NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047271

Metagenome / Metatranscriptome Family F047271

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047271
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 40 residues
Representative Sequence ERSHQIANDLATKAIAELAPYGDRAARLREIAEFLVLRRA
Number of Associated Samples 121
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(26.000 % of family members)
Environment Ontology (ENVO) Unclassified
(28.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.88%    β-sheet: 0.00%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF01728FtsJ 84.00
PF01513NAD_kinase 9.33
PF02784Orn_Arg_deC_N 1.33
PF00278Orn_DAP_Arg_deC 1.33
PF13564DoxX_2 0.67
PF01479S4 0.67
PF13537GATase_7 0.67
PF01887SAM_HAT_N 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 84.00
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 84.00
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 2.67
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 2.67
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.67 %
UnclassifiedrootN/A1.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002560|JGI25383J37093_10076105All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300002561|JGI25384J37096_10174038All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300004635|Ga0062388_100299954All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300005166|Ga0066674_10198694All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300005332|Ga0066388_103178854All Organisms → cellular organisms → Bacteria → Proteobacteria839Open in IMG/M
3300005439|Ga0070711_100827278All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria787Open in IMG/M
3300005445|Ga0070708_101598479All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005557|Ga0066704_10081058All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300005559|Ga0066700_11040867All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005559|Ga0066700_11102349All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005610|Ga0070763_10659969All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300005764|Ga0066903_100469583All Organisms → cellular organisms → Bacteria2114Open in IMG/M
3300005995|Ga0066790_10210468All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300006173|Ga0070716_100414500All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300006174|Ga0075014_100389300All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300006794|Ga0066658_10145627All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300006794|Ga0066658_10558575All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006806|Ga0079220_11817879All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300006854|Ga0075425_100896434All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300006854|Ga0075425_101597585All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300007265|Ga0099794_10555260All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300009012|Ga0066710_101248344All Organisms → cellular organisms → Bacteria → Acidobacteria1152Open in IMG/M
3300009088|Ga0099830_10556043All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300009088|Ga0099830_10690036All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300009088|Ga0099830_11310465All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300009090|Ga0099827_11651678All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300009137|Ga0066709_103365593All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300010046|Ga0126384_10099414All Organisms → cellular organisms → Bacteria → Acidobacteria2142Open in IMG/M
3300010046|Ga0126384_11657882All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300010047|Ga0126382_12234030All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300010048|Ga0126373_10340195All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300010048|Ga0126373_10867428All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300010320|Ga0134109_10093738All Organisms → cellular organisms → Bacteria → Acidobacteria1039Open in IMG/M
