| Basic Information | |
|---|---|
| Family ID | F047227 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.33 % |
| % of genes near scaffold ends (potentially truncated) | 81.33 % |
| % of genes from short scaffolds (< 2000 bps) | 89.33 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00472 | RF-1 | 16.00 |
| PF01266 | DAO | 5.33 |
| PF01872 | RibD_C | 4.67 |
| PF00067 | p450 | 4.00 |
| PF00877 | NLPC_P60 | 3.33 |
| PF13649 | Methyltransf_25 | 3.33 |
| PF01717 | Meth_synt_2 | 2.67 |
| PF00664 | ABC_membrane | 2.67 |
| PF00406 | ADK | 2.67 |
| PF05988 | DUF899 | 2.00 |
| PF00144 | Beta-lactamase | 1.33 |
| PF03807 | F420_oxidored | 1.33 |
| PF06719 | AraC_N | 1.33 |
| PF00355 | Rieske | 1.33 |
| PF05050 | Methyltransf_21 | 1.33 |
| PF00300 | His_Phos_1 | 0.67 |
| PF07690 | MFS_1 | 0.67 |
| PF12697 | Abhydrolase_6 | 0.67 |
| PF13340 | DUF4096 | 0.67 |
| PF00484 | Pro_CA | 0.67 |
| PF01553 | Acyltransferase | 0.67 |
| PF11716 | MDMPI_N | 0.67 |
| PF01842 | ACT | 0.67 |
| PF08669 | GCV_T_C | 0.67 |
| PF09107 | SelB-wing_3 | 0.67 |
| PF01966 | HD | 0.67 |
| PF13602 | ADH_zinc_N_2 | 0.67 |
| PF00440 | TetR_N | 0.67 |
| PF12680 | SnoaL_2 | 0.67 |
| PF12802 | MarR_2 | 0.67 |
| PF03437 | BtpA | 0.67 |
| PF02852 | Pyr_redox_dim | 0.67 |
| PF16177 | ACAS_N | 0.67 |
| PF13561 | adh_short_C2 | 0.67 |
| PF13191 | AAA_16 | 0.67 |
| PF00106 | adh_short | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 16.00 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 16.00 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 4.67 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 4.67 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 4.00 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 3.33 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 2.67 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.67 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 2.00 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.33 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.33 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.33 |
| COG4977 | Transcriptional regulator GlxA, contains an amidase domain and an AraC-type DNA-binding HTH domain | Transcription [K] | 1.33 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.67 |
| COG0434 | Membrane biogenesis protein, BtpA/SgcQ family | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.67 % |
| Unclassified | root | N/A | 13.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001664|P5cmW16_1079796 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300004281|Ga0066397_10156146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus siccatus | 525 | Open in IMG/M |
| 3300005331|Ga0070670_100388269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1231 | Open in IMG/M |
| 3300005332|Ga0066388_102920862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300005332|Ga0066388_103612743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 789 | Open in IMG/M |
| 3300005764|Ga0066903_100181176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3106 | Open in IMG/M |
| 3300005764|Ga0066903_107996717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300005983|Ga0081540_1000302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 50973 | Open in IMG/M |
| 3300005983|Ga0081540_1067439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1672 | Open in IMG/M |
| 3300006175|Ga0070712_100406100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 3300006796|Ga0066665_10738103 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006871|Ga0075434_100997355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300006880|Ga0075429_100780282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 837 | Open in IMG/M |
| 3300006904|Ga0075424_102078013 | Not Available | 599 | Open in IMG/M |
| 3300009143|Ga0099792_10855545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 599 | Open in IMG/M |
| 3300009520|Ga0116214_1101230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300009525|Ga0116220_10012437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3381 | Open in IMG/M |
