Basic Information | |
---|---|
Family ID | F047257 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 150 |
Average Sequence Length | 44 residues |
Representative Sequence | MGVEPEEEFISDDELKSLLERWVAPGPSRVLDKRIETSFAREF |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.33 % |
% of genes near scaffold ends (potentially truncated) | 99.33 % |
% of genes from short scaffolds (< 2000 bps) | 94.67 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (6.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF08281 | Sigma70_r4_2 | 91.33 |
PF00675 | Peptidase_M16 | 2.67 |
PF01209 | Ubie_methyltran | 2.00 |
PF05193 | Peptidase_M16_C | 1.33 |
PF07040 | DUF1326 | 0.67 |
PF04542 | Sigma70_r2 | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.00 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 2.00 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.67 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.67 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.67 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.67 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101940807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300003319|soilL2_10064795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
3300004463|Ga0063356_101005850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
3300004480|Ga0062592_101814112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300005289|Ga0065704_10142123 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300005295|Ga0065707_10712652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300005331|Ga0070670_100926696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300005331|Ga0070670_101324236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300005331|Ga0070670_101670490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300005333|Ga0070677_10591904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300005336|Ga0070680_101583535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300005344|Ga0070661_101609336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300005345|Ga0070692_10811815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300005354|Ga0070675_102074872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300005444|Ga0070694_101700964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300005457|Ga0070662_100367921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
3300005458|Ga0070681_10297219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
3300005467|Ga0070706_101816715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300005539|Ga0068853_101783624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300005547|Ga0070693_100300567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
3300005549|Ga0070704_100169023 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
3300005563|Ga0068855_101124355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300005564|Ga0070664_102060414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300005564|Ga0070664_102324182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300005616|Ga0068852_101306048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300005617|Ga0068859_101044794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300005618|Ga0068864_100794634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
3300005840|Ga0068870_10297417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
3300005841|Ga0068863_100467960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
3300005841|Ga0068863_102261475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300005876|Ga0075300_1006668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
3300006058|Ga0075432_10036478 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300006173|Ga0070716_101319151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300006173|Ga0070716_101377190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300006755|Ga0079222_10803477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300006806|Ga0079220_11419890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300006844|Ga0075428_102133740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300006845|Ga0075421_101472967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300006853|Ga0075420_100392763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