3300010325|Ga0134064_10116465All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300010325|Ga0134064_10126262All Organisms → cellular organisms → Bacteria → Acidobacteria865Open in IMG/M
3300010336|Ga0134071_10100741All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300010358|Ga0126370_10868885All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300010359|Ga0126376_11012184All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300010360|Ga0126372_10134000All Organisms → cellular organisms → Bacteria → Acidobacteria1944Open in IMG/M
3300010360|Ga0126372_11769949All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300010364|Ga0134066_10308155All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300010398|Ga0126383_10437418All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300010398|Ga0126383_11551043All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300010398|Ga0126383_12624803All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300011271|Ga0137393_11431497All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300012096|Ga0137389_10611860All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300012189|Ga0137388_10124184All Organisms → cellular organisms → Bacteria2252Open in IMG/M
3300012189|Ga0137388_10457398All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300012202|Ga0137363_11591601All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300012208|Ga0137376_10969043All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300012209|Ga0137379_10230251All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300012210|Ga0137378_10323779All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300012211|Ga0137377_10580498All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300012356|Ga0137371_10100399All Organisms → cellular organisms → Bacteria2254Open in IMG/M
3300012357|Ga0137384_11188935All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300012361|Ga0137360_10364496All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300012582|Ga0137358_10689128All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300012683|Ga0137398_10011731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4464Open in IMG/M
3300012685|Ga0137397_10720236All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300012685|Ga0137397_10971522All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300012923|Ga0137359_10668269All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300012924|Ga0137413_10810580All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300012925|Ga0137419_10824422All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300012927|Ga0137416_10694266All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300012929|Ga0137404_11406627All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300012975|Ga0134110_10054292All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300015052|Ga0137411_1327622All Organisms → cellular organisms → Bacteria → Acidobacteria1696Open in IMG/M
3300015053|Ga0137405_1026289All Organisms → cellular organisms → Bacteria → Acidobacteria1066Open in IMG/M
3300015053|Ga0137405_1300786All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300015053|Ga0137405_1305511All Organisms → cellular organisms → Bacteria4012Open in IMG/M
3300015053|Ga0137405_1409143All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300015193|Ga0167668_1015277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1724Open in IMG/M
3300015264|Ga0137403_11305804All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300015356|Ga0134073_10154836All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300016270|Ga0182036_10090222All Organisms → cellular organisms → Bacteria → Acidobacteria2055Open in IMG/M
