NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047257

Metagenome / Metatranscriptome Family F047257

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047257
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 44 residues
Representative Sequence MGVEPEEEFISDDELKSLLERWVAPGPSRVLDKRIETSFAREF
Number of Associated Samples 117
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.33 %
% of genes near scaffold ends (potentially truncated) 99.33 %
% of genes from short scaffolds (< 2000 bps) 94.67 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(6.667 % of family members)
Environment Ontology (ENVO) Unclassified
(52.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(67.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.80%    β-sheet: 0.00%    Coil/Unstructured: 66.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF08281Sigma70_r4_2 91.33
PF00675Peptidase_M16 2.67
PF01209Ubie_methyltran 2.00
PF05193Peptidase_M16_C 1.33
PF07040DUF1326 0.67
PF04542Sigma70_r2 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 2.00
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 2.00
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.67
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.67
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.67
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.67
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101940807All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300003319|soilL2_10064795All Organisms → cellular organisms → Bacteria → Acidobacteria1080Open in IMG/M
3300004463|Ga0063356_101005850All Organisms → cellular organisms → Bacteria → Acidobacteria1191Open in IMG/M
3300004480|Ga0062592_101814112All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300005289|Ga0065704_10142123All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300005295|Ga0065707_10712652All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300005331|Ga0070670_100926696All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300005331|Ga0070670_101324236All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300005331|Ga0070670_101670490All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300005333|Ga0070677_10591904All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300005336|Ga0070680_101583535All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300005344|Ga0070661_101609336All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300005345|Ga0070692_10811815All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300005354|Ga0070675_102074872All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300005444|Ga0070694_101700964All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300005457|Ga0070662_100367921All Organisms → cellular organisms → Bacteria → Acidobacteria1181Open in IMG/M
3300005458|Ga0070681_10297219All Organisms → cellular organisms → Bacteria → Acidobacteria1525Open in IMG/M
3300005467|Ga0070706_101816715All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300005539|Ga0068853_101783624All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300005547|Ga0070693_100300567All Organisms → cellular organisms → Bacteria → Acidobacteria1082Open in IMG/M
3300005549|Ga0070704_100169023All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300005563|Ga0068855_101124355All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300005564|Ga0070664_102060414All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300005564|Ga0070664_102324182All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300005616|Ga0068852_101306048All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300005617|Ga0068859_101044794All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300005618|Ga0068864_100794634All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
3300005840|Ga0068870_10297417All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300005841|Ga0068863_100467960All Organisms → cellular organisms → Bacteria → Acidobacteria1238Open in IMG/M
3300005841|Ga0068863_102261475All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300005876|Ga0075300_1006668All Organisms → cellular organisms → Bacteria → Acidobacteria1212Open in IMG/M