| 3300009792|Ga0126374_10165389 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300010043|Ga0126380_10195529 | Not Available | 1348 | Open in IMG/M |
| 3300010046|Ga0126384_12199203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300010048|Ga0126373_10894514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
| 3300010048|Ga0126373_11413677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300010048|Ga0126373_11741875 | Not Available | 687 | Open in IMG/M |
| 3300010333|Ga0134080_10383770 | Not Available | 647 | Open in IMG/M |
| 3300010358|Ga0126370_11126155 | Not Available | 725 | Open in IMG/M |
| 3300010361|Ga0126378_10700348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300010362|Ga0126377_11097905 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010366|Ga0126379_13197340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300010376|Ga0126381_104618286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300010396|Ga0134126_11607935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica | 715 | Open in IMG/M |
| 3300010398|Ga0126383_12107299 | Not Available | 651 | Open in IMG/M |
| 3300011270|Ga0137391_11012992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 675 | Open in IMG/M |
| 3300011998|Ga0120114_1116809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300012008|Ga0120174_1097065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300012206|Ga0137380_10211911 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300012207|Ga0137381_10035234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4063 | Open in IMG/M |
| 3300012207|Ga0137381_10302977 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300012208|Ga0137376_10780618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300012209|Ga0137379_10168206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2104 | Open in IMG/M |
| 3300012211|Ga0137377_10440374 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300012349|Ga0137387_11003218 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012350|Ga0137372_10924089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 616 | Open in IMG/M |
| 3300012351|Ga0137386_10043998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3072 | Open in IMG/M |
| 3300012353|Ga0137367_10075932 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300012354|Ga0137366_10078899 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
| 3300012532|Ga0137373_10204155 | Not Available | 1625 | Open in IMG/M |
| 3300012971|Ga0126369_10952552 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300014489|Ga0182018_10686742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 534 | Open in IMG/M |
| 3300016294|Ga0182041_10365722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300016294|Ga0182041_11285076 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300016341|Ga0182035_10255339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1417 | Open in IMG/M |
| 3300016341|Ga0182035_10417696 | Not Available | 1130 | Open in IMG/M |
| 3300016341|Ga0182035_10933204 | Not Available | 767 | Open in IMG/M |
| 3300016371|Ga0182034_10188419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1585 | Open in IMG/M |
| 3300016445|Ga0182038_10294341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
| 3300017928|Ga0187806_1037668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1446 | Open in IMG/M |
| 3300017930|Ga0187825_10304688 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300017942|Ga0187808_10299499 | Not Available | 724 | Open in IMG/M |
| 3300017943|Ga0187819_10662681 | Not Available | 589 | Open in IMG/M |
| 3300017966|Ga0187776_10528598 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300017970|Ga0187783_10179187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1560 | Open in IMG/M |
| 3300017974|Ga0187777_10535215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium pseudokansasii | 821 | Open in IMG/M |
| 3300018060|Ga0187765_10705043 | Not Available | 663 | Open in IMG/M |
