| Basic Information | |
|---|---|
| Family ID | F047262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AATLNALDGAITSNMAIVPTTNGSISVFGSNPTYLILDNFGYFAP |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.14 % |
| % of genes near scaffold ends (potentially truncated) | 88.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.74% Coil/Unstructured: 97.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF01820 | Dala_Dala_lig_N | 2.67 |
| PF13620 | CarboxypepD_reg | 2.00 |
| PF07478 | Dala_Dala_lig_C | 2.00 |
| PF02245 | Pur_DNA_glyco | 2.00 |
| PF00106 | adh_short | 1.33 |
| PF01436 | NHL | 1.33 |
| PF00313 | CSD | 1.33 |
| PF13751 | DDE_Tnp_1_6 | 0.67 |
| PF02223 | Thymidylate_kin | 0.67 |
| PF13229 | Beta_helix | 0.67 |
| PF04909 | Amidohydro_2 | 0.67 |
| PF13641 | Glyco_tranf_2_3 | 0.67 |
| PF01904 | DUF72 | 0.67 |
| PF14312 | FG-GAP_2 | 0.67 |
| PF16640 | Big_3_5 | 0.67 |
| PF08448 | PAS_4 | 0.67 |
| PF09411 | PagL | 0.67 |
| PF07676 | PD40 | 0.67 |
| PF00069 | Pkinase | 0.67 |
| PF01450 | IlvC | 0.67 |
| PF00202 | Aminotran_3 | 0.67 |
| PF04366 | Ysc84 | 0.67 |
| PF03928 | HbpS-like | 0.67 |
| PF03720 | UDPG_MGDP_dh_C | 0.67 |
| PF01935 | DUF87 | 0.67 |
| PF05685 | Uma2 | 0.67 |
| PF04542 | Sigma70_r2 | 0.67 |
| PF01555 | N6_N4_Mtase | 0.67 |
| PF03091 | CutA1 | 0.67 |
| PF00456 | Transketolase_N | 0.67 |
| PF13418 | Kelch_4 | 0.67 |
| PF06210 | DUF1003 | 0.67 |
| PF05593 | RHS_repeat | 0.67 |
| PF03551 | PadR | 0.67 |
| PF04379 | DUF525 | 0.67 |
| PF13439 | Glyco_transf_4 | 0.67 |
| PF07969 | Amidohydro_3 | 0.67 |
| PF03050 | DDE_Tnp_IS66 | 0.67 |
| PF14319 | Zn_Tnp_IS91 | 0.67 |
| PF00854 | PTR2 | 0.67 |
| PF00117 | GATase | 0.67 |
| PF05199 | GMC_oxred_C | 0.67 |
| PF13360 | PQQ_2 | 0.67 |
| PF00589 | Phage_integrase | 0.67 |
| PF00005 | ABC_tran | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.67 |
| COG1181 | D-alanine-D-alanine ligase or related ATP-grasp enzyme | Cell wall/membrane/envelope biogenesis [M] | 2.67 |
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 2.00 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.33 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.67 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.67 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.67 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.67 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.67 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.67 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 0.67 |
| COG2967 | Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transport | Inorganic ion transport and metabolism [P] | 0.67 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.67 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.67 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.67 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.67 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.67 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.67 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.67 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.67 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.67 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.67 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.67 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.67 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.67 % |
| Unclassified | root | N/A | 35.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10200703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300004114|Ga0062593_102443920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300004479|Ga0062595_100084652 | Not Available | 1620 | Open in IMG/M |
| 3300004479|Ga0062595_101481126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300004479|Ga0062595_101701920 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300004479|Ga0062595_102360664 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005337|Ga0070682_102045983 | Not Available | 504 | Open in IMG/M |
