| Basic Information | |
|---|---|
| Family ID | F047271 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ERSHQIANDLATKAIAELAPYGDRAARLREIAEFLVLRRA |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF01728 | FtsJ | 84.00 |
| PF01513 | NAD_kinase | 9.33 |
| PF02784 | Orn_Arg_deC_N | 1.33 |
| PF00278 | Orn_DAP_Arg_deC | 1.33 |
| PF13564 | DoxX_2 | 0.67 |
| PF01479 | S4 | 0.67 |
| PF13537 | GATase_7 | 0.67 |
| PF01887 | SAM_HAT_N | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 84.00 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 84.00 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 2.67 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 2.67 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.67 % |
| Unclassified | root | N/A | 1.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002560|JGI25383J37093_10076105 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300002561|JGI25384J37096_10174038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300004635|Ga0062388_100299954 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300005166|Ga0066674_10198694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300005332|Ga0066388_103178854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300005439|Ga0070711_100827278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 787 | Open in IMG/M |
| 3300005445|Ga0070708_101598479 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005557|Ga0066704_10081058 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300005559|Ga0066700_11040867 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005559|Ga0066700_11102349 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005610|Ga0070763_10659969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300005764|Ga0066903_100469583 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300005995|Ga0066790_10210468 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006173|Ga0070716_100414500 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300006174|Ga0075014_100389300 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006794|Ga0066658_10145627 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300006794|Ga0066658_10558575 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006806|Ga0079220_11817879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300006854|Ga0075425_100896434 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006854|Ga0075425_101597585 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300007265|Ga0099794_10555260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300009012|Ga0066710_101248344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300009088|Ga0099830_10556043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300009088|Ga0099830_10690036 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300009088|Ga0099830_11310465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009090|Ga0099827_11651678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300009137|Ga0066709_103365593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300010046|Ga0126384_10099414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2142 | Open in IMG/M |