| 3300018064|Ga0187773_10823006 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300020080|Ga0206350_10620732 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300020582|Ga0210395_10758705 | Not Available | 724 | Open in IMG/M |
| 3300021406|Ga0210386_11272637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300021433|Ga0210391_11463663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300021475|Ga0210392_10820955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300021477|Ga0210398_10420883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1089 | Open in IMG/M |
| 3300021560|Ga0126371_10120781 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300022510|Ga0242652_1003289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1281 | Open in IMG/M |
| 3300022523|Ga0242663_1102076 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300022726|Ga0242654_10184373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
| 3300022727|Ga0224567_103584 | Not Available | 555 | Open in IMG/M |
| 3300025906|Ga0207699_10078068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2044 | Open in IMG/M |
| 3300025906|Ga0207699_10755059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300025915|Ga0207693_10140354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1900 | Open in IMG/M |
| 3300025929|Ga0207664_10167100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1880 | Open in IMG/M |
| 3300025929|Ga0207664_10241837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1572 | Open in IMG/M |
| 3300026041|Ga0207639_10612112 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300026121|Ga0207683_11036231 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026300|Ga0209027_1156760 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300026555|Ga0179593_1135282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2994 | Open in IMG/M |
| 3300027646|Ga0209466_1029109 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300027654|Ga0209799_1117221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007 | 606 | Open in IMG/M |
| 3300027817|Ga0209112_10026771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
| 3300028768|Ga0307280_10275884 | Not Available | 609 | Open in IMG/M |
| 3300028885|Ga0307304_10156203 | Not Available | 954 | Open in IMG/M |
| 3300031544|Ga0318534_10769508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300031572|Ga0318515_10040205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2319 | Open in IMG/M |
| 3300031572|Ga0318515_10290820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 876 | Open in IMG/M |
| 3300031572|Ga0318515_10678616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031668|Ga0318542_10446999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300031682|Ga0318560_10271197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 913 | Open in IMG/M |
| 3300031708|Ga0310686_107007827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300031713|Ga0318496_10140465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1315 | Open in IMG/M |
| 3300031713|Ga0318496_10609556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → unclassified Nitriliruptor → Nitriliruptor sp. | 603 | Open in IMG/M |
| 3300031720|Ga0307469_11825800 | Not Available | 588 | Open in IMG/M |
| 3300031723|Ga0318493_10402313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300031724|Ga0318500_10703027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300031736|Ga0318501_10138831 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300031744|Ga0306918_10220658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1437 | Open in IMG/M |
| 3300031744|Ga0306918_10903559 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031747|Ga0318502_11025113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300031748|Ga0318492_10392256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
| 3300031751|Ga0318494_10080831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1766 | Open in IMG/M |
| 3300031765|Ga0318554_10249080 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031770|Ga0318521_10105662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1556 | Open in IMG/M |