3300006058|Ga0075432_10036478All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300006173|Ga0070716_101319151All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300006173|Ga0070716_101377190All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300006755|Ga0079222_10803477All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300006806|Ga0079220_11419890All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300006844|Ga0075428_102133740All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300006845|Ga0075421_101472967All Organisms → cellular organisms → Bacteria → Acidobacteria746Open in IMG/M
3300006853|Ga0075420_100392763All Organisms → cellular organisms → Bacteria → Acidobacteria1200Open in IMG/M
3300006881|Ga0068865_100445153All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300006894|Ga0079215_10652228All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300006904|Ga0075424_100155517All Organisms → cellular organisms → Bacteria2422Open in IMG/M
3300006904|Ga0075424_101017020All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300006914|Ga0075436_100034671All Organisms → cellular organisms → Bacteria → Acidobacteria3481Open in IMG/M
3300006918|Ga0079216_10047999All Organisms → cellular organisms → Bacteria1830Open in IMG/M
3300006954|Ga0079219_11584838All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300007004|Ga0079218_10012404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4288Open in IMG/M
3300007004|Ga0079218_13311429All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300009093|Ga0105240_11450866All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300009098|Ga0105245_11551374All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300009101|Ga0105247_10176523All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1423Open in IMG/M
3300009101|Ga0105247_11405095All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300009147|Ga0114129_10138936All Organisms → cellular organisms → Bacteria → Acidobacteria3332Open in IMG/M
3300009148|Ga0105243_10075353All Organisms → cellular organisms → Bacteria2738Open in IMG/M
3300009148|Ga0105243_10161056All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300009174|Ga0105241_10256729All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1484Open in IMG/M
3300009174|Ga0105241_10266538All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1458Open in IMG/M
3300009174|Ga0105241_10817691All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300009177|Ga0105248_10439607All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300009177|Ga0105248_11836639All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300009551|Ga0105238_11690995All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300009609|Ga0105347_1087331All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300010038|Ga0126315_10201935All Organisms → cellular organisms → Bacteria → Acidobacteria1198Open in IMG/M
3300010038|Ga0126315_10975175All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010042|Ga0126314_10184375All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1466Open in IMG/M
3300010045|Ga0126311_10697049All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300010123|Ga0127479_1016128All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300010166|Ga0126306_10161038All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300010166|Ga0126306_10263563All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1318Open in IMG/M
3300010166|Ga0126306_10750320All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300010362|Ga0126377_13584143All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300010373|Ga0134128_11038304All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300010375|Ga0105239_11483344All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300010397|Ga0134124_10412898All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300010399|Ga0134127_10363277All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1419Open in IMG/M
3300010399|Ga0134127_12223832All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300010400|Ga0134122_11050978All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300010403|Ga0134123_10764021All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300010403|Ga0134123_11958210All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300010403|Ga0134123_12161677All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300011119|Ga0105246_10260450All Organisms → cellular organisms → Bacteria → Acidobacteria1381Open in IMG/M