| 3300010046|Ga0126384_11657882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300010047|Ga0126382_12234030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300010048|Ga0126373_10340195 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300010048|Ga0126373_10867428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300010320|Ga0134109_10093738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300010325|Ga0134064_10116465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300010325|Ga0134064_10126262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300010336|Ga0134071_10100741 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300010358|Ga0126370_10868885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300010359|Ga0126376_11012184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300010360|Ga0126372_10134000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
| 3300010360|Ga0126372_11769949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300010364|Ga0134066_10308155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010398|Ga0126383_10437418 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300010398|Ga0126383_11551043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300010398|Ga0126383_12624803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300011271|Ga0137393_11431497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012096|Ga0137389_10611860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300012189|Ga0137388_10124184 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300012189|Ga0137388_10457398 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300012202|Ga0137363_11591601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300012208|Ga0137376_10969043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300012209|Ga0137379_10230251 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300012210|Ga0137378_10323779 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300012211|Ga0137377_10580498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300012356|Ga0137371_10100399 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300012357|Ga0137384_11188935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300012361|Ga0137360_10364496 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300012582|Ga0137358_10689128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012683|Ga0137398_10011731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4464 | Open in IMG/M |
| 3300012685|Ga0137397_10720236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300012685|Ga0137397_10971522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012923|Ga0137359_10668269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300012924|Ga0137413_10810580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012925|Ga0137419_10824422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012927|Ga0137416_10694266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300012929|Ga0137404_11406627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012975|Ga0134110_10054292 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300015052|Ga0137411_1327622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| 3300015053|Ga0137405_1026289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300015053|Ga0137405_1300786 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300015053|Ga0137405_1305511 | All Organisms → cellular organisms → Bacteria | 4012 | Open in IMG/M |
| 3300015053|Ga0137405_1409143 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300015193|Ga0167668_1015277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1724 | Open in IMG/M |
| 3300015264|Ga0137403_11305804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300015356|Ga0134073_10154836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300016270|Ga0182036_10090222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2055 | Open in IMG/M |