| 3300031770|Ga0318521_10421130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300031771|Ga0318546_10177886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1445 | Open in IMG/M |
| 3300031778|Ga0318498_10141474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1094 | Open in IMG/M |
| 3300031778|Ga0318498_10157827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300031779|Ga0318566_10041098 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300031781|Ga0318547_10340710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300031782|Ga0318552_10069957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1694 | Open in IMG/M |
| 3300031782|Ga0318552_10228712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300031782|Ga0318552_10625274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300031805|Ga0318497_10724991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300031831|Ga0318564_10099748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → unclassified Nitriliruptor → Nitriliruptor sp. | 1288 | Open in IMG/M |
| 3300031835|Ga0318517_10003794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4784 | Open in IMG/M |
| 3300031879|Ga0306919_10217800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1425 | Open in IMG/M |
| 3300031879|Ga0306919_10637984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 821 | Open in IMG/M |
| 3300031890|Ga0306925_10367389 | Not Available | 1544 | Open in IMG/M |
| 3300031894|Ga0318522_10079611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1195 | Open in IMG/M |
| 3300031897|Ga0318520_10177151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
| 3300031910|Ga0306923_11827772 | Not Available | 623 | Open in IMG/M |
| 3300031912|Ga0306921_11612121 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031912|Ga0306921_12201512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300031941|Ga0310912_10438139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1018 | Open in IMG/M |
| 3300032009|Ga0318563_10169554 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300032009|Ga0318563_10178810 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300032009|Ga0318563_10751571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300032010|Ga0318569_10131265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300032041|Ga0318549_10223787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300032041|Ga0318549_10522086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300032044|Ga0318558_10692668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita → Nakamurella multipartita DSM 44233 | 509 | Open in IMG/M |
| 3300032059|Ga0318533_11199033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → unclassified Nitriliruptor → Nitriliruptor sp. | 555 | Open in IMG/M |
| 3300032063|Ga0318504_10023075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2385 | Open in IMG/M |
| 3300032066|Ga0318514_10321728 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300032066|Ga0318514_10476080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 664 | Open in IMG/M |
| 3300032160|Ga0311301_10939701 | Not Available | 1156 | Open in IMG/M |
| 3300032770|Ga0335085_10330601 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300032805|Ga0335078_10335372 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300032805|Ga0335078_10418917 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300032805|Ga0335078_11332920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 816 | Open in IMG/M |
| 3300032828|Ga0335080_10515798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1267 | Open in IMG/M |
| 3300032892|Ga0335081_11353177 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300032955|Ga0335076_10392583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300033475|Ga0310811_10580811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella | 1135 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.33% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022727 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P5cmW16_10797962 | 3300001664 | Permafrost | LLGMPGYRMVLIPHPVQLLTAAELDARADAALARVLGMLTIPSGR* |
