFTDVYESARFGNSREDARRLPELYEEVLTATRSD |
| Ga0335073_107861422 | 3300033134 | Soil | RLREPVARFTDVYESARFGNSAEDARRLPDLYEEVLTATRSG |
| Ga0370501_0400744_29_157 | 3300034195 | Untreated Peat Soil | LLEPVTRFTEIYESARFGNSPDDAKRLPELYEAVETATRPQK |
| ⦗Top⦘ |