| 3300016387|Ga0182040_10936542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300016387|Ga0182040_11329634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300016445|Ga0182038_10998172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300017955|Ga0187817_10676092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300018057|Ga0187858_10415266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300018062|Ga0187784_11532218 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
| 3300018064|Ga0187773_10153863 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300020150|Ga0187768_1059191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300020579|Ga0210407_10062646 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
| 3300020579|Ga0210407_10456335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300020580|Ga0210403_10328909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300020580|Ga0210403_10577608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300021168|Ga0210406_10837383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300021170|Ga0210400_10498348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300021170|Ga0210400_10750649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300021170|Ga0210400_10926949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300021404|Ga0210389_11335806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021405|Ga0210387_11756865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300021420|Ga0210394_11030632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300021432|Ga0210384_10466865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300021432|Ga0210384_11706333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300021476|Ga0187846_10088239 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300021478|Ga0210402_10309912 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300021478|Ga0210402_10356840 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300021479|Ga0210410_11790689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300022563|Ga0212128_10346190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300024179|Ga0247695_1043819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300024284|Ga0247671_1068800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300024325|Ga0247678_1009092 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300024330|Ga0137417_1281857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300025922|Ga0207646_10625022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300025939|Ga0207665_10439670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300025939|Ga0207665_10608588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300026314|Ga0209268_1002523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8677 | Open in IMG/M |
| 3300026318|Ga0209471_1257512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300026325|Ga0209152_10079728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300026328|Ga0209802_1156404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300026374|Ga0257146_1036595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300026557|Ga0179587_10526751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300027014|Ga0207815_1020867 | Not Available | 810 | Open in IMG/M |