3300006881|Ga0068865_100445153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300006894|Ga0079215_10652228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300006904|Ga0075424_100155517 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
3300006904|Ga0075424_101017020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300006914|Ga0075436_100034671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3481 | Open in IMG/M |
3300006918|Ga0079216_10047999 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
3300006954|Ga0079219_11584838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300007004|Ga0079218_10012404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4288 | Open in IMG/M |
3300007004|Ga0079218_13311429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300009093|Ga0105240_11450866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300009098|Ga0105245_11551374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300009101|Ga0105247_10176523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1423 | Open in IMG/M |
3300009101|Ga0105247_11405095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300009147|Ga0114129_10138936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3332 | Open in IMG/M |
3300009148|Ga0105243_10075353 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
3300009148|Ga0105243_10161056 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300009174|Ga0105241_10256729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1484 | Open in IMG/M |
3300009174|Ga0105241_10266538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1458 | Open in IMG/M |
3300009174|Ga0105241_10817691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
3300009177|Ga0105248_10439607 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300009177|Ga0105248_11836639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300009551|Ga0105238_11690995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300009609|Ga0105347_1087331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
3300010038|Ga0126315_10201935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
3300010038|Ga0126315_10975175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300010042|Ga0126314_10184375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1466 | Open in IMG/M |
3300010045|Ga0126311_10697049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
3300010123|Ga0127479_1016128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300010166|Ga0126306_10161038 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300010166|Ga0126306_10263563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1318 | Open in IMG/M |
3300010166|Ga0126306_10750320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300010362|Ga0126377_13584143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300010373|Ga0134128_11038304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300010375|Ga0105239_11483344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300010397|Ga0134124_10412898 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300010399|Ga0134127_10363277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1419 | Open in IMG/M |
3300010399|Ga0134127_12223832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300010400|Ga0134122_11050978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300010403|Ga0134123_10764021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
3300010403|Ga0134123_11958210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300010403|Ga0134123_12161677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300011119|Ga0105246_10260450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
3300011119|Ga0105246_10472480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300011332|Ga0126317_10288889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300012203|Ga0137399_11472414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300012930|Ga0137407_12077752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300012957|Ga0164303_10596357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300012960|Ga0164301_10117157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
3300012960|Ga0164301_11746826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300013100|Ga0157373_10266358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