3300016387|Ga0182040_10936542All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300016387|Ga0182040_11329634All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300016445|Ga0182038_10998172All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300017955|Ga0187817_10676092All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300018057|Ga0187858_10415266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300018062|Ga0187784_11532218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes528Open in IMG/M
3300018064|Ga0187773_10153863All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300020150|Ga0187768_1059191All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300020579|Ga0210407_10062646All Organisms → cellular organisms → Bacteria2786Open in IMG/M
3300020579|Ga0210407_10456335All Organisms → cellular organisms → Bacteria → Acidobacteria999Open in IMG/M
3300020580|Ga0210403_10328909All Organisms → cellular organisms → Bacteria → Acidobacteria1251Open in IMG/M
3300020580|Ga0210403_10577608All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300021168|Ga0210406_10837383All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300021170|Ga0210400_10498348All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300021170|Ga0210400_10750649All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300021170|Ga0210400_10926949All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300021404|Ga0210389_11335806All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300021405|Ga0210387_11756865All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300021420|Ga0210394_11030632All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300021432|Ga0210384_10466865All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300021432|Ga0210384_11706333All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300021476|Ga0187846_10088239All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300021478|Ga0210402_10309912All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300021478|Ga0210402_10356840All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300021479|Ga0210410_11790689All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300022563|Ga0212128_10346190All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300024179|Ga0247695_1043819All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300024284|Ga0247671_1068800All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300024325|Ga0247678_1009092All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300024330|Ga0137417_1281857All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300025922|Ga0207646_10625022All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300025939|Ga0207665_10439670All Organisms → cellular organisms → Bacteria → Acidobacteria999Open in IMG/M
3300025939|Ga0207665_10608588All Organisms → cellular organisms → Bacteria → Acidobacteria854Open in IMG/M
3300026314|Ga0209268_1002523All Organisms → cellular organisms → Bacteria → Acidobacteria8677Open in IMG/M
3300026318|Ga0209471_1257512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300026325|Ga0209152_10079728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1202Open in IMG/M
3300026328|Ga0209802_1156404All Organisms → cellular organisms → Bacteria → Acidobacteria953Open in IMG/M
3300026374|Ga0257146_1036595All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300026557|Ga0179587_10526751All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300027014|Ga0207815_1020867Not Available810Open in IMG/M
3300027330|Ga0207777_1094632All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300027671|Ga0209588_1145407All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300027857|Ga0209166_10382628All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300027862|Ga0209701_10135460All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300027867|Ga0209167_10717407All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300027894|Ga0209068_10290681Not Available916Open in IMG/M