| 3300027330|Ga0207777_1094632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300027671|Ga0209588_1145407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300027857|Ga0209166_10382628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300027862|Ga0209701_10135460 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300027867|Ga0209167_10717407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027894|Ga0209068_10290681 | Not Available | 916 | Open in IMG/M |
| 3300028047|Ga0209526_10278338 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300028047|Ga0209526_10433698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300028536|Ga0137415_10085550 | All Organisms → cellular organisms → Bacteria | 3011 | Open in IMG/M |
| 3300028536|Ga0137415_10292515 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300028536|Ga0137415_11343219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300029636|Ga0222749_10001508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11816 | Open in IMG/M |
| 3300030991|Ga0073994_12296777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300031236|Ga0302324_100579479 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300031545|Ga0318541_10464392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031561|Ga0318528_10465489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031572|Ga0318515_10600179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031718|Ga0307474_10107851 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300031820|Ga0307473_10756735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300031821|Ga0318567_10346404 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031890|Ga0306925_10874244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300031947|Ga0310909_10062724 | All Organisms → cellular organisms → Bacteria | 2894 | Open in IMG/M |
| 3300031954|Ga0306926_10979622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300031962|Ga0307479_11471741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031962|Ga0307479_11730899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300032042|Ga0318545_10105356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300032089|Ga0318525_10702214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300032180|Ga0307471_100050796 | All Organisms → cellular organisms → Bacteria | 3419 | Open in IMG/M |
| 3300032180|Ga0307471_102271158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300032205|Ga0307472_100433644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300032782|Ga0335082_11670719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300032828|Ga0335080_10306574 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300032829|Ga0335070_11492097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300033412|Ga0310810_10345357 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300033983|Ga0371488_0297443 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.67% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.67% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25383J37093_100761052 | 3300002560 | Grasslands Soil | VYGLERSHQIANDLATKAIAELAPYADRAARLREIAEFLVLRRA* |
| JGI25384J37096_101740382 | 3300002561 | Grasslands Soil | GLERSHQIAQELASRATGELEPYGXRASRLXXIAEYLVLRRA* |
| Ga0062388_1002999541 | 3300004635 | Bog Forest Soil | LPRSHEIANELANKAIAALEPYAERAGRLREIAEFLVLRRA* |
| Ga0066674_101986941 | 3300005166 | Soil | LERSHQIANELATKAIAELSPYADRASRLRQIAEFLVLRRT* |
| Ga0066388_1031788541 | 3300005332 | Tropical Forest Soil | LERSHQIANDLAAKAIAELAPYADRASRLREIAEFLVLRRA* |
| Ga0070711_1008272782 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GLERSHQIANDLASQAIADLAPYADRAARLRQIANFLIRRRA* |