| 3300005434|Ga0070709_10457376 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300005434|Ga0070709_10862008 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005435|Ga0070714_101506103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300005435|Ga0070714_101671044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 622 | Open in IMG/M |
| 3300005436|Ga0070713_102368330 | Not Available | 514 | Open in IMG/M |
| 3300005437|Ga0070710_10863425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 651 | Open in IMG/M |
| 3300005439|Ga0070711_100666827 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005518|Ga0070699_100896140 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005531|Ga0070738_10006251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12614 | Open in IMG/M |
| 3300005541|Ga0070733_10048544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2657 | Open in IMG/M |
| 3300005541|Ga0070733_10843256 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005541|Ga0070733_10964194 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005542|Ga0070732_10410880 | Not Available | 817 | Open in IMG/M |
| 3300005542|Ga0070732_10958822 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005614|Ga0068856_101590530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300005944|Ga0066788_10056984 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300006055|Ga0097691_1147529 | Not Available | 631 | Open in IMG/M |
| 3300006059|Ga0075017_101464197 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006162|Ga0075030_101603805 | Not Available | 509 | Open in IMG/M |
| 3300006162|Ga0075030_101655892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa | 500 | Open in IMG/M |
| 3300006173|Ga0070716_100934286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 681 | Open in IMG/M |
| 3300006173|Ga0070716_101214940 | Not Available | 606 | Open in IMG/M |
| 3300006358|Ga0068871_100954157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300006797|Ga0066659_10155722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1629 | Open in IMG/M |
| 3300006806|Ga0079220_10861128 | Not Available | 696 | Open in IMG/M |
| 3300007265|Ga0099794_10300005 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300009089|Ga0099828_11330264 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009090|Ga0099827_10003747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8763 | Open in IMG/M |
| 3300009090|Ga0099827_10015365 | All Organisms → cellular organisms → Bacteria | 5136 | Open in IMG/M |
| 3300009137|Ga0066709_100024879 | All Organisms → cellular organisms → Bacteria | 6163 | Open in IMG/M |
| 3300009137|Ga0066709_101683548 | Not Available | 901 | Open in IMG/M |
| 3300009148|Ga0105243_12977497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009177|Ga0105248_13035864 | Not Available | 534 | Open in IMG/M |
| 3300009523|Ga0116221_1208055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300009551|Ga0105238_12686242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300009644|Ga0116121_1085263 | Not Available | 988 | Open in IMG/M |
| 3300010048|Ga0126373_13073666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus | 520 | Open in IMG/M |
| 3300010362|Ga0126377_13212356 | Not Available | 528 | Open in IMG/M |
| 3300010373|Ga0134128_10891496 | Not Available | 985 | Open in IMG/M |
| 3300010399|Ga0134127_13131217 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300011120|Ga0150983_14352126 | Not Available | 596 | Open in IMG/M |
| 3300011120|Ga0150983_14657792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 573 | Open in IMG/M |
| 3300011120|Ga0150983_14787521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300011269|Ga0137392_10882345 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300011270|Ga0137391_11046484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300012189|Ga0137388_11017433 | Not Available | 764 | Open in IMG/M |