3300028047|Ga0209526_10278338All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300028047|Ga0209526_10433698All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300028536|Ga0137415_10085550All Organisms → cellular organisms → Bacteria3011Open in IMG/M
3300028536|Ga0137415_10292515All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300028536|Ga0137415_11343219All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300029636|Ga0222749_10001508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11816Open in IMG/M
3300030991|Ga0073994_12296777All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300031236|Ga0302324_100579479All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300031545|Ga0318541_10464392All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300031561|Ga0318528_10465489All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300031572|Ga0318515_10600179All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300031718|Ga0307474_10107851All Organisms → cellular organisms → Bacteria2085Open in IMG/M
3300031820|Ga0307473_10756735All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300031821|Ga0318567_10346404All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031890|Ga0306925_10874244All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300031947|Ga0310909_10062724All Organisms → cellular organisms → Bacteria2894Open in IMG/M
3300031954|Ga0306926_10979622All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300031962|Ga0307479_11471741All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300031962|Ga0307479_11730899All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300032042|Ga0318545_10105356All Organisms → cellular organisms → Bacteria → Acidobacteria989Open in IMG/M
3300032089|Ga0318525_10702214All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300032180|Ga0307471_100050796All Organisms → cellular organisms → Bacteria3419Open in IMG/M
3300032180|Ga0307471_102271158All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300032205|Ga0307472_100433644All Organisms → cellular organisms → Bacteria → Acidobacteria1111Open in IMG/M
3300032782|Ga0335082_11670719All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300032828|Ga0335080_10306574All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300032829|Ga0335070_11492097All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300033412|Ga0310810_10345357All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300033983|Ga0371488_0297443All Organisms → cellular organisms → Bacteria774Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil26.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.67%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.67%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.67%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25383J37093_1007610523300002560Grasslands SoilVYGLERSHQIANDLATKAIAELAPYADRAARLREIAEFLVLRRA*
JGI25384J37096_1017403823300002561Grasslands SoilGLERSHQIAQELASRATGELEPYGXRASRLXXIAEYLVLRRA*
Ga0062388_10029995413300004635Bog Forest SoilLPRSHEIANELANKAIAALEPYAERAGRLREIAEFLVLRRA*
Ga0066674_1019869413300005166SoilLERSHQIANELATKAIAELSPYADRASRLRQIAEFLVLRRT*
Ga0066388_10317885413300005332Tropical Forest SoilLERSHQIANDLAAKAIAELAPYADRASRLREIAEFLVLRRA*
Ga0070711_10082727823300005439Corn, Switchgrass And Miscanthus RhizosphereGLERSHQIANDLASQAIADLAPYADRAARLRQIANFLIRRRA*
Ga0070708_10159847913300005445Corn, Switchgrass And Miscanthus RhizosphereRSHEIANDLAGKAIAELAPYGDAASRLREIAEYLVIRRT*
Ga0066704_1008105843300005557SoilERSHQIANDLATKAIAELAPYLDRAVRLHEIAEFLVLRRA*
Ga0066700_1104086713300005559SoilYPSVFGLERSHQIAKELSEKAIAELDTYGAKASRLREIAEFLVHRRT*
Ga0066700_1110234923300005559SoilERSHQIAKELSEKAIAELEPYGVKASRLREIAEFLVYRRA*
Ga0070763_1065996913300005610SoilAKELAGKALGELAVYGERAARLRELAEFLVLRRA*
Ga0066903_10046958343300005764Tropical Forest SoilGLERSHQIANDLSAQAISDLDHFAGRAERLRQIAHFLLHRRI*