| Ga0066397_101561461 | 3300004281 | Tropical Forest Soil | MPGCRMVYVPHPVQLLTDDELAARADAVFPAVLAALTEPPGHSP* |
| Ga0070670_1003882693 | 3300005331 | Switchgrass Rhizosphere | MPGARMVYIPHPVQLLTDDELNARADAIFPDVLAALIGG* |
| Ga0066388_1029208622 | 3300005332 | Tropical Forest Soil | LGMPGCRMVYVPHPVQLLTDDELAARADAVFPAVLAALTDPHGSSP* |
| Ga0066388_1036127432 | 3300005332 | Tropical Forest Soil | LGMPGCRMVYVPHPVQLLTDDELAARADAVFPAVLAALTEPPGSSP* |
| Ga0066903_1001811763 | 3300005764 | Tropical Forest Soil | MPGCRMVYVPHPVQLLSDDELAARADAVFPAVLAALTEPPGSSP* |
| Ga0066903_1079967172 | 3300005764 | Tropical Forest Soil | IPHPVQLLSDDELAGRADAVFPDVLAALTAGPGAG* |
| Ga0081540_100030215 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MPGCRMVYVPHPVQLLTDDELAARADAVFPAVHAALTEPGRPTA* |
| Ga0081540_10674393 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTSGQ* |
| Ga0070712_1004061001 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GYRMILIPHPVQLLTDAELDTRADAAFAHVLARLTA* |
| Ga0066665_107381031 | 3300006796 | Soil | GMPGARVLYIPHPVQLLSADELAGRADAVFPDVLAALTAGPIAE* |
| Ga0075434_1009973553 | 3300006871 | Populus Rhizosphere | MPGARMVYIPHPVQLLTDNELDARADAIFPDVLAALTSGQ* |
| Ga0075429_1007802823 | 3300006880 | Populus Rhizosphere | PDCRVVYVPHPVQLLTDDELAARADVAFPAVLAALTEPPASSP* |
| Ga0075424_1020780131 | 3300006904 | Populus Rhizosphere | AHPVQLLTDEALDALADAAFPAVFERLTGGPAPAIG* |
| Ga0099792_108555451 | 3300009143 | Vadose Zone Soil | RLGMPGARMVYIPHPVQLLTHDELDARADAIFPDVLAALTGGE* |
| Ga0116214_11012301 | 3300009520 | Peatlands Soil | RMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE* |
| Ga0116220_100124371 | 3300009525 | Peatlands Soil | ADEAIEQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE* |
| Ga0126374_101653893 | 3300009792 | Tropical Forest Soil | MPGCRMVYVPHPVQLLTDDELAARADAVFPAVLAALTEPPGSSP* |
| Ga0126380_101955292 | 3300010043 | Tropical Forest Soil | MVYVPHPVQLLTDDELAARADAVFPAVLAALTEPPGPSP* |
| Ga0126384_121992031 | 3300010046 | Tropical Forest Soil | QARRLGMPDCRVAYVPHPVQLLTDDELAARADASFPAVLAALTEPAGPVSR* |
| Ga0126373_108945141 | 3300010048 | Tropical Forest Soil | AVEQARLLAMQSCRMLYIPHPVQLLTEAELDGRADAIFPAVLAALTTS* |
| Ga0126373_114136771 | 3300010048 | Tropical Forest Soil | VEQARLLSMPGCRMLYVPHPVQLLTKAELAGLADAAFPAVVAALTE* |
| Ga0126373_117418752 | 3300010048 | Tropical Forest Soil | GSRVVYIPHPVQLLTDDELAGRADAAFPAVLEALTGNP* |
| Ga0134080_103837701 | 3300010333 | Grasslands Soil | QARRLGMPGARMVYIPHPVQLLTHDELDARADAIFPDVLAALTGGE* |
| Ga0126370_111261552 | 3300010358 | Tropical Forest Soil | MPGCRMVYVPHPVQLLTDDELAARADAVFPAVLAALTDPPGSSP* |
| Ga0126378_107003483 | 3300010361 | Tropical Forest Soil | GMPGARVLYIPHPVQLLSAGELAARADAVFPDVLAALTSELAAG* |
| Ga0126377_110979052 | 3300010362 | Tropical Forest Soil | MVYVPHPVQLLTDDELAARADAVFPAVLAALTEPPGSSP* |
| Ga0126379_131973401 | 3300010366 | Tropical Forest Soil | MLYIPHPVQLLSDDELDGRADAVFPDVLAALTAGPGAG* |
| Ga0126381_1046182862 | 3300010376 | Tropical Forest Soil | MPDVRVLYIPHPVQLLSDDELAGRADAVFPDVLAALTAGPGAG* |
| Ga0134126_116079351 | 3300010396 | Terrestrial Soil | RLLAMPASRMLYIPHPVQLLTKAELAGRADTVFPAIVRALTVT* |
| Ga0126383_121072992 | 3300010398 | Tropical Forest Soil | GARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGK* |
| Ga0137391_110129921 | 3300011270 | Vadose Zone Soil | LLGMPGARVLYLPHPVQLLTHDELAGRADAVFPDVLAALTETR* |
| Ga0120114_11168091 | 3300011998 | Permafrost | LLGMPGYRMVLIPHPVQLLTAAELDTRADAALARVLGMLTIPSGR* |
| Ga0120174_10970651 | 3300012008 | Permafrost | MVLIPHPVQLLTAAELDARADAALARVLGMLTIPSGR* |
| Ga0137380_102119113 | 3300012206 | Vadose Zone Soil | MPGARMVYIPHPVQLLTGDELDARADAIFPDMLAALTGGE* |
| Ga0137381_100352345 | 3300012207 | Vadose Zone Soil | PGARMAYIPHPVQLLTGDELDARADAIFPDMLAALTGGE* |
| Ga0137381_103029771 | 3300012207 | Vadose Zone Soil | MPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE* |
| Ga0137376_107806183 | 3300012208 | Vadose Zone Soil | YVPHPVQLLTDDELAARADAAFPAVLAALTEPPASSP* |