3300013100|Ga0157373_10576699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300013100|Ga0157373_11478035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300013102|Ga0157371_11387066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300013296|Ga0157374_12582767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300013297|Ga0157378_12267978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300013297|Ga0157378_13084471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300013308|Ga0157375_11210143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300013308|Ga0157375_12527180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300014263|Ga0075324_1016873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
3300014325|Ga0163163_13043961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300015371|Ga0132258_10333489 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
3300015372|Ga0132256_101960366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300015372|Ga0132256_103228891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300015373|Ga0132257_102362411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300015374|Ga0132255_102399555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300015374|Ga0132255_103314973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300018422|Ga0190265_12356351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300019254|Ga0184641_1303063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300020018|Ga0193721_1165071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300021307|Ga0179585_1096755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300025893|Ga0207682_10565248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300025908|Ga0207643_10214133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300025911|Ga0207654_10108467 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
3300025911|Ga0207654_10195227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
3300025911|Ga0207654_10532588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300025921|Ga0207652_10819256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300025925|Ga0207650_11219727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300025930|Ga0207701_11277794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300025931|Ga0207644_10220797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
3300025934|Ga0207686_10211260 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300025935|Ga0207709_10629519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300025936|Ga0207670_10782186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300025936|Ga0207670_11063043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300025938|Ga0207704_10087506 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
3300025942|Ga0207689_10731759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300025945|Ga0207679_11371704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300026035|Ga0207703_11431325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300026071|Ga0208537_1011825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
3300026075|Ga0207708_10728502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
3300026088|Ga0207641_10192168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1877 | Open in IMG/M |
3300026095|Ga0207676_10505044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
3300026095|Ga0207676_11282901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300026095|Ga0207676_12480765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300026116|Ga0207674_10874144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300026121|Ga0207683_10665679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300026121|Ga0207683_10869616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
3300026142|Ga0207698_10888834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300026142|Ga0207698_12283465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300027527|Ga0209684_1066180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300027530|Ga0209216_1001585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4094 | Open in IMG/M |