Ga0066790_1021046823300005995SoilSHEIATDLANKAIAALEPYGERGARLREIAEFLVLRRT*
Ga0070716_10041450013300006173Corn, Switchgrass And Miscanthus RhizosphereGLERSHQIANDLASQAIADLAPYADRAARLRQIANFLIHRRA*
Ga0075014_10038930023300006174WatershedsLEKSHEIAKDLATKAIDELQPYGKRAERLRAIAEFLVLRRT*
Ga0066658_1014562713300006794SoilKSHQMATELATRAIKELEPYGERAQRLRELAEFLVLRRA*
Ga0066658_1055857513300006794SoilIANELATKAIAELAPYGERAARLREIAEFLVLRRT*
Ga0079220_1181787913300006806Agricultural SoilRSHQIANELATKAIAELAPYAERAARLQEIGEFLVLRRA*
Ga0075425_10089643413300006854Populus RhizosphereSHEIARELATKAIDELSPYAERAARLREIAEYLVLRRT*
Ga0075425_10159758523300006854Populus RhizosphereLEKSHEIAKELATKAIDELQPYGERAERLRSIAEFLVLRRA*
Ga0099794_1055526013300007265Vadose Zone SoilQIANDLATKAIAELAPYTSRAARLREIAEFLVLRRA*
Ga0066710_10124834423300009012Grasslands SoilLERSHQIASELATKAIAELSPYAARAARLREIAEFLVLRRT
Ga0099830_1055604323300009088Vadose Zone SoilLPRSHEIANDLAGKAIAELAPYHEGASRLREIAEYLVIRRT*
Ga0099830_1069003613300009088Vadose Zone SoilIANDLAGKAIAELAPYREGASRLREIAEYLVIRRT*
Ga0099830_1131046513300009088Vadose Zone SoilIANELASKAIAELEPYGEKASRLREIAEYLVIRRA*
Ga0099827_1165167823300009090Vadose Zone SoilANDLAGKAIAELAPNREGASRLREIAEYLVIRRA*
Ga0066709_10336559313300009137Grasslands SoilIAREHATKAISELSPYAERAARLREIAEYLVLRRT*
Ga0126384_1009941413300010046Tropical Forest SoilHQIANDLSAQAIADLDHYAGRADRLRQIAHFLLHRRA*
Ga0126384_1165788213300010046Tropical Forest SoilSHQIANELATKAITELSPYDDRAARLREIAEFLVLRRA*
Ga0126382_1223403013300010047Tropical Forest SoilIANDLSAQAISDLDRYAGRADRLRQIARFLLHRRT*
Ga0126373_1034019513300010048Tropical Forest SoilHQIAKELAGRGISELTAYGERADRLRAIAEFLVHRRK*
Ga0126373_1086742823300010048Tropical Forest SoilSHEIASELARRAIAELAPYGERAARLRDIAEYLVLRRT*
Ga0134109_1009373833300010320Grasslands SoilERSHQIAKDLATKAIAELAPFSDRAARLREIAEFLVLRRA*
Ga0134064_1011646513300010325Grasslands SoilERSHQIANDLATKAIAELAPYLDRAVRLREIAEFLVLRRA*
Ga0134064_1012626213300010325Grasslands SoilLERSHQIANDLATKAIAELAPYTSRAARLREIAEFLVLRRA*
Ga0134071_1010074133300010336Grasslands SoilANELSSKAIADLASYGARAARLREIAEFLVHRRT*
Ga0126370_1086888523300010358Tropical Forest SoilYGLERSHQIARELATKAIDELSPYAERTARLREIAEYLVLRRT*
Ga0126376_1101218423300010359Tropical Forest SoilSHEIANELATRAIAELAPYGERASRLRDIAEYLVLRRT*
Ga0126372_1013400013300010360Tropical Forest SoilIANELATKAIAELSPLGDRAARLREIAEFLVLRRT*
Ga0126372_1176994923300010360Tropical Forest SoilQRSHEIAQELATRAIGELVPYDERAERLRQIAEYLIIRRA*
Ga0134066_1030815523300010364Grasslands SoilAKDLATKAIAELAPFSDRAARLREIAEFLVLRRA*
Ga0126383_1043741833300010398Tropical Forest SoilFGLERSHQIANELSTKAIGELKSYGARAARLREIAQFLVDRRA*
Ga0126383_1155104313300010398Tropical Forest SoilRSHKIAEELSRKAIAELDPYGAKAARLREIAEFLVYRRA*
Ga0126383_1262480313300010398Tropical Forest SoilPSVFGLERSHQIAKELASEGMVELDAYGARADRLRTIAEFLVHRRA*
Ga0137393_1143149713300011271Vadose Zone SoilLERSHQIANDLATKAISELAPYAERTARLREIAEFLVLRRA*
Ga0137389_1061186013300012096Vadose Zone SoilGLERSHQIANDLATKAIAELAPYTDRATRLREIAEFLVLRRA*
Ga0137388_1012418433300012189Vadose Zone SoilYGLERAHEIANELATRAIAELAPYAERAERLRDIAEYLVLRRT*
Ga0137388_1045739833300012189Vadose Zone SoilYGLERSHQIAKELADKGIAELDVYGERAGRLRTIAEFLVQRRA*
Ga0137363_1159160113300012202Vadose Zone SoilYGLERSHQIAKELADKGIAELDAYGERAGRLRTIAEFLVLRRA*
Ga0137376_1096904313300012208Vadose Zone SoilPAVYGLERSHQIANDLATKAIAELAPYTSRAARLHEIAEFLVLRRA*
Ga0137379_1023025133300012209Vadose Zone SoilQIAKDLATKAIAELAPYGDRAARLREIAEFLVLRRA*
Ga0137378_1032377913300012210Vadose Zone SoilERSHQIANDLATNAIAELAPYTGRAARLREIAEFLVLRRA*
Ga0137377_1058049833300012211Vadose Zone SoilASELSTKAIADLAPYGERAARLREIAEFLVNRRA*
Ga0137371_1010039953300012356Vadose Zone SoilANDLATNAIAELAPYTGRAARLREIAEFLVLRRA*
Ga0137384_1118893523300012357Vadose Zone SoilHQIANELATKAIAELTPYADRASRLREIAEFLVLRRT*
Ga0137360_1036449633300012361Vadose Zone SoilERSHQIANDLATKAIAELAPYGDRAARLREIAEFLVLRRA*