| Ga0070708_1015984791 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RSHEIANDLAGKAIAELAPYGDAASRLREIAEYLVIRRT* |
| Ga0066704_100810584 | 3300005557 | Soil | ERSHQIANDLATKAIAELAPYLDRAVRLHEIAEFLVLRRA* |
| Ga0066700_110408671 | 3300005559 | Soil | YPSVFGLERSHQIAKELSEKAIAELDTYGAKASRLREIAEFLVHRRT* |
| Ga0066700_111023492 | 3300005559 | Soil | ERSHQIAKELSEKAIAELEPYGVKASRLREIAEFLVYRRA* |
| Ga0070763_106599691 | 3300005610 | Soil | AKELAGKALGELAVYGERAARLRELAEFLVLRRA* |
| Ga0066903_1004695834 | 3300005764 | Tropical Forest Soil | GLERSHQIANDLSAQAISDLDHFAGRAERLRQIAHFLLHRRI* |
| Ga0066790_102104682 | 3300005995 | Soil | SHEIATDLANKAIAALEPYGERGARLREIAEFLVLRRT* |
| Ga0070716_1004145001 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GLERSHQIANDLASQAIADLAPYADRAARLRQIANFLIHRRA* |
| Ga0075014_1003893002 | 3300006174 | Watersheds | LEKSHEIAKDLATKAIDELQPYGKRAERLRAIAEFLVLRRT* |
| Ga0066658_101456271 | 3300006794 | Soil | KSHQMATELATRAIKELEPYGERAQRLRELAEFLVLRRA* |
| Ga0066658_105585751 | 3300006794 | Soil | IANELATKAIAELAPYGERAARLREIAEFLVLRRT* |
| Ga0079220_118178791 | 3300006806 | Agricultural Soil | RSHQIANELATKAIAELAPYAERAARLQEIGEFLVLRRA* |
| Ga0075425_1008964341 | 3300006854 | Populus Rhizosphere | SHEIARELATKAIDELSPYAERAARLREIAEYLVLRRT* |
| Ga0075425_1015975852 | 3300006854 | Populus Rhizosphere | LEKSHEIAKELATKAIDELQPYGERAERLRSIAEFLVLRRA* |
| Ga0099794_105552601 | 3300007265 | Vadose Zone Soil | QIANDLATKAIAELAPYTSRAARLREIAEFLVLRRA* |
| Ga0066710_1012483442 | 3300009012 | Grasslands Soil | LERSHQIASELATKAIAELSPYAARAARLREIAEFLVLRRT |
| Ga0099830_105560432 | 3300009088 | Vadose Zone Soil | LPRSHEIANDLAGKAIAELAPYHEGASRLREIAEYLVIRRT* |
| Ga0099830_106900361 | 3300009088 | Vadose Zone Soil | IANDLAGKAIAELAPYREGASRLREIAEYLVIRRT* |
| Ga0099830_113104651 | 3300009088 | Vadose Zone Soil | IANELASKAIAELEPYGEKASRLREIAEYLVIRRA* |
| Ga0099827_116516782 | 3300009090 | Vadose Zone Soil | ANDLAGKAIAELAPNREGASRLREIAEYLVIRRA* |
| Ga0066709_1033655931 | 3300009137 | Grasslands Soil | IAREHATKAISELSPYAERAARLREIAEYLVLRRT* |
| Ga0126384_100994141 | 3300010046 | Tropical Forest Soil | HQIANDLSAQAIADLDHYAGRADRLRQIAHFLLHRRA* |
| Ga0126384_116578821 | 3300010046 | Tropical Forest Soil | SHQIANELATKAITELSPYDDRAARLREIAEFLVLRRA* |
| Ga0126382_122340301 | 3300010047 | Tropical Forest Soil | IANDLSAQAISDLDRYAGRADRLRQIARFLLHRRT* |
| Ga0126373_103401951 | 3300010048 | Tropical Forest Soil | HQIAKELAGRGISELTAYGERADRLRAIAEFLVHRRK* |
| Ga0126373_108674282 | 3300010048 | Tropical Forest Soil | SHEIASELARRAIAELAPYGERAARLRDIAEYLVLRRT* |
| Ga0134109_100937383 | 3300010320 | Grasslands Soil | ERSHQIAKDLATKAIAELAPFSDRAARLREIAEFLVLRRA* |
| Ga0134064_101164651 | 3300010325 | Grasslands Soil | ERSHQIANDLATKAIAELAPYLDRAVRLREIAEFLVLRRA* |
| Ga0134064_101262621 | 3300010325 | Grasslands Soil | LERSHQIANDLATKAIAELAPYTSRAARLREIAEFLVLRRA* |
| Ga0134071_101007413 | 3300010336 | Grasslands Soil | ANELSSKAIADLASYGARAARLREIAEFLVHRRT* |
| Ga0126370_108688852 | 3300010358 | Tropical Forest Soil | YGLERSHQIARELATKAIDELSPYAERTARLREIAEYLVLRRT* |
| Ga0126376_110121842 | 3300010359 | Tropical Forest Soil | SHEIANELATRAIAELAPYGERASRLRDIAEYLVLRRT* |
| Ga0126372_101340001 | 3300010360 | Tropical Forest Soil | IANELATKAIAELSPLGDRAARLREIAEFLVLRRT* |
| Ga0126372_117699492 | 3300010360 | Tropical Forest Soil | QRSHEIAQELATRAIGELVPYDERAERLRQIAEYLIIRRA* |
| Ga0134066_103081552 | 3300010364 | Grasslands Soil | AKDLATKAIAELAPFSDRAARLREIAEFLVLRRA* |