| 3300012211|Ga0137377_11422856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 621 | Open in IMG/M |
| 3300012212|Ga0150985_112866831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 554 | Open in IMG/M |
| 3300012361|Ga0137360_10794536 | Not Available | 814 | Open in IMG/M |
| 3300012362|Ga0137361_11712268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012363|Ga0137390_10771811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300012469|Ga0150984_123456029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 570 | Open in IMG/M |
| 3300012917|Ga0137395_10186557 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300012917|Ga0137395_11122093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012922|Ga0137394_11415545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa | 556 | Open in IMG/M |
| 3300012927|Ga0137416_11707891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300012927|Ga0137416_11888052 | Not Available | 547 | Open in IMG/M |
| 3300012971|Ga0126369_12854123 | Not Available | 566 | Open in IMG/M |
| 3300012986|Ga0164304_10294018 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300012989|Ga0164305_11658900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012989|Ga0164305_12089187 | Not Available | 519 | Open in IMG/M |
| 3300013105|Ga0157369_10339484 | Not Available | 1560 | Open in IMG/M |
| 3300013297|Ga0157378_10206546 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300013297|Ga0157378_10555898 | Not Available | 1154 | Open in IMG/M |
| 3300013307|Ga0157372_11982359 | Not Available | 669 | Open in IMG/M |
| 3300014156|Ga0181518_10311478 | Not Available | 781 | Open in IMG/M |
| 3300014162|Ga0181538_10339349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300014200|Ga0181526_10162181 | Not Available | 1433 | Open in IMG/M |
| 3300014201|Ga0181537_10396272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300014491|Ga0182014_10083538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1990 | Open in IMG/M |
| 3300014491|Ga0182014_10134518 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300014491|Ga0182014_10373161 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300014502|Ga0182021_10942474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → unclassified Rhizomicrobium → Rhizomicrobium sp. SCGC AG-212-E05 | 1038 | Open in IMG/M |
| 3300014658|Ga0181519_10197616 | Not Available | 1268 | Open in IMG/M |
| 3300014838|Ga0182030_11214547 | Not Available | 643 | Open in IMG/M |
| 3300014839|Ga0182027_10048438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5342 | Open in IMG/M |
| 3300015193|Ga0167668_1051117 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300015193|Ga0167668_1102973 | Not Available | 525 | Open in IMG/M |
| 3300015245|Ga0137409_11104672 | Not Available | 632 | Open in IMG/M |
| 3300017975|Ga0187782_11647506 | Not Available | 507 | Open in IMG/M |
| 3300017988|Ga0181520_10436126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa | 942 | Open in IMG/M |
| 3300017988|Ga0181520_10446381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300018034|Ga0187863_10039299 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
| 3300018034|Ga0187863_10312096 | Not Available | 874 | Open in IMG/M |
| 3300018037|Ga0187883_10030600 | Not Available | 2922 | Open in IMG/M |
| 3300018038|Ga0187855_10338295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300018043|Ga0187887_10273188 | Not Available | 999 | Open in IMG/M |
| 3300018044|Ga0187890_10296347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 908 | Open in IMG/M |
| 3300018044|Ga0187890_10389242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300018044|Ga0187890_10723493 | Not Available | 562 | Open in IMG/M |
| 3300019789|Ga0137408_1190655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 762 | Open in IMG/M |
| 3300021374|Ga0213881_10080626 | Not Available | 1397 | Open in IMG/M |
| 3300021374|Ga0213881_10165583 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300021377|Ga0213874_10304017 | Not Available | 601 | Open in IMG/M |