3300011119|Ga0105246_10472480All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300011332|Ga0126317_10288889All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300012203|Ga0137399_11472414All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300012930|Ga0137407_12077752All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300012957|Ga0164303_10596357All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300012960|Ga0164301_10117157All Organisms → cellular organisms → Bacteria → Acidobacteria1565Open in IMG/M
3300012960|Ga0164301_11746826All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300013100|Ga0157373_10266358All Organisms → cellular organisms → Bacteria → Acidobacteria1213Open in IMG/M
3300013100|Ga0157373_10576699All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300013100|Ga0157373_11478035All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300013102|Ga0157371_11387066All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300013296|Ga0157374_12582767All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300013297|Ga0157378_12267978All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300013297|Ga0157378_13084471All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300013308|Ga0157375_11210143All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300013308|Ga0157375_12527180All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300014263|Ga0075324_1016873All Organisms → cellular organisms → Bacteria → Acidobacteria1253Open in IMG/M
3300014325|Ga0163163_13043961All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300015371|Ga0132258_10333489All Organisms → cellular organisms → Bacteria3745Open in IMG/M
3300015372|Ga0132256_101960366All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300015372|Ga0132256_103228891All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300015373|Ga0132257_102362411All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300015374|Ga0132255_102399555All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300015374|Ga0132255_103314973All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300018422|Ga0190265_12356351All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300019254|Ga0184641_1303063All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300020018|Ga0193721_1165071All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300021307|Ga0179585_1096755All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300025893|Ga0207682_10565248All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300025908|Ga0207643_10214133All Organisms → cellular organisms → Bacteria → Acidobacteria1177Open in IMG/M
3300025911|Ga0207654_10108467All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300025911|Ga0207654_10195227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1329Open in IMG/M
3300025911|Ga0207654_10532588All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300025921|Ga0207652_10819256All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300025925|Ga0207650_11219727All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300025930|Ga0207701_11277794All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300025931|Ga0207644_10220797All Organisms → cellular organisms → Bacteria → Acidobacteria1502Open in IMG/M
3300025934|Ga0207686_10211260All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300025935|Ga0207709_10629519All Organisms → cellular organisms → Bacteria → Acidobacteria852Open in IMG/M
3300025936|Ga0207670_10782186All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300025936|Ga0207670_11063043All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300025938|Ga0207704_10087506All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300025942|Ga0207689_10731759All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300025945|Ga0207679_11371704All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300026035|Ga0207703_11431325All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300026071|Ga0208537_1011825All Organisms → cellular organisms → Bacteria → Acidobacteria1135Open in IMG/M
3300026075|Ga0207708_10728502All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300026088|Ga0207641_10192168All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1877Open in IMG/M
3300026095|Ga0207676_10505044All Organisms → cellular organisms → Bacteria → Acidobacteria1149Open in IMG/M