3300028380|Ga0268265_11553121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300030511|Ga0268241_10128658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300031548|Ga0307408_101570369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300031716|Ga0310813_11179834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300031740|Ga0307468_102419333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300031852|Ga0307410_10836504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300031854|Ga0310904_10282991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
3300031908|Ga0310900_10878077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300032000|Ga0310903_10062689 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300032075|Ga0310890_10818582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300032159|Ga0268251_10495334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.33% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.33% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.33% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.33% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.67% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.67% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.67% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026071 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1019408071 | 3300000364 | Soil | MGVEPEDDFASDDQLKTLLERWTAPNPSRVLDKRIATSFNR |
soilL2_100647951 | 3300003319 | Sugarcane Root And Bulk Soil | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQS |
Ga0063356_1010058503 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRVEREEEFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFSGAAGL |
Ga0062592_1018141121 | 3300004480 | Soil | MGVEPEDKFDSDDELKALLERWTAAGPSRILDKRIETSFLREFSGAGALSQS |
Ga0065704_101421231 | 3300005289 | Switchgrass Rhizosphere | MSVRPEDEFVSDNELKSLLERWVAPQPSRVLDKRIETSFARE |
Ga0065707_107126522 | 3300005295 | Switchgrass Rhizosphere | MGDEPEDKFDSDGELKALLGRWTTAGPSRILDKRIESSFLREFSG |
Ga0070670_1009266961 | 3300005331 | Switchgrass Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGA |
Ga0070670_1013242362 | 3300005331 | Switchgrass Rhizosphere | MGVQPEDEIISDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQS |
Ga0070670_1016704902 | 3300005331 | Switchgrass Rhizosphere | MGVEPGEEFISDDELKSLLERWNAPGPSRVLDERIETSFK |
Ga0070677_105919042 | 3300005333 | Miscanthus Rhizosphere | MGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFAREFS |
Ga0070680_1015835351 | 3300005336 | Corn Rhizosphere | MGVEPEDKFDSEDELKALLERWTTPGPSRVLDKRIETSFA |
Ga0070661_1016093362 | 3300005344 | Corn Rhizosphere | MGVRPEEEFVPDDELRSLLETWNAPEPSRVLDKRIITSFQREF |
Ga0070692_108118151 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVEPEEEFISDDELSSLLGRWVAPGPSRVLDKRIETSFAREFSGADR |
Ga0070675_1020748722 | 3300005354 | Miscanthus Rhizosphere | MGVRPEDEFVPDDELRSLLQSWNAPEPSRVLDKRIITSFQ |
Ga0070694_1017009641 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVEPEERFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGA |
Ga0070662_1003679213 | 3300005457 | Corn Rhizosphere | MSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFS |
Ga0070681_102972193 | 3300005458 | Corn Rhizosphere | MGVEPENEFVSDDELKSLLERWNVPGPSRVLDKRIANSFAREFSGAD |
Ga0070706_1018167152 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVEPEEEFVSDDQLKTLLERWIAPDPSRVLDKRITTSFQREFSGADGL |
Ga0068853_1017836241 | 3300005539 | Corn Rhizosphere | MGVEPEEEFISDDELKSLLERWVAPGPSRVLDKRIETSFAREF |
Ga0070693_1003005672 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVEPESEFVSDDELKSLLERWNAPGPSRVLDKRIANSFAREFSGA |
Ga0070704_1001690233 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVEPEEGFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGA |
Ga0068855_1011243551 | 3300005563 | Corn Rhizosphere | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGADGLSQ |
Ga0070664_1020604142 | 3300005564 | Corn Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAD |
Ga0070664_1023241822 | 3300005564 | Corn Rhizosphere | MGVEPEEEFISDNELKSMLERWVAPGPSRVLDKRIETSFAREFSGADGL |
Ga0068852_1013060481 | 3300005616 | Corn Rhizosphere | MSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSG |
Ga0068859_1010447941 | 3300005617 | Switchgrass Rhizosphere | MAFEPEDEFVSDDELKTLLERWIVPGPSRVLDKRIATSFTREFSGADGLS |
Ga0068864_1007946341 | 3300005618 | Switchgrass Rhizosphere | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQ |
Ga0068870_102974171 | 3300005840 | Miscanthus Rhizosphere | MSVQPEDEFVSDDELRSLLERWVAPQPSRVLDKRIETSYAREFSGADRLSQS |
Ga0068863_1004679603 | 3300005841 | Switchgrass Rhizosphere | MGVEPEEEFISDDELKSLLERWVAPGPSRVLDKRIETS |