| Ga0126383_104374183 | 3300010398 | Tropical Forest Soil | FGLERSHQIANELSTKAIGELKSYGARAARLREIAQFLVDRRA* |
| Ga0126383_115510431 | 3300010398 | Tropical Forest Soil | RSHKIAEELSRKAIAELDPYGAKAARLREIAEFLVYRRA* |
| Ga0126383_126248031 | 3300010398 | Tropical Forest Soil | PSVFGLERSHQIAKELASEGMVELDAYGARADRLRTIAEFLVHRRA* |
| Ga0137393_114314971 | 3300011271 | Vadose Zone Soil | LERSHQIANDLATKAISELAPYAERTARLREIAEFLVLRRA* |
| Ga0137389_106118601 | 3300012096 | Vadose Zone Soil | GLERSHQIANDLATKAIAELAPYTDRATRLREIAEFLVLRRA* |
| Ga0137388_101241843 | 3300012189 | Vadose Zone Soil | YGLERAHEIANELATRAIAELAPYAERAERLRDIAEYLVLRRT* |
| Ga0137388_104573983 | 3300012189 | Vadose Zone Soil | YGLERSHQIAKELADKGIAELDVYGERAGRLRTIAEFLVQRRA* |
| Ga0137363_115916011 | 3300012202 | Vadose Zone Soil | YGLERSHQIAKELADKGIAELDAYGERAGRLRTIAEFLVLRRA* |
| Ga0137376_109690431 | 3300012208 | Vadose Zone Soil | PAVYGLERSHQIANDLATKAIAELAPYTSRAARLHEIAEFLVLRRA* |
| Ga0137379_102302513 | 3300012209 | Vadose Zone Soil | QIAKDLATKAIAELAPYGDRAARLREIAEFLVLRRA* |
| Ga0137378_103237791 | 3300012210 | Vadose Zone Soil | ERSHQIANDLATNAIAELAPYTGRAARLREIAEFLVLRRA* |
| Ga0137377_105804983 | 3300012211 | Vadose Zone Soil | ASELSTKAIADLAPYGERAARLREIAEFLVNRRA* |
| Ga0137371_101003995 | 3300012356 | Vadose Zone Soil | ANDLATNAIAELAPYTGRAARLREIAEFLVLRRA* |
| Ga0137384_111889352 | 3300012357 | Vadose Zone Soil | HQIANELATKAIAELTPYADRASRLREIAEFLVLRRT* |
| Ga0137360_103644963 | 3300012361 | Vadose Zone Soil | ERSHQIANDLATKAIAELAPYGDRAARLREIAEFLVLRRA* |
| Ga0137358_106891282 | 3300012582 | Vadose Zone Soil | AIANDLATKAIAELAPFGERALRLREIAEFLVLRRT* |
| Ga0137398_100117315 | 3300012683 | Vadose Zone Soil | HQIAKELSEKAIAELDTYGAKASRLREIAEFLVHRRT* |
| Ga0137397_107202361 | 3300012685 | Vadose Zone Soil | HQIANDLASKAIDELALYADRAARIREIAEFLVHRRA* |
| Ga0137397_109715222 | 3300012685 | Vadose Zone Soil | AVYGLERSHAIASDLATKAVAELTPFGESALRLRDIAEFLVLRRT* |
| Ga0137359_106682691 | 3300012923 | Vadose Zone Soil | HAIANDLATKAIAELSPFGERALRLREIAEFLVLRRT* |
| Ga0137413_108105801 | 3300012924 | Vadose Zone Soil | AVYGLERSHQIANDLATKAIAELAPYTDRAARLREIAEFLVLRRA* |
| Ga0137419_108244221 | 3300012925 | Vadose Zone Soil | RSHQIAKELADKGIAELDTYGERAGRLRTIAEFLVLRRA* |
| Ga0137416_106942661 | 3300012927 | Vadose Zone Soil | YPAVYGLERSHQIANDLATKAIAELAPYTGRAARLCEIAEFLVLRRA* |
| Ga0137404_114066271 | 3300012929 | Vadose Zone Soil | HAIASDLATKAVAELTPFGESALRLRDIAEFLVLRRT* |
| Ga0134110_100542921 | 3300012975 | Grasslands Soil | VFGLERSHQIAKELSEKAIAELDTYGPKAARLREIAELLVHRRT* |
| Ga0137411_13276224 | 3300015052 | Vadose Zone Soil | MASSGLTKIANDLAGKAISELAPYGEAASRLKEIAEYLVIRRT* |
| Ga0137405_10262891 | 3300015053 | Vadose Zone Soil | GLERSHQIAKELSEKAIAELDTYGAKASRLREIAEFLVHRRT* |
| Ga0137405_13007861 | 3300015053 | Vadose Zone Soil | QIANDLATKAIDELALYADRAARIREIAEFLVHRRA* |
| Ga0137405_13055118 | 3300015053 | Vadose Zone Soil | FGLERSHQIANELSSNAIADLAGYGARAARLREIAEFLVHRRT* |
| Ga0137405_14091431 | 3300015053 | Vadose Zone Soil | VFGLERSHQIARELSEKAIAELNGYGSKAARLREIAEFLVYRRA* |
| Ga0167668_10152773 | 3300015193 | Glacier Forefield Soil | IANDLAGKAIAELAPYREGASRLCEIAEYLVIRRT* |
| Ga0137403_113058042 | 3300015264 | Vadose Zone Soil | HEIANELATKAVTELALYGDRASRLSEIAAYLVQRRA* |
| Ga0134073_101548361 | 3300015356 | Grasslands Soil | AMYGLERSHEIGRELATKAISELSPYAERAARLREIAEYLVLRRT* |
| Ga0182036_100902223 | 3300016270 | Soil | SHQIANDLSAQAISDLDHYAGRADRLRQIARFLLHRRT |
| Ga0182040_109365422 | 3300016387 | Soil | SHQIANDLATKAIVELEPYGARAERLRTIAEFLVLRRT |