3300026095|Ga0207676_11282901All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300026095|Ga0207676_12480765All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300026116|Ga0207674_10874144All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300026121|Ga0207683_10665679All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300026121|Ga0207683_10869616All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300026142|Ga0207698_10888834All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300026142|Ga0207698_12283465All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300027527|Ga0209684_1066180All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300027530|Ga0209216_1001585All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4094Open in IMG/M
3300028380|Ga0268265_11553121All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300030511|Ga0268241_10128658All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300031548|Ga0307408_101570369All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300031716|Ga0310813_11179834All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300031740|Ga0307468_102419333All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300031852|Ga0307410_10836504All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300031854|Ga0310904_10282991All Organisms → cellular organisms → Bacteria → Acidobacteria1043Open in IMG/M
3300031908|Ga0310900_10878077All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300032000|Ga0310903_10062689All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300032075|Ga0310890_10818582All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300032159|Ga0268251_10495334All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.33%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.33%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.33%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.67%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.67%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.67%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005876Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010123Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026071Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027530Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10194080713300000364SoilMGVEPEDDFASDDQLKTLLERWTAPNPSRVLDKRIATSFNR
soilL2_1006479513300003319Sugarcane Root And Bulk SoilMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQS
Ga0063356_10100585033300004463Arabidopsis Thaliana RhizosphereMSRVEREEEFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFSGAAGL
Ga0062592_10181411213300004480SoilMGVEPEDKFDSDDELKALLERWTAAGPSRILDKRIETSFLREFSGAGALSQS
Ga0065704_1014212313300005289Switchgrass RhizosphereMSVRPEDEFVSDNELKSLLERWVAPQPSRVLDKRIETSFARE
Ga0065707_1071265223300005295Switchgrass RhizosphereMGDEPEDKFDSDGELKALLGRWTTAGPSRILDKRIESSFLREFSG
Ga0070670_10092669613300005331Switchgrass RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGA
Ga0070670_10132423623300005331Switchgrass RhizosphereMGVQPEDEIISDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQS
Ga0070670_10167049023300005331Switchgrass RhizosphereMGVEPGEEFISDDELKSLLERWNAPGPSRVLDERIETSFK
Ga0070677_1059190423300005333Miscanthus RhizosphereMGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFAREFS
Ga0070680_10158353513300005336Corn RhizosphereMGVEPEDKFDSEDELKALLERWTTPGPSRVLDKRIETSFA
Ga0070661_10160933623300005344Corn RhizosphereMGVRPEEEFVPDDELRSLLETWNAPEPSRVLDKRIITSFQREF
Ga0070692_1081181513300005345Corn, Switchgrass And Miscanthus RhizosphereMGVEPEEEFISDDELSSLLGRWVAPGPSRVLDKRIETSFAREFSGADR
Ga0070675_10207487223300005354Miscanthus RhizosphereMGVRPEDEFVPDDELRSLLQSWNAPEPSRVLDKRIITSFQ
Ga0070694_10170096413300005444Corn, Switchgrass And Miscanthus RhizosphereMSVEPEERFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGA
Ga0070662_10036792133300005457Corn RhizosphereMSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFS
Ga0070681_1029721933300005458Corn RhizosphereMGVEPENEFVSDDELKSLLERWNVPGPSRVLDKRIANSFAREFSGAD
Ga0070706_10181671523300005467Corn, Switchgrass And Miscanthus RhizosphereMGVEPEEEFVSDDQLKTLLERWIAPDPSRVLDKRITTSFQREFSGADGL
Ga0068853_10178362413300005539Corn RhizosphereMGVEPEEEFISDDELKSLLERWVAPGPSRVLDKRIETSFAREF