Ga0068863_1022614751 | 3300005841 | Switchgrass Rhizosphere | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAD |
Ga0075300_10066683 | 3300005876 | Rice Paddy Soil | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIE |
Ga0075432_100364783 | 3300006058 | Populus Rhizosphere | MGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIQTS |
Ga0070716_1013191512 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGA |
Ga0070716_1013771901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIA |
Ga0079222_108034772 | 3300006755 | Agricultural Soil | MGVEPENEFVSDDELKSVLERWNAPGPSRVLDKRIA |
Ga0079220_114198902 | 3300006806 | Agricultural Soil | MGVEPENELVSDDELKSVLERWNAPGPSRVLDKRIA |
Ga0075428_1021337401 | 3300006844 | Populus Rhizosphere | MSGIEPDGFASEDELKSLLERWTAPGPSRVLDKRIETSFAREFSGADG |
Ga0075421_1014729672 | 3300006845 | Populus Rhizosphere | MSVEPEEGFVSDDQLKSLLERWVAPGPSRTLDKRIETSFNREFSEGVS |
Ga0075420_1003927631 | 3300006853 | Populus Rhizosphere | MGVEPEDKFDSEDELKALLERWTTPGPSRILDKRIETSFLREFSGADG |
Ga0068865_1004451531 | 3300006881 | Miscanthus Rhizosphere | MSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAD |
Ga0079215_106522282 | 3300006894 | Agricultural Soil | MGGELEDQFASDDELKSLLERWNAPGPSRVLDKRIATSFAR* |
Ga0075424_1001555173 | 3300006904 | Populus Rhizosphere | MSVQPEDEFVSDDELKSLLERWVAPQPSRVLDKRIETSYAREFSGADRLSQS |
Ga0075424_1010170201 | 3300006904 | Populus Rhizosphere | MGVEPEDGFVSDDELKSLLERWVAPGPSRVLDKRIE |
Ga0075436_1000346711 | 3300006914 | Populus Rhizosphere | MGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIATSFAREFSGADGL |
Ga0079216_100479993 | 3300006918 | Agricultural Soil | MGVESEDKFDSEDELKALLERWTTPGPSRVLDKRIETSFAREFSSAGERSG |
Ga0079219_115848382 | 3300006954 | Agricultural Soil | MSVQPEDEFVSDDELKSLLKRWVAPEPSRVLDERIKTSF |
Ga0079218_100124045 | 3300007004 | Agricultural Soil | MGVESEDKFDSEDELKALLERWTTPGPSRVLDKRIETSF |
Ga0079218_133114292 | 3300007004 | Agricultural Soil | MSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRLSQ |
Ga0105240_114508661 | 3300009093 | Corn Rhizosphere | MGVEPEEEFVSDEELKSLLQRWVAPGPSRVLDKRIE |
Ga0105245_115513742 | 3300009098 | Miscanthus Rhizosphere | MGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIE |
Ga0105247_101765231 | 3300009101 | Switchgrass Rhizosphere | MSVQPEDEFVSDNELKALLKRWVAPEPSRVLDERIKTSFIREFSGADGL |
Ga0105247_114050951 | 3300009101 | Switchgrass Rhizosphere | MGVEPGEEFISDDELKSLLERWNAPGPSRVLDERIET |
Ga0114129_101389364 | 3300009147 | Populus Rhizosphere | MSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIE |
Ga0105243_100753533 | 3300009148 | Miscanthus Rhizosphere | MGVKPEEEFVSDDELSSLLERWVAPGPSRVLDKRI |
Ga0105243_101610563 | 3300009148 | Miscanthus Rhizosphere | MGVRPEDEFAPDDELRSLLETWNAPEPSRVLDKRIITSFQRE |
Ga0105241_102567293 | 3300009174 | Corn Rhizosphere | MGVQPEDEFISDDELKSLLERWIAPGPSRVLDKRVETSFA |
Ga0105241_102665381 | 3300009174 | Corn Rhizosphere | MGVEPEEGFISDDELKSLLERWVAPGPSRNLDKRIETS |
Ga0105241_108176912 | 3300009174 | Corn Rhizosphere | MGVEPEEDFISDNELKSLLERWVAPGPSRVLDKRIETSFA |
Ga0105248_104396073 | 3300009177 | Switchgrass Rhizosphere | MGVEPEEEFVSDDELSSLLERWVAPGPSRVLDKRIETSFAREFSGAD |
Ga0105248_118366392 | 3300009177 | Switchgrass Rhizosphere | MGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIASSFAR |
Ga0105238_116909951 | 3300009551 | Corn Rhizosphere | MGVEREEEFVSDNELKSLLERWVAPGPSGVLDKRIETSFAREFSGADGLSQS |
Ga0105347_10873311 | 3300009609 | Soil | MGVEPENEFVSDDELKSLLERWVAPGPSRVLDKRIATSFQQEVSGADR |
Ga0126315_102019352 | 3300010038 | Serpentine Soil | MSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGL |
Ga0126315_109751752 | 3300010038 | Serpentine Soil | MGVEPEEEFVSDEELKSLLERWVAPGPSRVLDKRIETSFAREFSG |
Ga0126314_101843753 | 3300010042 | Serpentine Soil | MGVEPEESFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGA |
Ga0126311_106970492 | 3300010045 | Serpentine Soil | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADG |
Ga0127479_10161281 | 3300010123 | Grasslands Soil | MGVEPEDKIISDNELKSLLERWVAPGPSRVLDKRIETSFTREFSGAD |
Ga0126306_101610381 | 3300010166 | Serpentine Soil | LGVEPEEELVSDNELKSLLERWIAPGPSRVLDKRIETS |
Ga0126306_102635631 | 3300010166 | Serpentine Soil | MGVQPEEEFVSDNELKSLLERWVVPGPSRVLDKRIETSFAREFS |
Ga0126306_107503202 | 3300010166 | Serpentine Soil | MGVEPEESFVSDEELKSLLERWVAPGPSRVLDKRIE |