Ga0137358_1068912823300012582Vadose Zone SoilAIANDLATKAIAELAPFGERALRLREIAEFLVLRRT*
Ga0137398_1001173153300012683Vadose Zone SoilHQIAKELSEKAIAELDTYGAKASRLREIAEFLVHRRT*
Ga0137397_1072023613300012685Vadose Zone SoilHQIANDLASKAIDELALYADRAARIREIAEFLVHRRA*
Ga0137397_1097152223300012685Vadose Zone SoilAVYGLERSHAIASDLATKAVAELTPFGESALRLRDIAEFLVLRRT*
Ga0137359_1066826913300012923Vadose Zone SoilHAIANDLATKAIAELSPFGERALRLREIAEFLVLRRT*
Ga0137413_1081058013300012924Vadose Zone SoilAVYGLERSHQIANDLATKAIAELAPYTDRAARLREIAEFLVLRRA*
Ga0137419_1082442213300012925Vadose Zone SoilRSHQIAKELADKGIAELDTYGERAGRLRTIAEFLVLRRA*
Ga0137416_1069426613300012927Vadose Zone SoilYPAVYGLERSHQIANDLATKAIAELAPYTGRAARLCEIAEFLVLRRA*
Ga0137404_1140662713300012929Vadose Zone SoilHAIASDLATKAVAELTPFGESALRLRDIAEFLVLRRT*
Ga0134110_1005429213300012975Grasslands SoilVFGLERSHQIAKELSEKAIAELDTYGPKAARLREIAELLVHRRT*
Ga0137411_132762243300015052Vadose Zone SoilMASSGLTKIANDLAGKAISELAPYGEAASRLKEIAEYLVIRRT*
Ga0137405_102628913300015053Vadose Zone SoilGLERSHQIAKELSEKAIAELDTYGAKASRLREIAEFLVHRRT*
Ga0137405_130078613300015053Vadose Zone SoilQIANDLATKAIDELALYADRAARIREIAEFLVHRRA*
Ga0137405_130551183300015053Vadose Zone SoilFGLERSHQIANELSSNAIADLAGYGARAARLREIAEFLVHRRT*
Ga0137405_140914313300015053Vadose Zone SoilVFGLERSHQIARELSEKAIAELNGYGSKAARLREIAEFLVYRRA*
Ga0167668_101527733300015193Glacier Forefield SoilIANDLAGKAIAELAPYREGASRLCEIAEYLVIRRT*
Ga0137403_1130580423300015264Vadose Zone SoilHEIANELATKAVTELALYGDRASRLSEIAAYLVQRRA*
Ga0134073_1015483613300015356Grasslands SoilAMYGLERSHEIGRELATKAISELSPYAERAARLREIAEYLVLRRT*
Ga0182036_1009022233300016270SoilSHQIANDLSAQAISDLDHYAGRADRLRQIARFLLHRRT
Ga0182040_1093654223300016387SoilSHQIANDLATKAIVELEPYGARAERLRTIAEFLVLRRT
Ga0182040_1132963423300016387SoilSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT
Ga0182038_1099817223300016445SoilVFGLERSHQIASDLASEAIADLDHYSPGATARLRQISHFLIHRRT
Ga0187817_1067609223300017955Freshwater SedimentLERSHQIAEELATKAITELQVYSDRADRLRTIAEFLVLRRT
Ga0187858_1041526613300018057PeatlandSHQFARDLANEAIAQLASYGDRAARLREIAEFLVLRRA
Ga0187784_1153221823300018062Tropical PeatlandLEKSHEFARKLATEAIAELEPYGPRGAPLRDLAEFLVLRRA
Ga0187773_1015386313300018064Tropical PeatlandPAVFGLERSHQIAYELATKAIGELQTYGERAERLRTIAEFLVLRRA
Ga0187768_105919123300020150Tropical PeatlandHKIAEELSAKAIAELQPFGGRAERLRTIGEFLVQRRA
Ga0210407_1006264643300020579SoilIANDLATKAISELAPYAERAARLREIAEFLVLRRA
Ga0210407_1045633533300020579SoilRSHEIANDLAGKAIAELAPYREGASRLREIAEYLVIRRT
Ga0210403_1032890913300020580SoilLERSHQIANDLASKSIAELTPYAHRAARLREIAEFLVLRRA
Ga0210403_1057760813300020580SoilIAKELADKGIAELDAYGERASRLRTIAEFLVLRRA
Ga0210406_1083738313300021168SoilERSHQIANELAAKAASELTPYGDRASRLREIAEYLVHRRA
Ga0210400_1049834823300021170SoilLERSHQIAKELADKGIAELDAYGERAGRLRTIAEFLVLRRA
Ga0210400_1075064923300021170SoilQIAKELADKGIAELDVYGDGANRLRTIAEFLVLRRA
Ga0210400_1092694913300021170SoilLQRSHQIANDLATKAIAELAPYADRAARLREIAEFLVLRRA
Ga0210389_1133580613300021404SoilGLERSHQIAKELADKGIAELDTYGERAGRLRTIAEFLVLRRA
Ga0210387_1175686513300021405SoilPAVYGLERSHQIAKELADKGIAELDAYGECANRLRMIAEFLVLRRA
Ga0210394_1103063213300021420SoilYGLKRSHQIANDLATKAIAELAPYTDRAARLREIAEFLVLRRA
Ga0210384_1046686513300021432SoilIAHELVSKAIAELAPYADRAARLREVAEFLVQRRA
Ga0210384_1170633323300021432SoilVYGLERSHQIAHDLATKAIAELAPYAERTSRLREIAEFLVLRRA
Ga0187846_1008823933300021476BiofilmGVYGLERSHQIAGELATKAIAELAPYADRAARLREIAEFLVLRRT
Ga0210402_1030991213300021478SoilSHQIAKELADKGIAELDGYGERANRLRTIAEFLVLRRA
Ga0210402_1035684013300021478SoilHEIAKDLATKAIAELEPYSEKAARLREIAEFLVLRRA
Ga0210410_1179068913300021479SoilHQIAKELADKGIAELDAYGGRADRLRAIAEFLALRRA
Ga0212128_1034619013300022563Thermal SpringsKSQAMAEELAARAIRELVPYGERAERLRHLAEFLAVRRA
Ga0247695_104381923300024179SoilIAGDLAAKAIAELVPYAQRASRLREIAEYLVQRRA
Ga0247671_106880023300024284SoilHQIASELAAKAIAELAPYAQRASRLREIAEYLVQRRA
Ga0247678_100909233300024325SoilSHQIAKELSEKAIAELDIYGTKASRLREIGEFLVYRRA
Ga0137417_128185713300024330Vadose Zone SoilLTRIANDLATKATAELVPYTDRAARLREIAEFLVLRRA