| Ga0182040_113296342 | 3300016387 | Soil | SHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT |
| Ga0182038_109981722 | 3300016445 | Soil | VFGLERSHQIASDLASEAIADLDHYSPGATARLRQISHFLIHRRT |
| Ga0187817_106760922 | 3300017955 | Freshwater Sediment | LERSHQIAEELATKAITELQVYSDRADRLRTIAEFLVLRRT |
| Ga0187858_104152661 | 3300018057 | Peatland | SHQFARDLANEAIAQLASYGDRAARLREIAEFLVLRRA |
| Ga0187784_115322182 | 3300018062 | Tropical Peatland | LEKSHEFARKLATEAIAELEPYGPRGAPLRDLAEFLVLRRA |
| Ga0187773_101538631 | 3300018064 | Tropical Peatland | PAVFGLERSHQIAYELATKAIGELQTYGERAERLRTIAEFLVLRRA |
| Ga0187768_10591912 | 3300020150 | Tropical Peatland | HKIAEELSAKAIAELQPFGGRAERLRTIGEFLVQRRA |
| Ga0210407_100626464 | 3300020579 | Soil | IANDLATKAISELAPYAERAARLREIAEFLVLRRA |
| Ga0210407_104563353 | 3300020579 | Soil | RSHEIANDLAGKAIAELAPYREGASRLREIAEYLVIRRT |
| Ga0210403_103289091 | 3300020580 | Soil | LERSHQIANDLASKSIAELTPYAHRAARLREIAEFLVLRRA |
| Ga0210403_105776081 | 3300020580 | Soil | IAKELADKGIAELDAYGERASRLRTIAEFLVLRRA |
| Ga0210406_108373831 | 3300021168 | Soil | ERSHQIANELAAKAASELTPYGDRASRLREIAEYLVHRRA |
| Ga0210400_104983482 | 3300021170 | Soil | LERSHQIAKELADKGIAELDAYGERAGRLRTIAEFLVLRRA |
| Ga0210400_107506492 | 3300021170 | Soil | QIAKELADKGIAELDVYGDGANRLRTIAEFLVLRRA |
| Ga0210400_109269491 | 3300021170 | Soil | LQRSHQIANDLATKAIAELAPYADRAARLREIAEFLVLRRA |
| Ga0210389_113358061 | 3300021404 | Soil | GLERSHQIAKELADKGIAELDTYGERAGRLRTIAEFLVLRRA |
| Ga0210387_117568651 | 3300021405 | Soil | PAVYGLERSHQIAKELADKGIAELDAYGECANRLRMIAEFLVLRRA |
| Ga0210394_110306321 | 3300021420 | Soil | YGLKRSHQIANDLATKAIAELAPYTDRAARLREIAEFLVLRRA |
| Ga0210384_104668651 | 3300021432 | Soil | IAHELVSKAIAELAPYADRAARLREVAEFLVQRRA |
| Ga0210384_117063332 | 3300021432 | Soil | VYGLERSHQIAHDLATKAIAELAPYAERTSRLREIAEFLVLRRA |
| Ga0187846_100882393 | 3300021476 | Biofilm | GVYGLERSHQIAGELATKAIAELAPYADRAARLREIAEFLVLRRT |
| Ga0210402_103099121 | 3300021478 | Soil | SHQIAKELADKGIAELDGYGERANRLRTIAEFLVLRRA |
| Ga0210402_103568401 | 3300021478 | Soil | HEIAKDLATKAIAELEPYSEKAARLREIAEFLVLRRA |
| Ga0210410_117906891 | 3300021479 | Soil | HQIAKELADKGIAELDAYGGRADRLRAIAEFLALRRA |
| Ga0212128_103461901 | 3300022563 | Thermal Springs | KSQAMAEELAARAIRELVPYGERAERLRHLAEFLAVRRA |
| Ga0247695_10438192 | 3300024179 | Soil | IAGDLAAKAIAELVPYAQRASRLREIAEYLVQRRA |
| Ga0247671_10688002 | 3300024284 | Soil | HQIASELAAKAIAELAPYAQRASRLREIAEYLVQRRA |
| Ga0247678_10090923 | 3300024325 | Soil | SHQIAKELSEKAIAELDIYGTKASRLREIGEFLVYRRA |
| Ga0137417_12818571 | 3300024330 | Vadose Zone Soil | LTRIANDLATKATAELVPYTDRAARLREIAEFLVLRRA |
| Ga0207646_106250221 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VFGLERSHQIANDLASQAVADLATYSDRATRLRQIADFLIHRRT |
| Ga0207665_104396703 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GLERSHQIANDLASQAIADLAPYADRAARLRQIANFLIHRRA |
| Ga0207665_106085881 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IAKELATKAIDELQPYGERAERLRSIAEFLVLRRA |
| Ga0209268_10025237 | 3300026314 | Soil | IANDLATKAIAELAPYLDRAVRLREIAEFLVLRRA |
| Ga0209471_12575122 | 3300026318 | Soil | HQMATELATRAIKELEPYGERARRLGELAEFLVLRRA |
| Ga0209152_100797283 | 3300026325 | Soil | GLEKSHQMATELATRAIKELEPYGERAQRLRELAEFLVLRRA |
| Ga0209802_11564042 | 3300026328 | Soil | VYGLERSHQIANDLATKAIAELAPYLDRAVRLREIAEFLVLRRA |
| Ga0257146_10365952 | 3300026374 | Soil | VYGLERSHQIAKELADKGIAELDAYGERASRLRTIAEFLVLRRA |
| Ga0179587_105267511 | 3300026557 | Vadose Zone Soil | QRPHQIAKELADNGIAELDAYGERADRLRTIAEFLVLRRA |