Ga0070693_10030056723300005547Corn, Switchgrass And Miscanthus RhizosphereMGVEPESEFVSDDELKSLLERWNAPGPSRVLDKRIANSFAREFSGA
Ga0070704_10016902333300005549Corn, Switchgrass And Miscanthus RhizosphereMGVEPEEGFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGA
Ga0068855_10112435513300005563Corn RhizosphereMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGADGLSQ
Ga0070664_10206041423300005564Corn RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAD
Ga0070664_10232418223300005564Corn RhizosphereMGVEPEEEFISDNELKSMLERWVAPGPSRVLDKRIETSFAREFSGADGL
Ga0068852_10130604813300005616Corn RhizosphereMSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSG
Ga0068859_10104479413300005617Switchgrass RhizosphereMAFEPEDEFVSDDELKTLLERWIVPGPSRVLDKRIATSFTREFSGADGLS
Ga0068864_10079463413300005618Switchgrass RhizosphereMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQ
Ga0068870_1029741713300005840Miscanthus RhizosphereMSVQPEDEFVSDDELRSLLERWVAPQPSRVLDKRIETSYAREFSGADRLSQS
Ga0068863_10046796033300005841Switchgrass RhizosphereMGVEPEEEFISDDELKSLLERWVAPGPSRVLDKRIETS
Ga0068863_10226147513300005841Switchgrass RhizosphereMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAD
Ga0075300_100666833300005876Rice Paddy SoilMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIE
Ga0075432_1003647833300006058Populus RhizosphereMGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIQTS
Ga0070716_10131915123300006173Corn, Switchgrass And Miscanthus RhizosphereMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGA
Ga0070716_10137719013300006173Corn, Switchgrass And Miscanthus RhizosphereMGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIA
Ga0079222_1080347723300006755Agricultural SoilMGVEPENEFVSDDELKSVLERWNAPGPSRVLDKRIA
Ga0079220_1141989023300006806Agricultural SoilMGVEPENELVSDDELKSVLERWNAPGPSRVLDKRIA
Ga0075428_10213374013300006844Populus RhizosphereMSGIEPDGFASEDELKSLLERWTAPGPSRVLDKRIETSFAREFSGADG
Ga0075421_10147296723300006845Populus RhizosphereMSVEPEEGFVSDDQLKSLLERWVAPGPSRTLDKRIETSFNREFSEGVS
Ga0075420_10039276313300006853Populus RhizosphereMGVEPEDKFDSEDELKALLERWTTPGPSRILDKRIETSFLREFSGADG
Ga0068865_10044515313300006881Miscanthus RhizosphereMSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAD
Ga0079215_1065222823300006894Agricultural SoilMGGELEDQFASDDELKSLLERWNAPGPSRVLDKRIATSFAR*
Ga0075424_10015551733300006904Populus RhizosphereMSVQPEDEFVSDDELKSLLERWVAPQPSRVLDKRIETSYAREFSGADRLSQS
Ga0075424_10101702013300006904Populus RhizosphereMGVEPEDGFVSDDELKSLLERWVAPGPSRVLDKRIE
Ga0075436_10003467113300006914Populus RhizosphereMGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIATSFAREFSGADGL
Ga0079216_1004799933300006918Agricultural SoilMGVESEDKFDSEDELKALLERWTTPGPSRVLDKRIETSFAREFSSAGERSG
Ga0079219_1158483823300006954Agricultural SoilMSVQPEDEFVSDDELKSLLKRWVAPEPSRVLDERIKTSF
Ga0079218_1001240453300007004Agricultural SoilMGVESEDKFDSEDELKALLERWTTPGPSRVLDKRIETSF
Ga0079218_1331142923300007004Agricultural SoilMSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRLSQ
Ga0105240_1145086613300009093Corn RhizosphereMGVEPEEEFVSDEELKSLLQRWVAPGPSRVLDKRIE
Ga0105245_1155137423300009098Miscanthus RhizosphereMGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIE
Ga0105247_1017652313300009101Switchgrass RhizosphereMSVQPEDEFVSDNELKALLKRWVAPEPSRVLDERIKTSFIREFSGADGL
Ga0105247_1140509513300009101Switchgrass RhizosphereMGVEPGEEFISDDELKSLLERWNAPGPSRVLDERIET
Ga0114129_1013893643300009147Populus RhizosphereMSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIE
Ga0105243_1007535333300009148Miscanthus RhizosphereMGVKPEEEFVSDDELSSLLERWVAPGPSRVLDKRI
Ga0105243_1016105633300009148Miscanthus RhizosphereMGVRPEDEFAPDDELRSLLETWNAPEPSRVLDKRIITSFQRE
Ga0105241_1025672933300009174Corn RhizosphereMGVQPEDEFISDDELKSLLERWIAPGPSRVLDKRVETSFA
Ga0105241_1026653813300009174Corn RhizosphereMGVEPEEGFISDDELKSLLERWVAPGPSRNLDKRIETS
Ga0105241_1081769123300009174Corn RhizosphereMGVEPEEDFISDNELKSLLERWVAPGPSRVLDKRIETSFA
Ga0105248_1043960733300009177Switchgrass RhizosphereMGVEPEEEFVSDDELSSLLERWVAPGPSRVLDKRIETSFAREFSGAD
Ga0105248_1183663923300009177Switchgrass RhizosphereMGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIASSFAR
Ga0105238_1169099513300009551Corn RhizosphereMGVEREEEFVSDNELKSLLERWVAPGPSGVLDKRIETSFAREFSGADGLSQS
Ga0105347_108733113300009609SoilMGVEPENEFVSDDELKSLLERWVAPGPSRVLDKRIATSFQQEVSGADR