| 3300021420|Ga0210394_10555224 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300021559|Ga0210409_10115692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2467 | Open in IMG/M |
| 3300022724|Ga0242665_10346714 | Not Available | 531 | Open in IMG/M |
| 3300025544|Ga0208078_1023695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1378 | Open in IMG/M |
| 3300025579|Ga0207927_1117271 | Not Available | 587 | Open in IMG/M |
| 3300025619|Ga0207926_1097817 | Not Available | 718 | Open in IMG/M |
| 3300025898|Ga0207692_10440649 | Not Available | 818 | Open in IMG/M |
| 3300025906|Ga0207699_10748768 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300025906|Ga0207699_11264558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300025916|Ga0207663_10185832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1488 | Open in IMG/M |
| 3300025928|Ga0207700_10823080 | Not Available | 831 | Open in IMG/M |
| 3300025949|Ga0207667_11663834 | Not Available | 606 | Open in IMG/M |
| 3300026078|Ga0207702_11763670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 611 | Open in IMG/M |
| 3300027795|Ga0209139_10007007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4246 | Open in IMG/M |
| 3300027867|Ga0209167_10007107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5430 | Open in IMG/M |
| 3300027910|Ga0209583_10172571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 902 | Open in IMG/M |
| 3300027911|Ga0209698_10904392 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027965|Ga0209062_1013999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5580 | Open in IMG/M |
| 3300029636|Ga0222749_10449748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300029944|Ga0311352_10427973 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300031239|Ga0265328_10350677 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031446|Ga0170820_16341184 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031524|Ga0302320_11740747 | Not Available | 598 | Open in IMG/M |
| 3300031718|Ga0307474_10955950 | Not Available | 678 | Open in IMG/M |
| 3300031720|Ga0307469_10991641 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031754|Ga0307475_10360648 | Not Available | 1168 | Open in IMG/M |
| 3300031820|Ga0307473_10734603 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031938|Ga0308175_101329386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300031938|Ga0308175_101484126 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300031962|Ga0307479_10494224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300031962|Ga0307479_10877100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300031996|Ga0308176_12390547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 564 | Open in IMG/M |
| 3300032205|Ga0307472_100799784 | Not Available | 861 | Open in IMG/M |
| 3300032205|Ga0307472_102531955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 522 | Open in IMG/M |
| 3300032783|Ga0335079_10443771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1392 | Open in IMG/M |
| 3300032805|Ga0335078_10092826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4374 | Open in IMG/M |
| 3300032893|Ga0335069_10268259 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300032955|Ga0335076_11433282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 577 | Open in IMG/M |
| 3300033134|Ga0335073_10900320 | Not Available | 932 | Open in IMG/M |
| 3300033158|Ga0335077_11362381 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300033887|Ga0334790_218268 | Not Available | 540 | Open in IMG/M |
| 3300034091|Ga0326724_0141985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1502 | Open in IMG/M |
| 3300034125|Ga0370484_0008123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2184 | Open in IMG/M |