| Ga0137379_101682062 | 3300012209 | Vadose Zone Soil | FADEAIEQARRLGMPGARMAYIPHPVQLLTGDELDARADAIFPDVLAALTGGE* |
| Ga0137377_104403741 | 3300012211 | Vadose Zone Soil | LGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE* |
| Ga0137387_110032182 | 3300012349 | Vadose Zone Soil | EQARLLAMPGCRMLYIPHPVQLLTAAELAGRADAVIPAVISALTEPG* |
| Ga0137372_109240891 | 3300012350 | Vadose Zone Soil | ADEAIEQARRLGMPGARMAYIPHPVQLLTGDELDARADAIFPDVLAALTGGE* |
| Ga0137386_100439981 | 3300012351 | Vadose Zone Soil | PFADEAIEQARRLGMPGARMVYIPHPVQLLTGDELDARADAIFPDMLAALTGGE* |
| Ga0137367_100759321 | 3300012353 | Vadose Zone Soil | IEQARRLGMPGARMAYIPHPVQLLTGDELDARADAIFPDMLAALTGGE* |
| Ga0137366_100788991 | 3300012354 | Vadose Zone Soil | LGMPGARMAYIPHPVQLLTGDELDARADAIFPDMLAALTGGE* |
| Ga0137373_102041551 | 3300012532 | Vadose Zone Soil | RMVYIPHPVQLLTDDELDARADAIFPDMLAALTGGE* |
| Ga0126369_109525522 | 3300012971 | Tropical Forest Soil | EQARRLGMPGSRMVYIPHPVQLLTDGELDARADAAFPAVLEALTGNP* |
| Ga0182018_106867421 | 3300014489 | Palsa | MRSCRMLYIPHPVQLLTPAELDGRADAIFPAVLAALTQARGPGRR* |
| Ga0182041_103657223 | 3300016294 | Soil | LGMPGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0182041_112850761 | 3300016294 | Soil | MLYIPHPVQLLSDDELAARADAVFPDVLAALTAGQAAG |
| Ga0182035_102553391 | 3300016341 | Soil | MVYIPHPVQLLTDDELDARADAIFPDVLAALTGAE |
| Ga0182035_104176961 | 3300016341 | Soil | EQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0182035_109332042 | 3300016341 | Soil | RLLGMPGSRVVYIPHPVQLLSAGELDQRADDIFPAVLAALTQAGT |
| Ga0182034_101884191 | 3300016371 | Soil | GMPGARVLYIPHPVQLLSAAELAGRADAVFPDVLAALTSVPVTG |
| Ga0182038_102943411 | 3300016445 | Soil | QARRLGMPGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0187806_10376682 | 3300017928 | Freshwater Sediment | ADEAIEQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGE |
| Ga0187825_103046881 | 3300017930 | Freshwater Sediment | MVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0187808_102994991 | 3300017942 | Freshwater Sediment | EAIEQARRLGMPGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTSSE |
| Ga0187819_106626812 | 3300017943 | Freshwater Sediment | AMPASRMLYIPHPVQLLTDAELAGRADSIFPAVVQALTL |
| Ga0187776_105285983 | 3300017966 | Tropical Peatland | MPGARMVYIPHPVQLLTDDELDTRADAIFPDVLAALTRGN |
| Ga0187783_101791873 | 3300017970 | Tropical Peatland | MVYIPHPVQLLTDDELGARADAIFPGVLAALTGGE |
| Ga0187777_105352152 | 3300017974 | Tropical Peatland | PGARVVYVPHPVQLLTDDELDARADAVFPEVLAALTEPAAPPP |
| Ga0187765_107050431 | 3300018060 | Tropical Peatland | EQARRLSMPGARMVYVPHPVQLLTDGELAARAEDAFPAVLEALTENP |
| Ga0187773_108230062 | 3300018064 | Tropical Peatland | QASLLGMSAVRLVYVPHPVQLLSAAELDALADATYPAIVANVVE |
| Ga0206350_106207321 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGARMVYIPHPVQLLTDEELNARADAIFPDVLAALTGG |
| Ga0210395_107587051 | 3300020582 | Soil | IEQARRLGMPGARMVYIPHPVQLLTDAELDARADAIFPDVLAALTGGE |
| Ga0210386_112726371 | 3300021406 | Soil | EQARLLAMPGCRMLYIPHPVQLLTAPELDGRADAIFPAVLAALTTQAPAT |
| Ga0210391_114636632 | 3300021433 | Soil | VVYIPHPVQLLSHDELAGRADAVFGAVLAALTSGPAALTPGPEAG |
| Ga0210392_108209552 | 3300021475 | Soil | LLGMPGARVLYIPHPVQLLTHDELAGRADAVFPDVLAALTETN |
| Ga0210398_104208831 | 3300021477 | Soil | RLLGMPGARVVYIPHPVQLLSHDELAGRADAVFGAVLAALTSGPAALTPGPEAG |
| Ga0126371_101207812 | 3300021560 | Tropical Forest Soil | MPDARVVYIPHPVQLLTDDELAARADAIFPAVVAALTVPAPDGEISSG |
| Ga0242652_10032891 | 3300022510 | Soil | RMLYIPHPVQLMTEPELAAHADAVFPAVVRALTAF |
| Ga0242663_11020762 | 3300022523 | Soil | MPASRMLYIPHPVQLLTDAELAGRADSVFPAIVRALTAGDGA |
| Ga0242654_101843731 | 3300022726 | Soil | LLSMPGCRMLYVPHPVQLLTAAELDGLADAVFPAVVAALTT |
| Ga0224567_1035843 | 3300022727 | Plant Litter | ARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0207699_100780684 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QARRLGMPGARMVYIPHPVQLLTDDELNARADAIFPDVLAALIGG |
| Ga0207699_107550591 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RLGMPGARMVYIPHPVQLLTGDELDARADAIFPDVLAALTSGE |
| Ga0207693_101403541 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GYRMILIPHPVQLLTDAELDTRADAAFAHVLARLTA |