Ga0126377_135841431 | 3300010362 | Tropical Forest Soil | MGVEPENEFVSDDELKSLLERWNVPGPSRVLDKRI |
Ga0134128_110383041 | 3300010373 | Terrestrial Soil | MGVEREEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREF |
Ga0105239_114833442 | 3300010375 | Corn Rhizosphere | MGVEPEEEFVSDDELSSLLGRWVAPRPSRVLDKRIETSFAREFSGADRLSQ |
Ga0134124_104128983 | 3300010397 | Terrestrial Soil | MGVRPEDEFVPDHELRSLLETWNAPEPSRVLDKRII |
Ga0134127_103632773 | 3300010399 | Terrestrial Soil | MSSVEREEEFLPEDELKALLERWIAPGPSKLLDKRVET |
Ga0134127_122238321 | 3300010399 | Terrestrial Soil | MGVQPEDEIISDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRL |
Ga0134122_110509782 | 3300010400 | Terrestrial Soil | MGVRPEDEFVPDGELRSLLESWNAPEPSRVLDKRIL |
Ga0134123_107640212 | 3300010403 | Terrestrial Soil | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAR |
Ga0134123_119582102 | 3300010403 | Terrestrial Soil | MAFEPEDEFVSDDELKTLLERWIVPGPSRVLDKRIATSF |
Ga0134123_121616771 | 3300010403 | Terrestrial Soil | MSVQPEDEFVSDDELKSLLERWVAPQPSRVLDKRIE |
Ga0105246_102604503 | 3300011119 | Miscanthus Rhizosphere | MGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIETSFARE |
Ga0105246_104724802 | 3300011119 | Miscanthus Rhizosphere | MGVQPEDELISDDELKSLLERWVAPGPSRVLDKRVE |
Ga0126317_102888891 | 3300011332 | Soil | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFARE |
Ga0137399_114724142 | 3300012203 | Vadose Zone Soil | MSSIEPGEEFISEDELKPLLDAWIAPGPSRVLDKRIATSFSREFSGAD |
Ga0137407_120777521 | 3300012930 | Vadose Zone Soil | MSGAGPGEEFISEDELKTLLESWIAPGPSRVLDERIATSFAREFSGADGLSRQV |
Ga0164303_105963571 | 3300012957 | Soil | MGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIQTSFARE |
Ga0164301_101171571 | 3300012960 | Soil | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRSATSFNREFSGA |
Ga0164301_117468261 | 3300012960 | Soil | MGVEPEDEFVSDDQLKTLLDRWIAPDPSRVLDKRI |
Ga0157373_102663583 | 3300013100 | Corn Rhizosphere | MGVEPEDEFVSDDELKTLLERWIAPGPSRVLDKRIATSFQREFSGADGLSQ |
Ga0157373_105766991 | 3300013100 | Corn Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSG |
Ga0157373_114780351 | 3300013100 | Corn Rhizosphere | MGVEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIETSFAREFSGAEEVVLMKF |
Ga0157371_113870661 | 3300013102 | Corn Rhizosphere | MGIEPEEEFVSDDELSSLLGRWVAPGPSRVLDKRIQTSFAREFSGAEE |
Ga0157374_125827672 | 3300013296 | Miscanthus Rhizosphere | MGVEPGEEFISDDELKSLLERWNAPGPSRVLDERIETSFKREFLGADRLP |
Ga0157378_122679782 | 3300013297 | Miscanthus Rhizosphere | MAFEPEDEFVSDDELKTLLERWIVPGPSRVLDKRIATSFTREFSGADGLSQ |
Ga0157378_130844711 | 3300013297 | Miscanthus Rhizosphere | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAR |
Ga0157375_112101432 | 3300013308 | Miscanthus Rhizosphere | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGADG |
Ga0157375_125271801 | 3300013308 | Miscanthus Rhizosphere | MGVEPEDKYDSEDELKALLERWTTPGPSRVLDKRIETSFAREFSG |
Ga0075324_10168731 | 3300014263 | Natural And Restored Wetlands | MGVEPEDKFDSEDELKALLERWITPGPSRVLDKRIETSFAREFSGADGL |
Ga0163163_130439611 | 3300014325 | Switchgrass Rhizosphere | MSVQPEDEFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADR |
Ga0132258_103334891 | 3300015371 | Arabidopsis Rhizosphere | MGVEPESEFVSDDELKSLLERWNAPGPSRVLDKRIANS |
Ga0132256_1019603662 | 3300015372 | Arabidopsis Rhizosphere | MSVEPEGDFASDDQLKTLLERWTAPGPSRVLDKRI |
Ga0132256_1032288911 | 3300015372 | Arabidopsis Rhizosphere | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFNREFSGADGL |
Ga0132257_1023624112 | 3300015373 | Arabidopsis Rhizosphere | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSFN |
Ga0132255_1023995552 | 3300015374 | Arabidopsis Rhizosphere | MSVEPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATS |
Ga0132255_1033149732 | 3300015374 | Arabidopsis Rhizosphere | MSVGPEGDFASDDQLKTLLERWTAPGPSRVLDKRIATSF |
Ga0190265_123563512 | 3300018422 | Soil | MSSVEREDEFASEDELKALLERWIAPGPSRVLDKRVATSFAREFSSADGLS |
Ga0184641_13030632 | 3300019254 | Groundwater Sediment | MGVEPGEEFISEDELKTLLERWIAPGPSRVLDKRIETSFAREFSGAD |
Ga0193721_11650711 | 3300020018 | Soil | MSSIEPEEEFISEDELKPLLEAWIAPGPSRVLDKRIATSFSREFSGADGLS |
Ga0179585_10967551 | 3300021307 | Vadose Zone Soil | MGVEPGNEFLSEDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGL |
Ga0207682_105652481 | 3300025893 | Miscanthus Rhizosphere | MGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFAREFSGADGLSRLTESE |
Ga0207643_102141331 | 3300025908 | Miscanthus Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREF |
Ga0207654_101084671 | 3300025911 | Corn Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLSQ |
Ga0207654_101952271 | 3300025911 | Corn Rhizosphere | MGVEPEEEFVSDDQLKTLLERWIAPDPSRVLDKRI |
Ga0207654_105325882 | 3300025911 | Corn Rhizosphere | MGVRPEDEFVPDGELRSLLENWNAPEPSRVLDKRI |
Ga0207652_108192562 | 3300025921 | Corn Rhizosphere | MGVEREEEFISDNELKSLLERWVAPGPSRVLDKRIETSFA |
Ga0207650_112197272 | 3300025925 | Switchgrass Rhizosphere | MGVEPEEEFVSDDELSSLLERWVTPGPSRVLDKRIKTSFAREFSRAE |
Ga0207701_112777941 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFARE |
Ga0207644_102207971 | 3300025931 | Switchgrass Rhizosphere | MGVEPEEELVSDDQLKTLLERWIAPDPSRVLDKRITTSFQREFSGADGLSQ |
Ga0207686_102112603 | 3300025934 | Miscanthus Rhizosphere | MSSVEREEEFLPEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAVGPQSIP |
Ga0207709_106295191 | 3300025935 | Miscanthus Rhizosphere | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGA |
Ga0207670_107821861 | 3300025936 | Switchgrass Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAGGLSQS |
Ga0207670_110630431 | 3300025936 | Switchgrass Rhizosphere | MGVEPEEEFVSDEELKSLLKRWVAPGPSRVLDKRIETSF |
Ga0207704_100875063 | 3300025938 | Miscanthus Rhizosphere | MSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAVGPQS |
Ga0207689_107317592 | 3300025942 | Miscanthus Rhizosphere | MGVEPEDKYDSEDELKALLERWTTPGPSRVLDKRIETSFAREFSGA |
Ga0207679_113717042 | 3300025945 | Corn Rhizosphere | MGVEPEDKFDSDDELKALLERWTTAGPSRILDKRI |
Ga0207703_114313252 | 3300026035 | Switchgrass Rhizosphere | MSRVERGEEFLSEDELKALLERWMAPGPSKLLDKRVETSFARE |
Ga0208537_10118253 | 3300026071 | Natural And Restored Wetlands | MGVEPEDGFVSDDELKSLLERWVVPGPSGVLDKRIETSFAREFSGADRL |
Ga0207708_107285022 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSVEREEEFLPEDELKALLERWIAPGPSKLLDKRVETSFVR |
Ga0207641_101921681 | 3300026088 | Switchgrass Rhizosphere | MSVQPEDEFVSDDELKSLLERWVAPQPSRVLDKRIETSYARE |
Ga0207676_105050441 | 3300026095 | Switchgrass Rhizosphere | MGVEPEDKFDSDDELKALLERWTTAGPSRILDKRIETSFLREFYGA |
Ga0207676_112829011 | 3300026095 | Switchgrass Rhizosphere | MGVEPEEEFISDDELSSLLERWIAPGPSRVLDKRIETSFAREFSGAEE |
Ga0207676_124807651 | 3300026095 | Switchgrass Rhizosphere | MGVQPEDEIISDDELKSLLERRVAPGPSRVLDKRIETS |
Ga0207674_108741441 | 3300026116 | Corn Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSF |
Ga0207683_106656792 | 3300026121 | Miscanthus Rhizosphere | MGVQPEDKFDSEDELRALLERWTTPGPSRVLDKRIETSFA |
Ga0207683_108696161 | 3300026121 | Miscanthus Rhizosphere | MGVEPEEEFVSDDQLKTLLERWIAPGPSRVLDKRIATS |
Ga0207698_108888342 | 3300026142 | Corn Rhizosphere | MGVEPEEEFVSDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGAGG |
Ga0207698_122834652 | 3300026142 | Corn Rhizosphere | LSEDELKALLERWMAPGPSKLLDKRVETSFAREFSGAVGPQSIPLPKREKR |
Ga0209684_10661802 | 3300027527 | Tropical Forest Soil | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREF |
Ga0209216_10015851 | 3300027530 | Forest Soil | MGVEPENEFISDDELKSLLERWNAPGPSRVLDKRIANSFAREF |
Ga0268265_115531211 | 3300028380 | Switchgrass Rhizosphere | MSVQPEDEFVSDDELKSLLKRWVAPEPSRVLDERI |
Ga0268241_101286581 | 3300030511 | Soil | MGVEPENEFLSDDELKSLLERWNVPGPSRVLDKRIANSFVREFSSADG |
Ga0307408_1015703691 | 3300031548 | Rhizosphere | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFS |
Ga0310813_111798341 | 3300031716 | Soil | MGVEPENEFVSDDELKSLLERWNAPGPSRVLDKRIATSFAREFSG |
Ga0307468_1024193331 | 3300031740 | Hardwood Forest Soil | MGVEPEEEFVSDDELSSLLERWIAPGPSRVLDKRIETSFAREFSGA |
Ga0307410_108365041 | 3300031852 | Rhizosphere | MGVEPEESFVSDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRLSQ |
Ga0310904_102829912 | 3300031854 | Soil | MGVQPEDEIISDDELKSLLERWVAPGPSRVLDKRIETSFAREFSGADRLSQ |
Ga0310900_108780771 | 3300031908 | Soil | MSRVERDEDFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFSGAAGLS |
Ga0310903_100626893 | 3300032000 | Soil | MSRVERDEEFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFS |
Ga0310890_108185822 | 3300032075 | Soil | MSRVERDEDFVSEDDLKALLERWIAPGPSKLLDKRIETSFAREFSGA |
Ga0268251_104953341 | 3300032159 | Agave | MGVEPEEEFISDNELKSLLERWVAPGPSRVLDKRIETSFAREFSGADGLS |
⦗Top⦘ |