Ga0207646_1062502213300025922Corn, Switchgrass And Miscanthus RhizosphereVFGLERSHQIANDLASQAVADLATYSDRATRLRQIADFLIHRRT
Ga0207665_1043967033300025939Corn, Switchgrass And Miscanthus RhizosphereGLERSHQIANDLASQAIADLAPYADRAARLRQIANFLIHRRA
Ga0207665_1060858813300025939Corn, Switchgrass And Miscanthus RhizosphereIAKELATKAIDELQPYGERAERLRSIAEFLVLRRA
Ga0209268_100252373300026314SoilIANDLATKAIAELAPYLDRAVRLREIAEFLVLRRA
Ga0209471_125751223300026318SoilHQMATELATRAIKELEPYGERARRLGELAEFLVLRRA
Ga0209152_1007972833300026325SoilGLEKSHQMATELATRAIKELEPYGERAQRLRELAEFLVLRRA
Ga0209802_115640423300026328SoilVYGLERSHQIANDLATKAIAELAPYLDRAVRLREIAEFLVLRRA
Ga0257146_103659523300026374SoilVYGLERSHQIAKELADKGIAELDAYGERASRLRTIAEFLVLRRA
Ga0179587_1052675113300026557Vadose Zone SoilQRPHQIAKELADNGIAELDAYGERADRLRTIAEFLVLRRA
Ga0207815_102086723300027014Tropical Forest SoilAVFGLEKSHQIANELSNKAIGELQIYDQRAERLRTIAEFLVQRRA
Ga0207777_109463223300027330Tropical Forest SoilEKSHQIANELSTKAIRELDVYGERAERLRTIAEFLVQRRT
Ga0209588_114540713300027671Vadose Zone SoilHAIANDLATKAIAELAPFGERASRLREIAEFLVLRRT
Ga0209166_1038262813300027857Surface SoilEIARELATKAIDELSPYAERASRLREIAEYLVLRRT
Ga0209701_1013546013300027862Vadose Zone SoilGLERSHQIANELATKAIAELAPYSDRAARLREIADFLVLRRA
Ga0209167_1071740713300027867Surface SoilRSHQIANDLATQAINDLAPYATRADRLRQIAHFLVHRRA
Ga0209068_1029068113300027894WatershedsLKRSHEIAKDLATRAIAALDPYGPKANPLRDIAEFLILRRT
Ga0209526_1027833813300028047Forest SoilQRSHEIANDLAGKAIAELAPYGDAASRLREIAEYLVIRRA
Ga0209526_1043369813300028047Forest SoilIAKELADKSIAELDAYGERANRLRTIAEFLVLRRA
Ga0137415_1008555043300028536Vadose Zone SoilLYGLEKSHQMATELATRAIKELEPYGERARRLGELAEFLVLRRA
Ga0137415_1029251513300028536Vadose Zone SoilYGLERSHQIANDLATKAISELAPYAERTARLREIAEFLVLRRA
Ga0137415_1134321923300028536Vadose Zone SoilPRSHEIANDLASKAIAELAPHHEGASRLREIAEYLVIRRT
Ga0222749_1000150813300029636SoilKRSHEIAKDLATKAIAELTPYAERAARVREIAEFLVLRRA
Ga0073994_1229677723300030991SoilSVYGLEKSHQIATGLADKAVNELNPYGDRAARLRSIAEFLVLRRA
Ga0302324_10057947933300031236PalsaERSRAIATDLEKKAVAELASYGERAARLLELGEFLVMRRS
Ga0318541_1046439223300031545SoilFGLQRSHQIAEELSAKAVAELQVYGQRSERLRTIAEFLVLRRV
Ga0318528_1046548923300031561SoilLERSHQIANELATKAIAELSPYAESAVRLREIAEFLVLRRT
Ga0318515_1060017923300031572SoilLERSHQIANQLATKAIAELSPYAESAVRLREIAEFLVLRRT
Ga0307474_1010785143300031718Hardwood Forest SoilLQRSHEIANDLAGKAVAELAPYRESAIRLREIAEYLVIRRT
Ga0307473_1075673523300031820Hardwood Forest SoilERSHEIANELATKGIAELDSYGDRAARLRELAEYLVLRRT
Ga0318567_1034640423300031821SoilYPAVFGLERSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT
Ga0306925_1087424423300031890SoilLERSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT
Ga0310909_1006272413300031947SoilERSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT
Ga0306926_1097962233300031954SoilHQIARELAAKGIAELEAYGIRAARLRAIAEFLILRRA
Ga0307479_1147174123300031962Hardwood Forest SoilQRSHEIANDLARKAIAELAPYREGASRLREIAEYLVIRRT
Ga0307479_1173089913300031962Hardwood Forest SoilRSHQIAKELADKGIAELDAYGERAGRLRTIAEFLVLRRA
Ga0318545_1010535613300032042SoilRSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT
Ga0318525_1070221413300032089SoilSHQIANDLASEAIADLDHYSPAAATRLRQIAHFLIHRRA
Ga0307471_10005079653300032180Hardwood Forest SoilSHQIAKELADKGIAELDAYGERASRLRTIAEFLVLRRA
Ga0307471_10227115823300032180Hardwood Forest SoilHQIANDLAGKANSELASYGEAGNRLKEIAEYLVIRRT
Ga0307472_10043364433300032205Hardwood Forest SoilQIANDLATRAIAELAPYADRAARLREIAEFLVLRRA
Ga0335082_1167071923300032782SoilIANELSTKAISELRVYGERAERLRTIAEFLVMRRT
Ga0335080_1030657433300032828SoilLEKSHQIANELSTKAISELRVYGERAERLRTIAEFLVMRRT
Ga0335070_1149209713300032829SoilVFGLARSHEFANELASKAIAELQPYGDRAERLRTIAEFLVLRRA
Ga0310810_1034535733300033412SoilERSHQIASDLATKAIAELAPYAQRASRLREIAEYLVQRRA
Ga0371488_0297443_635_7693300033983Peat SoilVFGLERSHQIAEELATKAIAELQVYGDRAERLRMIAEFLVLRRT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.