Ga0126315_1020193523300010038Serpentine SoilMSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGL
Ga0126315_1097517523300010038Serpentine SoilMGVEPEEEFVSDEELKSLLERWVAPGPSRVLDKRIETSFAREFSG
Ga0126314_1018437533300010042Serpentine SoilMGVEPEESFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGA
Ga0126311_1069704923300010045Serpentine SoilMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADG
Ga0127479_101612813300010123Grasslands SoilMGVEPEDKIISDNELKSLLERWVAPGPSRVLDKRIETSFTREFSGAD
Ga0126306_1016103813300010166Serpentine SoilLGVEPEEELVSDNELKSLLERWIAPGPSRVLDKRIETS
Ga0126306_1026356313300010166Serpentine SoilMGVQPEEEFVSDNELKSLLERWVVPGPSRVLDKRIETSFAREFS
Ga0126306_1075032023300010166Serpentine SoilMGVEPEESFVSDEELKSLLERWVAPGPSRVLDKRIE
Ga0126377_1358414313300010362Tropical Forest SoilMGVEPENEFVSDDELKSLLERWNVPGPSRVLDKRI
Ga0134128_1103830413300010373Terrestrial SoilMGVEREEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREF
Ga0105239_1148334423300010375Corn RhizosphereMGVEPEEEFVSDDELSSLLGRWVAPRPSRVLDKRIETSFAREFSGADRLSQ
Ga0134124_1041289833300010397Terrestrial SoilMGVRPEDEFVPDHELRSLLETWNAPEPSRVLDKRII
Ga0134127_1036327733300010399Terrestrial SoilMSSVEREEEFLPEDELKALLERWIAPGPSKLLDKRVET
Ga0134127_1222383213300010399Terrestrial SoilMGVQPEDEIISDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRL
Ga0134122_1105097823300010400Terrestrial SoilMGVRPEDEFVPDGELRSLLESWNAPEPSRVLDKRIL
Ga0134123_1076402123300010403Terrestrial SoilMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAR
Ga0134123_1195821023300010403Terrestrial SoilMAFEPEDEFVSDDELKTLLERWIVPGPSRVLDKRIATSF
Ga0134123_1216167713300010403Terrestrial SoilMSVQPEDEFVSDDELKSLLERWVAPQPSRVLDKRIE
Ga0105246_1026045033300011119Miscanthus RhizosphereMGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIETSFARE
Ga0105246_1047248023300011119Miscanthus RhizosphereMGVQPEDELISDDELKSLLERWVAPGPSRVLDKRVE
Ga0126317_1028888913300011332SoilMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFARE
Ga0137399_1147241423300012203Vadose Zone SoilMSSIEPGEEFISEDELKPLLDAWIAPGPSRVLDKRIATSFSREFSGAD
Ga0137407_1207775213300012930Vadose Zone SoilMSGAGPGEEFISEDELKTLLESWIAPGPSRVLDERIATSFAREFSGADGLSRQV
Ga0164303_1059635713300012957SoilMGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIQTSFARE
Ga0164301_1011715713300012960SoilMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRSATSFNREFSGA
Ga0164301_1174682613300012960SoilMGVEPEDEFVSDDQLKTLLDRWIAPDPSRVLDKRI
Ga0157373_1026635833300013100Corn RhizosphereMGVEPEDEFVSDDELKTLLERWIAPGPSRVLDKRIATSFQREFSGADGLSQ
Ga0157373_1057669913300013100Corn RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSG
Ga0157373_1147803513300013100Corn RhizosphereMGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIETSFAREFSGAEEVVLMKF
Ga0157371_1138706613300013102Corn RhizosphereMGIEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIQTSFAREFSGAEE
Ga0157374_1258276723300013296Miscanthus RhizosphereMGVEPGEEFISDDELKSLLERWNAPGPSRVLDERIETSFKREFLGADRLP
Ga0157378_1226797823300013297Miscanthus RhizosphereMAFEPEDEFVSDDELKTLLERWIVPGPSRVLDKRIATSFTREFSGADGLSQ
Ga0157378_1308447113300013297Miscanthus RhizosphereMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAR
Ga0157375_1121014323300013308Miscanthus RhizosphereMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGADG
Ga0157375_1252718013300013308Miscanthus RhizosphereMGVEPEDKYDSEDELKALLERWTTPGPSRVLDKRIETSFAREFSG
Ga0075324_101687313300014263Natural And Restored WetlandsMGVEPEDKFDSEDELKALLERWITPGPSRVLDKRIETSFAREFSGADGL
Ga0163163_1304396113300014325Switchgrass RhizosphereMSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADR
Ga0132258_1033348913300015371Arabidopsis RhizosphereMGVEPESEFVSDDELKSLLERWNAPGPSRVLDKRIANS
Ga0132256_10196036623300015372Arabidopsis RhizosphereMSVEPEGDFASDDQLKTLLERWTAPGPSRVLDKRI
Ga0132256_10322889113300015372Arabidopsis RhizosphereMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGADGL
Ga0132257_10236241123300015373Arabidopsis RhizosphereMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFN
Ga0132255_10239955523300015374Arabidopsis RhizosphereMSVEPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATS
Ga0132255_10331497323300015374Arabidopsis RhizosphereMSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSF
Ga0190265_1235635123300018422SoilMSSVEREDEFASEDELKALLERWIAPGPSRVLDKRVATSFAREFSSADGLS
Ga0184641_130306323300019254Groundwater SedimentMGVEPGEEFISEDELKTLLERWIAPGPSRVLDKRIETSFAREFSGAD