| 3300034125|Ga0370484_0115511 | Not Available | 707 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.33% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.67% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.33% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.33% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.33% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.67% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_102007032 | 3300002914 | Grasslands Soil | IDGAVTSNMAIVPTTNGSVSAFAPNPTHLVLDIFGYFAP* |
| Ga0062593_1024439202 | 3300004114 | Soil | QGQPQPQVATLNAVDAAVTSNLAIVPTANGNISAFVSNATQLVLDIFGYFAP* |
| Ga0062595_1000846523 | 3300004479 | Soil | AIDGAITSNLAIVPAANGSISIFGSNPTHVVMDISGYFVAP* |
| Ga0062595_1014811262 | 3300004479 | Soil | MWPQGQTQPLAATLNAYDGAITNNMAIVPSTSGAVSVSPLAPTHLVLDIFGYFAP* |
| Ga0062595_1017019201 | 3300004479 | Soil | TLNAIDGAITSNLAIVPAANGSISIFGSNPTHVVMDISGYFVP* |
| Ga0062595_1023606641 | 3300004479 | Soil | PQAQTQPLAATLNAYDGAITNNMAIVPTTTGSISVYPSAPTHLVLDIVGYFAP* |
| Ga0070682_1020459832 | 3300005337 | Corn Rhizosphere | LSLWGDGGDPRPNASVLNAPDGVVTSNMALVPTTNGSVDAFASDSTHLILDLSGYFAP* |
| Ga0070709_104573762 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPLAATLNAYDGAVTNNMAIVPTTTGSVSVFPSAATHLVLDLFGYFAP* |
| Ga0070709_108620081 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PTVATLNAVDGALTSNLAIVPGTNGSISVFPSNPTHLVLDLFGYFAP* |
| Ga0070714_1015061032 | 3300005435 | Agricultural Soil | TLWPQGQTQPNVATLNAVDAAVTSNLAIVPTVNGTVSAFASNPSHLVLDIFGYFGQ* |
| Ga0070714_1016710441 | 3300005435 | Agricultural Soil | VSTLNAGDGFVTSNLAIVPTTNGLISSFASDPVHLVLDLSGYFAP* |
| Ga0070713_1023683301 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | STLNAIDGAVTSNMAIVPTNNGSIDVFVSNPTHVVLDIFGYFAP* |
| Ga0070710_108634252 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | STLNASDGFVTSNLAIVPTTNGLISSFASNPVHLILDLSGYFAP* |
| Ga0070711_1006668271 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MWPQGQMRPLAATLNAYDGAVTNNMAIVPTTTGSVCVFPSAATHLVPDLFGYFAP* |
| Ga0070699_1008961401 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LNAGDGAITSNLAIVPAANGSISIFGSNPTHVVMDISGYFVAP* |
| Ga0070738_100062511 | 3300005531 | Surface Soil | VSSNMAIVPTTNANISAYASDPTFLILDLLGYFAP* |
| Ga0070733_100485443 | 3300005541 | Surface Soil | ATLNASDGAVTNNMAIIPTTNGSISAFATDPTHLVLDIFAYFAP* |
| Ga0070733_108432561 | 3300005541 | Surface Soil | PLAATLNDYDGTVTNNMAIVPTTTGSISIFPSNPTHLVLDIFGYFAP* |
| Ga0070733_109641942 | 3300005541 | Surface Soil | QPLAATLNAYDGAVTNNMAIVPTTTGSISVFPSNPTHLVLDIFGYFGP* |
| Ga0070732_104108801 | 3300005542 | Surface Soil | APGTSTLNSFDGAVTSNMAIVSTNNGSVNAFASAPTQLVLDIFGYFAP* |
| Ga0070732_109588221 | 3300005542 | Surface Soil | PPGPFGFLTMWPEGEPQPPTATLNALDGAITSKMAIVPTKNGSITAFASNPTYLILDIFGFYAP* |
| Ga0068856_1015905301 | 3300005614 | Corn Rhizosphere | NASVLNAPDGVVTSNMAVVPTTNGSVSAFASDSTHLILDLSGYFAP* |
| Ga0066788_100569842 | 3300005944 | Soil | MRWTGAITSNLAIVPTANGSISVFPSNPTHLVVDISGYFGQ* |
| Ga0097691_11475293 | 3300006055 | Arctic Peat Soil | AITSNLALVPTANGSISAFASDLAHLIVDISGYFGQ* |
| Ga0075017_1014641972 | 3300006059 | Watersheds | LNAIDGAVTSNMAIVPAQSGAISVFALDPTHLVLDIFGYFAP* |
| Ga0075030_1016038051 | 3300006162 | Watersheds | RPVVATLNAVDGAITSNMAIVPTTNGSISAFASNPTHLVMDISGYFGQ* |
| Ga0075030_1016558921 | 3300006162 | Watersheds | TLNAMDGAITSNMAIVPATNGTISAFPSNPTHLILDILGYFGQ* |
| Ga0070716_1009342862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NAGDGAVTSNMAIVPTTNGSISAFVPDLSHLVLDISGFFAP* |
| Ga0070716_1012149402 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLNDTDGAVTNNMAIVPTTTGSVSVFPLFPTHLVLDIFSYFAP* |
| Ga0068871_1009541572 | 3300006358 | Miscanthus Rhizosphere | QGQSQPLAATLNAYDGAITNNMAIVPTTTGSISVFPVNPTHLVLDIFGFFAP* |
| Ga0066659_101557221 | 3300006797 | Soil | LVSTLNAGDGAVTSNLAIVPTTNGSVSAFVSQPSHLVLDISGFFAP* |
| Ga0079220_108611281 | 3300006806 | Agricultural Soil | QPIASILNSIDSAVTSNMAIVPTSNGSVKAFVSNPADLVLDIFGYFAP* |
| Ga0099794_103000051 | 3300007265 | Vadose Zone Soil | GQPQPPTATLNAGDGAVTSNLAIIPTVNGSVSAFALSPTHLVLDVFGYFAP* |
| Ga0099828_113302642 | 3300009089 | Vadose Zone Soil | AVDGAITSNLAIVPTTNGSIAVFPSAPTHLVLDLFGYFAP* |