| Ga0207815_10208672 | 3300027014 | Tropical Forest Soil | AVFGLEKSHQIANELSNKAIGELQIYDQRAERLRTIAEFLVQRRA |
| Ga0207777_10946322 | 3300027330 | Tropical Forest Soil | EKSHQIANELSTKAIRELDVYGERAERLRTIAEFLVQRRT |
| Ga0209588_11454071 | 3300027671 | Vadose Zone Soil | HAIANDLATKAIAELAPFGERASRLREIAEFLVLRRT |
| Ga0209166_103826281 | 3300027857 | Surface Soil | EIARELATKAIDELSPYAERASRLREIAEYLVLRRT |
| Ga0209701_101354601 | 3300027862 | Vadose Zone Soil | GLERSHQIANELATKAIAELAPYSDRAARLREIADFLVLRRA |
| Ga0209167_107174071 | 3300027867 | Surface Soil | RSHQIANDLATQAINDLAPYATRADRLRQIAHFLVHRRA |
| Ga0209068_102906811 | 3300027894 | Watersheds | LKRSHEIAKDLATRAIAALDPYGPKANPLRDIAEFLILRRT |
| Ga0209526_102783381 | 3300028047 | Forest Soil | QRSHEIANDLAGKAIAELAPYGDAASRLREIAEYLVIRRA |
| Ga0209526_104336981 | 3300028047 | Forest Soil | IAKELADKSIAELDAYGERANRLRTIAEFLVLRRA |
| Ga0137415_100855504 | 3300028536 | Vadose Zone Soil | LYGLEKSHQMATELATRAIKELEPYGERARRLGELAEFLVLRRA |
| Ga0137415_102925151 | 3300028536 | Vadose Zone Soil | YGLERSHQIANDLATKAISELAPYAERTARLREIAEFLVLRRA |
| Ga0137415_113432192 | 3300028536 | Vadose Zone Soil | PRSHEIANDLASKAIAELAPHHEGASRLREIAEYLVIRRT |
| Ga0222749_100015081 | 3300029636 | Soil | KRSHEIAKDLATKAIAELTPYAERAARVREIAEFLVLRRA |
| Ga0073994_122967772 | 3300030991 | Soil | SVYGLEKSHQIATGLADKAVNELNPYGDRAARLRSIAEFLVLRRA |
| Ga0302324_1005794793 | 3300031236 | Palsa | ERSRAIATDLEKKAVAELASYGERAARLLELGEFLVMRRS |
| Ga0318541_104643922 | 3300031545 | Soil | FGLQRSHQIAEELSAKAVAELQVYGQRSERLRTIAEFLVLRRV |
| Ga0318528_104654892 | 3300031561 | Soil | LERSHQIANELATKAIAELSPYAESAVRLREIAEFLVLRRT |
| Ga0318515_106001792 | 3300031572 | Soil | LERSHQIANQLATKAIAELSPYAESAVRLREIAEFLVLRRT |
| Ga0307474_101078514 | 3300031718 | Hardwood Forest Soil | LQRSHEIANDLAGKAVAELAPYRESAIRLREIAEYLVIRRT |
| Ga0307473_107567352 | 3300031820 | Hardwood Forest Soil | ERSHEIANELATKGIAELDSYGDRAARLRELAEYLVLRRT |
| Ga0318567_103464042 | 3300031821 | Soil | YPAVFGLERSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT |
| Ga0306925_108742442 | 3300031890 | Soil | LERSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT |
| Ga0310909_100627241 | 3300031947 | Soil | ERSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT |
| Ga0306926_109796223 | 3300031954 | Soil | HQIARELAAKGIAELEAYGIRAARLRAIAEFLILRRA |
| Ga0307479_114717412 | 3300031962 | Hardwood Forest Soil | QRSHEIANDLARKAIAELAPYREGASRLREIAEYLVIRRT |
| Ga0307479_117308991 | 3300031962 | Hardwood Forest Soil | RSHQIAKELADKGIAELDAYGERAGRLRTIAEFLVLRRA |
| Ga0318545_101053561 | 3300032042 | Soil | RSHQIANDLATKAIGELESYGEKAERLRTIAEFLVLRRT |
| Ga0318525_107022141 | 3300032089 | Soil | SHQIANDLASEAIADLDHYSPAAATRLRQIAHFLIHRRA |
| Ga0307471_1000507965 | 3300032180 | Hardwood Forest Soil | SHQIAKELADKGIAELDAYGERASRLRTIAEFLVLRRA |
| Ga0307471_1022711582 | 3300032180 | Hardwood Forest Soil | HQIANDLAGKANSELASYGEAGNRLKEIAEYLVIRRT |
| Ga0307472_1004336443 | 3300032205 | Hardwood Forest Soil | QIANDLATRAIAELAPYADRAARLREIAEFLVLRRA |
| Ga0335082_116707192 | 3300032782 | Soil | IANELSTKAISELRVYGERAERLRTIAEFLVMRRT |
| Ga0335080_103065743 | 3300032828 | Soil | LEKSHQIANELSTKAISELRVYGERAERLRTIAEFLVMRRT |
| Ga0335070_114920971 | 3300032829 | Soil | VFGLARSHEFANELASKAIAELQPYGDRAERLRTIAEFLVLRRA |
| Ga0310810_103453573 | 3300033412 | Soil | ERSHQIASDLATKAIAELAPYAQRASRLREIAEYLVQRRA |
| Ga0371488_0297443_635_769 | 3300033983 | Peat Soil | VFGLERSHQIAEELATKAIAELQVYGDRAERLRMIAEFLVLRRT |
| ⦗Top⦘ |