Ga0193721_116507113300020018SoilMSSIEPEEEFISEDELKPLLEAWIAPGPSRVLDKRIATSFSREFSGADGLS
Ga0179585_109675513300021307Vadose Zone SoilMGVEPGNEFLSEDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGL
Ga0207682_1056524813300025893Miscanthus RhizosphereMGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFAREFSGADGLSRLTESE
Ga0207643_1021413313300025908Miscanthus RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREF
Ga0207654_1010846713300025911Corn RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQ
Ga0207654_1019522713300025911Corn RhizosphereMGVEPEEEFVSDDQLKTLLERWIAPDPSRVLDKRI
Ga0207654_1053258823300025911Corn RhizosphereMGVRPEDEFVPDGELRSLLENWNAPEPSRVLDKRI
Ga0207652_1081925623300025921Corn RhizosphereMGVEREEEFISDNELKSLLERWVAPGPSRVLDKRIETSFA
Ga0207650_1121972723300025925Switchgrass RhizosphereMGVEPEEEFVSDDELSSLLERWVTPGPSRVLDKRIKTSFAREFSRAE
Ga0207701_1127779413300025930Corn, Switchgrass And Miscanthus RhizosphereMGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFARE
Ga0207644_1022079713300025931Switchgrass RhizosphereMGVEPEEELVSDDQLKTLLERWIAPDPSRVLDKRITTSFQREFSGADGLSQ
Ga0207686_1021126033300025934Miscanthus RhizosphereMSSVEREEEFLPEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAVGPQSIP
Ga0207709_1062951913300025935Miscanthus RhizosphereMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGA
Ga0207670_1078218613300025936Switchgrass RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAGGLSQS
Ga0207670_1106304313300025936Switchgrass RhizosphereMGVEPEEEFVSDEELKSLLKRWVAPGPSRVLDKRIETSF
Ga0207704_1008750633300025938Miscanthus RhizosphereMSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAVGPQS
Ga0207689_1073175923300025942Miscanthus RhizosphereMGVEPEDKYDSEDELKALLERWTTPGPSRVLDKRIETSFAREFSGA
Ga0207679_1137170423300025945Corn RhizosphereMGVEPEDKFDSDDELKALLERWTTAGPSRILDKRI
Ga0207703_1143132523300026035Switchgrass RhizosphereMSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFARE
Ga0208537_101182533300026071Natural And Restored WetlandsMGVEPEDGFVSDDELKSLLERWVVPGPSGVLDKRIETSFAREFSGADRL
Ga0207708_1072850223300026075Corn, Switchgrass And Miscanthus RhizosphereMSSVEREEEFLPEDELKALLERWIAPGPSKLLDKRVETSFVR
Ga0207641_1019216813300026088Switchgrass RhizosphereMSVQPEDEFVSDDELKSLLERWVAPQPSRVLDKRIETSYARE
Ga0207676_1050504413300026095Switchgrass RhizosphereMGVEPEDKFDSDDELKALLERWTTAGPSRILDKRIETSFLREFYGA
Ga0207676_1128290113300026095Switchgrass RhizosphereMGVEPEEEFISDDELSSLLERWIAPGPSRVLDKRIETSFAREFSGAEE
Ga0207676_1248076513300026095Switchgrass RhizosphereMGVQPEDEIISDDELKSLLERRVAPGPSRVLDKRIETS
Ga0207674_1087414413300026116Corn RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSF
Ga0207683_1066567923300026121Miscanthus RhizosphereMGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFA
Ga0207683_1086961613300026121Miscanthus RhizosphereMGVEPEEEFVSDDQLKTLLERWIAPGPSRVLDKRIATS
Ga0207698_1088883423300026142Corn RhizosphereMGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAGG
Ga0207698_1228346523300026142Corn RhizosphereLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAVGPQSIPLPKREKR
Ga0209684_106618023300027527Tropical Forest SoilMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREF
Ga0209216_100158513300027530Forest SoilMGVEPENEFISDDELKSLLERWNAPGPSRVLDKRIANSFAREF
Ga0268265_1155312113300028380Switchgrass RhizosphereMSVQPEDEFVSDDELKSLLKRWVAPEPSRVLDERI
Ga0268241_1012865813300030511SoilMGVEPENEFLSDDELKSLLERWNVPGPSRVLDKRIANSFVREFSSADG
Ga0307408_10157036913300031548RhizosphereMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFS
Ga0310813_1117983413300031716SoilMGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIATSFAREFSG
Ga0307468_10241933313300031740Hardwood Forest SoilMGVEPEEEFVSDDELSSLLERWIAPGPSRVLDKRIETSFAREFSGA
Ga0307410_1083650413300031852RhizosphereMGVEPEESFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRLSQ
Ga0310904_1028299123300031854SoilMGVQPEDEIISDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRLSQ
Ga0310900_1087807713300031908SoilMSRVERDEDFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFSGAAGLS
Ga0310903_1006268933300032000SoilMSRVERDEEFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFS
Ga0310890_1081858223300032075SoilMSRVERDEDFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFSGA
Ga0268251_1049533413300032159AgaveMGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.