| Ga0099827_100037477 | 3300009090 | Vadose Zone Soil | AVTSNMAIVPTTNGSVSAFAPNPTHLVLDIFGYFAP* |
| Ga0099827_100153652 | 3300009090 | Vadose Zone Soil | MWPQGQTLPLAATLNAYDGAITNNMAIVPTTTGSVSVFPSAPTHLVLDIFAYFAP* |
| Ga0066709_1000248794 | 3300009137 | Grasslands Soil | LWPQGQAQPLVATLNAIDGAITSNMAITPTQNGSISAYALNPAHLVLDIFGYFAP* |
| Ga0066709_1016835482 | 3300009137 | Grasslands Soil | LNAIDGAVTSNMAIVPTANGSISIFSSQPTHLVIDISGFFEP* |
| Ga0105243_129774971 | 3300009148 | Miscanthus Rhizosphere | QPQPVVSTLNAIDGAITSNLAITPIQNGSISAFALNPTHLILDIFGYFAP* |
| Ga0105248_130358641 | 3300009177 | Switchgrass Rhizosphere | ITSNMAIVPVGSGSISVFGSNPTHLILDVSGYLAP* |
| Ga0116230_111122882 | 3300009510 | Host-Associated | DGAVTSNTAIVGTTNGSIGIFAANPTVLTLDVYGYFAP* |
| Ga0116221_12080551 | 3300009523 | Peatlands Soil | AASLNALDGAITSNLAIVPTTNGSISVFPFNPTHLVLDLFGYFAP* |
| Ga0105238_126862421 | 3300009551 | Corn Rhizosphere | VSTLNDLDGSITNNLAIVPTNNGAISVFATDSTHLVMDVFGYFAP* |
| Ga0116121_10852632 | 3300009644 | Peatland | SSLDQTVTSNLAIVPTTNGSISTYAANPTQLVLDIFGYFGP* |
| Ga0126373_130736661 | 3300010048 | Tropical Forest Soil | TMWPQGQPQPLAATLNAFDGAITNNMAIVPTTNGSVSIFPTGPTHLVLDAFGFFAP* |
| Ga0126377_132123562 | 3300010362 | Tropical Forest Soil | TLNAVDGVVTSNMAIVPTTNLSVSAFGPNPTHLVLDISGYFAP* |
| Ga0134128_108914961 | 3300010373 | Terrestrial Soil | TLHAIDGAITSNLAIVPAANGSISIFGSNPMHVVMDISGYFVAP* |
| Ga0134127_131312171 | 3300010399 | Terrestrial Soil | TLNAIDGAITNNMAIVPTNNGSISVFPTAPTHLVLDVFGFFAP* |
| Ga0150983_143521261 | 3300011120 | Forest Soil | QGQPLPLAATLNASDGAVTNNMAIIPTTNGSISAFATDPTHLVLDIFAYFAP* |
| Ga0150983_146577922 | 3300011120 | Forest Soil | PQGQTRPLASTLNAQDGAITSNLAIVPTTNGSISAFATAPTHVVMDISGYFGQ* |
| Ga0150983_147875212 | 3300011120 | Forest Soil | AVTSNMAIVSTTNGSVNAFGSNPTQLVLDIFGYFAP* |
| Ga0137392_108823451 | 3300011269 | Vadose Zone Soil | LWPQGAVQPFVSTLNAVDGFVTSNMAIVLTTNGSVSAFATNSTHLVLDISGYFAP* |
| Ga0137391_110464841 | 3300011270 | Vadose Zone Soil | AYDGAITNNMAIVPTTTGSISVFPSAPTHLVLDIFGYFAP* |
| Ga0137388_110174332 | 3300012189 | Vadose Zone Soil | TMWPQGQTQPPTATLNAYDATITNNMAIVPTTTGSISVFPSALTQLVLDVFGYFAP* |
| Ga0137377_114228562 | 3300012211 | Vadose Zone Soil | TLNAWDATVTSNMAIVPTTNGSVSAFANDSTHLVLDISAYFAP* |
| Ga0150985_1128668311 | 3300012212 | Avena Fatua Rhizosphere | LNSLDAAVTSNLAIVPTYNGSASAFASNTTHLALDLNGFFAP* |
| Ga0137360_107945362 | 3300012361 | Vadose Zone Soil | LWPNGTPQPGTSTLNAFDGAVTSNMAIVATNNGSVNVFTSSPTQLVLDIFGYFAP* |
| Ga0137361_117122682 | 3300012362 | Vadose Zone Soil | VPPAPLGFLTMWPQGQPQPPTATLNAGDGAVTSNLAIIATVNGSVSAFALNPTHLVLDVFGYFAP* |
| Ga0137390_107718111 | 3300012363 | Vadose Zone Soil | QPLAATLNDTDGAVTNNMAIVPTTTGSVSVFPIAPTHLVLDIFAYFAP* |
| Ga0150984_1234560292 | 3300012469 | Avena Fatua Rhizosphere | AGVATLNSLDAAVTSNMAIVPTYNGSASAFASNATQLVLDLNGFFAP* |
| Ga0137395_101865571 | 3300012917 | Vadose Zone Soil | GQPQPPTATLNAGDGAVTSNMAIIPTVNGSVSAFALNLTHLVVDVFAYFAP* |
| Ga0137395_111220931 | 3300012917 | Vadose Zone Soil | NAYDGAITNNMAIVPTTTGSISVFPSAPTHLVLDIFGYFAP* |
| Ga0137394_114155451 | 3300012922 | Vadose Zone Soil | MWPQGQPLPLAATLNAGDGAVTSNLAIIPTTNGSVSAFALNPTHLVLDIFGYFAP* |
| Ga0137416_117078912 | 3300012927 | Vadose Zone Soil | WPQGQPQPPTATLNAGDGAVTSNMAIIPTVNGSVSAFALSPTHLVLDVFGYFAP* |
| Ga0137416_118880521 | 3300012927 | Vadose Zone Soil | PTATLNAGDGAVTSNVAIIPTVNGSVSAFALSSTHLVLDVFGYFAP* |
| Ga0126369_128541231 | 3300012971 | Tropical Forest Soil | IDGAITSNLAIVPAANGSISIFGSNPTHVIMDISGYFVP* |
| Ga0164304_102940182 | 3300012986 | Soil | QPQPPTATLNAGDGAVTSNLGIIPTANGSVSTYAISPTHLVLDIFGYFAP* |
| Ga0164305_116589001 | 3300012989 | Soil | QGQMRPLAAGLNAYDGAVTNNMAIVPTTTGSVCVFPSAATHLVPDLFGYFAP* |
| Ga0164305_120891871 | 3300012989 | Soil | GQTQPLAATLNAYDGAVTNNMAIVPTTTGSISVFPSAPTHLILDLFGYFAP* |
| Ga0157370_118066561 | 3300013104 | Corn Rhizosphere | ITSNMAIVPATNGSISAFGTHPVDLILDMSGYFAP* |
| Ga0157369_103394844 | 3300013105 | Corn Rhizosphere | QPNASALNAPDGTVTSNMAIVPTTDGSISAFASQSTHLILDIFGYFAP* |
| Ga0157378_102065461 | 3300013297 | Miscanthus Rhizosphere | ATLNASDGAVTNNMAIIRTTNGAISAFATDLTHMVLDIFAYFAP* |
| Ga0157378_105558982 | 3300013297 | Miscanthus Rhizosphere | GAVTSNLAIVPATNGVISVFASNPTHLIVDIAGYFGQ* |
| Ga0157372_119823591 | 3300013307 | Corn Rhizosphere | LWPHGTGAQPNASALNAPDGTVTSNMAIVPTTDGSISAFASQSTHLILDIFGYFAP* |
| Ga0181518_103114781 | 3300014156 | Bog | TVTSNLAIVPTTNESISTFASNTTQLVLDLFAYFALP* |
| Ga0181538_103393491 | 3300014162 | Bog | LDQTVTSNLAIVPTTNLSISTFAANPSQLILDIFGFFAP* |
| Ga0181526_101621811 | 3300014200 | Bog | LNALDGAITSNMALVPTTNGSISSYVYVPSTTYLILDIFGYFAP* |
| Ga0181537_103962721 | 3300014201 | Bog | PLAATLSATDQTVTSNMAIVPASNGAISAFASNPTQLILDMFGFFAP* |
| Ga0182014_100835381 | 3300014491 | Bog | QTMPVVSTLNALDGAVTSNLAIVPTASGSISIFPSNPTHVVMDISGYFGP* |
| Ga0182014_101345181 | 3300014491 | Bog | QTMPVVSTLNALDGAVTSNLAIVPTASGSISIFPSNPTHVVLDISGYFAP* |
| Ga0182014_103731611 | 3300014491 | Bog | GQTMPVASTLNALDGSVTSNLAIVPTLDGSISVFPSNPTHVVMDISAYFGP* |
| Ga0182021_109424742 | 3300014502 | Fen | ITSNLAIVPTTNGSISAFPSNPTHLILDISGYFGQ* |
| Ga0181519_101976162 | 3300014658 | Bog | PQPVVSTLNAIDGDITSNLAIVPTNNTEISAFADSSTYLVLDLFGYFAP* |
| Ga0182030_112145471 | 3300014838 | Bog | PLAATLNAVDGAITSNMAIVPTTNGSITAYPSNPTYLILDIFGFFAP* |
| Ga0182027_100484385 | 3300014839 | Fen | MPVVSTLNALDGAVTSNLAIVPTASGSISVFPSNPTHVVMDISAYFGP* |
| Ga0167668_10511171 | 3300015193 | Glacier Forefield Soil | ATLNAGDGAVTSNMAIIPTVNGSVSAFALSPTHLVLDVFGYFAP* |
| Ga0167668_11029732 | 3300015193 | Glacier Forefield Soil | PWYDGAVTNNMAVVPTTTGSVSVFPLAPTQLVLDIFGYFAP* |
| Ga0137409_111046721 | 3300015245 | Vadose Zone Soil | AMLNAGDGAVTSNLAIIPTVNGSVSAFALNPTHLVLDVFGYFAP* |
| Ga0187782_116475061 | 3300017975 | Tropical Peatland | GASMPVVSTLNALDGAITSDMAIVPTTNGEISAYASNQTQLVLDLFGYFAP |
| Ga0181520_104361262 | 3300017988 | Bog | GAITSNMPLVPTANGSISSYVYVPTTTYLILDLFGYFAP |
| Ga0181520_104463813 | 3300017988 | Bog | STLNALDGAITSNMALVPTTNGSISSYVYVPSTTYLILDLFGYLAP |
| Ga0187863_100392991 | 3300018034 | Peatland | PLVATLSALDATVTSNLAIVPTTNGSISTFASNPTQLILDIFGFFAP |
| Ga0187863_103120962 | 3300018034 | Peatland | VSTLNALDGSITSNLAIVPTSNTQISAFADGSTYLVLDIFGYFAP |
| Ga0187883_100306002 | 3300018037 | Peatland | LWPQGIVQPVVSTLNAENGDITSNMAIVPTSNTQISAFASNTTYLVLDLFGYFAP |
| Ga0187855_103119602 | 3300018038 | Peatland | TQPVVSTLNALDGAITSNMALVPTTNGSISSYVYVPSTTYLILDVFGYFAP |
| Ga0187855_103382952 | 3300018038 | Peatland | ATLSATDQTVTSNMAIVPASNGAISAFASNPTQLILDMFGFFAP |
| Ga0187887_102731882 | 3300018043 | Peatland | QPLAATLSALDQTVTSNLAIVPTTNGSISTYAANPTQLVLDIFGYFGP |
| Ga0187890_102963471 | 3300018044 | Peatland | GITAANMAIVPTDNGSISAYVTNPTFLVLDIFGYFAP |
| Ga0187890_103892422 | 3300018044 | Peatland | ATDQTVTSNMAIVPASNGAISAFASNPTQLILDMFGFFAP |
| Ga0187890_107234931 | 3300018044 | Peatland | PLAATLSALDQTVTSNLAIVPTTNGSVSTYAANPTQLVLDLFGYFAP |
| Ga0137408_11906551 | 3300019789 | Vadose Zone Soil | LFRRLNAIDGSITSNLAIVPTNNGQISSFASNPVQLILDISGYFAP |
| Ga0210388_101322071 | 3300021181 | Soil | VTSNLAIVPGAGGSISVFPFNPTQLVLDLFGYFAP |
| Ga0213881_100806261 | 3300021374 | Exposed Rock | LNALDAAITSNLALVPTASGLLNAFASNPTHLILDISGFFAP |
| Ga0213881_101655831 | 3300021374 | Exposed Rock | NAVDGAITSNMALVPTNNGSISAFASNPTNLVLDIFGYFGP |
| Ga0213874_103040172 | 3300021377 | Plant Roots | NASALNAPDGAVTSNLAIVPATDGSVNAFASQSTHLILDISGYFAP |
| Ga0210383_113466421 | 3300021407 | Soil | ITSNMAIVPTTTGSISVFGSSPTYLILDNFGYIAP |
| Ga0210394_105552241 | 3300021420 | Soil | GAITNNMAIVPTKNGSISVFPSGPTQLVLDLFGYFAP |
| Ga0210409_101156921 | 3300021559 | Soil | DGAVTNNMAVVPATTGSVSVFPSAPTHLVLDIFGYFAP |
| Ga0242665_103467141 | 3300022724 | Soil | STLNAGDSAITSNMAIVSTTNGSISAFVPDPSHLVLDLSGFFGP |
| Ga0208078_10236953 | 3300025544 | Arctic Peat Soil | QVSTLNASDGAVTSNMAIVPTNNGSINVFVSNQTHVVLDIFGYFAP |
| Ga0207927_11172711 | 3300025579 | Arctic Peat Soil | GVSTLNALDASVTSNLAIVPTGNGSISAFASDPTHLILDISGYFGQ |
| Ga0207926_10978171 | 3300025619 | Arctic Peat Soil | LWQQGQTRPVVSTLNALDGAITSNLAIVPTGNGSISAFGSDMTHLILDISGYFGQ |
| Ga0207692_104406492 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NASDGAVTNNMAIIRTTNGAISAFATDLTHMVLDIFAYFAP |
| Ga0207699_107487681 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QPTVATLNAVDGALTSNLAIVPGTNGSISVFPSNPTHLVLDLFGYFAP |
| Ga0207699_112645582 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PQPRTATLNAGDGAVTSNLAIIPTANGSVSTYAISPTHLVLDIFGYFAP |
| Ga0207663_101858324 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVSTLNALDGAVTSNLAIVPTYNRSISAFPTNPVRLVLDMFGYFAP |
| Ga0207700_108230802 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QPTVATLNAVDGALTSNLAIVPSTNGSISVFPSNPTHLVLDLFGYFAP |
| Ga0207667_116638341 | 3300025949 | Corn Rhizosphere | VSTLNALDGAITSNLAIVPAAVGGSISAYASATTHLILDIFGYMAP |
| Ga0207702_117636701 | 3300026078 | Corn Rhizosphere | NAHDGAVTSNMAIVPTTNGLISAFGSNPVHLVLDISGYFAP |
| Ga0209139_100070072 | 3300027795 | Bog Forest Soil | VSTLNAPDGTITSNRAIVPTANGSINAYATNSTNLILDPSCHFAP |
| Ga0209167_100071075 | 3300027867 | Surface Soil | WPQGPARPLAATLNASDGAVTNNMAIIPTTNGSISAFATDPTHLVLDIFAYFAP |
| Ga0209583_101725711 | 3300027910 | Watersheds | GQPLPLASTLNAGDGAVTSNLAIIPTTNGSVSAFALNPTHLVLDIFAYFAP |
| Ga0209698_109043922 | 3300027911 | Watersheds | NSEGSVASNMAIVPTINGFIDAYASQPTYLIIDVYGYFAP |
| Ga0209062_10139995 | 3300027965 | Surface Soil | AVSSNMAIVPTTNANISAYASDPTFLILDLLGYFAP |
| Ga0222749_104497481 | 3300029636 | Soil | QGQSQPLVATLNAYDGAVTNNMAIVPATTGSISVFPSAPTHLVLDIFGYFAP |
| Ga0311352_104279731 | 3300029944 | Palsa | VTSNMAIVPTTNTDISAYATNDTYLVLDMFGYFAP |
| Ga0265328_103506772 | 3300031239 | Rhizosphere | WPQGIPQPVVSTLNALDGAITGNMAVVPSNNGSISIFAPQPTHLVLDLFGFFGQ |
| Ga0170820_163411842 | 3300031446 | Forest Soil | TLNAIDGAITSNLAIVPAANGSISIFGSNPTHVVMYISGYFLAP |
| Ga0302320_117407472 | 3300031524 | Bog | GQTRPVVSTLNALDGAITSNLAIVPTSNGSISVFPSNPTHLVVDIYGYFAQ |
| Ga0307474_109559502 | 3300031718 | Hardwood Forest Soil | LAATLNALDGAITSNMAIVPTTTGSISVFGSSPTYLILDNFGYIAP |
| Ga0307469_109916413 | 3300031720 | Hardwood Forest Soil | GFLTMWPQGQPQPLAATLNAGDGAVTSNLAIIPTNNGSVSAFAPSSTHLVLDVFAYFAP |
| Ga0307475_103606481 | 3300031754 | Hardwood Forest Soil | PRPLAATLNASDGAITNNMAIIPSTNGSISAFTTDPTHLILDIFAFFAP |
| Ga0307473_107346031 | 3300031820 | Hardwood Forest Soil | TLNSYDGAVTNNMTIVPTTTGSVSVFPFNPTHLVLDIFGYFAP |
| Ga0308175_1013293862 | 3300031938 | Soil | QAQAQPGVATVNALDRAVTSNMAIVPATSGSISAFASNLTHLILDIFGYFAP |
| Ga0308175_1014841263 | 3300031938 | Soil | QGQPQPTVATLNSLDGAVTSNLAIVPTSNGSTSAFATNVTHLVFDLNGFFAP |
| Ga0307479_104942241 | 3300031962 | Hardwood Forest Soil | FGYLTLWAQGQPQPLVATLNAIDGAITSNMAIVPTQNGSISVFALNPAHLVLDIFGYFAP |
| Ga0307479_108771001 | 3300031962 | Hardwood Forest Soil | PQGALGYLTLWAQGAAQPFVSTLNAWDATVTSNMAIVPTTNGSVSAFATDSTHLVLDISAYFAP |
| Ga0308176_123905471 | 3300031996 | Soil | LWPQGQVQPGVATLNALDGVVTSNLAIVPTANGSVSSYATNPSHLIVDLFGYFAP |
| Ga0307472_1007997842 | 3300032205 | Hardwood Forest Soil | LLPLAATLNASDGAVTNNMAIIRTTNGAISAFATDLTHLVLDIFAYFAP |
| Ga0307472_1025319551 | 3300032205 | Hardwood Forest Soil | ITNNMAIVPTTNGSISVFPSAPTHLVLDIFGYFAP |
| Ga0335079_104437711 | 3300032783 | Soil | AATLNALDGAITSNMAIVPTTNGSISVFGSNPTYLILDNFGYFAP |
| Ga0335078_100928262 | 3300032805 | Soil | VAAGHVGPMASTLNAADGAITGNMVIVPTANGSISAYASNQTQLVLDLFGYFAP |
| Ga0335069_102682591 | 3300032893 | Soil | VVATLNAVDGAVTSNLAIVPTNNGSISAFLSNPAYLVLDIFGYFAQ |
| Ga0335076_114332822 | 3300032955 | Soil | ITSNMAIVPTTNGSISVFGSNPTYLILDNFGYFAP |
| Ga0335073_109003203 | 3300033134 | Soil | EPVVSTLNAYDGAVTSNLAIVPTINGEIDSFASNWTNLILDVFGYFAP |
| Ga0335077_113623812 | 3300033158 | Soil | MASTLNAADGAITGNMVIVPTANGSISAYASNQTQLVLDLFGYFAP |
| Ga0334790_218268_402_539 | 3300033887 | Soil | ATLSALDATVTSNLADVPTTNGSISTFASNTTQLVLDLFAYFSLP |
| Ga0326724_0141985_1369_1500 | 3300034091 | Peat Soil | TLNAVDGAITNNMAIVPTANGSISAYASDPTHLILDIFGYFAP |
| Ga0370484_0008123_1_123 | 3300034125 | Untreated Peat Soil | ALDGAITSNLAIVPTTNGWIGAFASDPTHMVVDISGYFGQ |
| Ga0370484_0115511_13_141 | 3300034125 | Untreated Peat Soil | LNALDGAITSNLAIVPTTNGWISSFASDMAHLIVDISGYFGQ |
| ⦗Top⦘ |