| Ga0207664_101671003 | 3300025929 | Agricultural Soil | AIEQARRLGMPASRVVYIPHPVQLLTDDELAARADASFPAVLAALTEPAGPSAPFTA |
| Ga0207664_102418373 | 3300025929 | Agricultural Soil | PGARMVYIPHPVQLLTGDELDARADAIFPDVLAALTSGE |
| Ga0207639_106121121 | 3300026041 | Corn Rhizosphere | GARMVYIPHPVQLLTDDELNARADAVFPDVLAALTGG |
| Ga0207683_110362312 | 3300026121 | Miscanthus Rhizosphere | ARMVYIPHPVQLLTDDELNARADAVFPDVLAALTGG |
| Ga0209027_11567602 | 3300026300 | Grasslands Soil | MPGARMVYIPHPVQLLTDDKLDARADAIFPDVLAALTSGQ |
| Ga0179593_11352821 | 3300026555 | Vadose Zone Soil | GMPGARVLYIPHPVQLLTHDELAGRADAVFPDVLAALTETK |
| Ga0209466_10291091 | 3300027646 | Tropical Forest Soil | MPGCRMVYVPHPVQLLTDDELAARADAVFPAVLAALTEPPGHSP |
| Ga0209799_11172212 | 3300027654 | Tropical Forest Soil | VQQARLLGMPGARMLYIPHPVQLLSHDELAGRADAVFPGVLAALTAEPGAA |
| Ga0209112_100267713 | 3300027817 | Forest Soil | MPGARMVYIPHPVQLLTDDELTARADAIFPDVLAALTGGESDR |
| Ga0307280_102758841 | 3300028768 | Soil | MPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0307304_101562032 | 3300028885 | Soil | YVPHPVQLLTDDELAARADAAFPAVLAALTEPPASSP |
| Ga0318534_107695082 | 3300031544 | Soil | VPHPVQLLSAAELAGRADAVFPGVLAALTSGPAAR |
| Ga0318515_100402051 | 3300031572 | Soil | RLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0318515_102908201 | 3300031572 | Soil | VVYIPHPVQLLSAGELDQRADDIFPAVLAALTQAGT |
| Ga0318515_106786162 | 3300031572 | Soil | RLGMPASRVVYIPHPVQLLTDGELAARADAAFPAVLEALTENP |
| Ga0318542_104469991 | 3300031668 | Soil | QARRLGMPAARVVYVPHPVQLLTDGELDARADAIFPDVVAALTEPAAP |
| Ga0318560_102711973 | 3300031682 | Soil | RMLYIPHPVQLLSDDELAARADAVFPDVLAALTAGPAAG |
| Ga0310686_1070078272 | 3300031708 | Soil | QACRMIYIPHPVQLLTAAELDGRADAVFPAVLRALTAR |
| Ga0318496_101404651 | 3300031713 | Soil | MPDARMLYVPHPVQLLSAAELAGRADAVFPGVLAALTSGPAAR |
| Ga0318496_106095561 | 3300031713 | Soil | DEAIEQARRLGMPGARMVYVPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0307469_118258002 | 3300031720 | Hardwood Forest Soil | MQSCRMLYIPHPVQLLTGAELDARADAIFPAVISALTAAR |
| Ga0318493_104023131 | 3300031723 | Soil | RLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGQ |
| Ga0318500_107030272 | 3300031724 | Soil | ARMVYLPHPVQLLTDGELDARADDIFPDVLAALTEPAAP |
| Ga0318501_101388311 | 3300031736 | Soil | RMVYVPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0306918_102206581 | 3300031744 | Soil | MPGARVAYIPHPVQLLSAAELAARADAVFPSVLAALTTRPAG |
| Ga0306918_109035591 | 3300031744 | Soil | DEAIEQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0318502_110251132 | 3300031747 | Soil | RLLAMPDARMLYVPHPVQLLSAAELAGRADAVFPGVLAALTSGPAAR |
| Ga0318492_103922561 | 3300031748 | Soil | LGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0318494_100808311 | 3300031751 | Soil | LGMPGARMVYIPHPVQLLTGDELNARADAIFPDVLAALTGGE |
| Ga0318554_102490802 | 3300031765 | Soil | MPGARMVYIPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0318521_101056623 | 3300031770 | Soil | CRPCGRQARRLGMPGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0318521_104211303 | 3300031770 | Soil | EAIEQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0318546_101778861 | 3300031771 | Soil | IEQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGQ |
| Ga0318498_101414741 | 3300031778 | Soil | RMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0318498_101578273 | 3300031778 | Soil | PGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0318566_100410983 | 3300031779 | Soil | MLYIPHPVQLLSDDELAGRADAVFPDVLAALTAGPGAG |
| Ga0318547_103407101 | 3300031781 | Soil | MPGTTVAYIPHPVQLLSAAELAARADAVFPSVLAALTTRPAG |
| Ga0318552_100699571 | 3300031782 | Soil | PGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0318552_102287121 | 3300031782 | Soil | PGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGQ |
| Ga0318552_106252742 | 3300031782 | Soil | LGMPGARVLYIPHPVQLLSAGELSGRADAVFPGVLAALTAGPVAG |
| Ga0318497_107249911 | 3300031805 | Soil | MPAARVVYVPHPVQLLTDGELDARADAIFPDVVAALTEPAAP |
| Ga0318564_100997482 | 3300031831 | Soil | MPGARMVYVPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0318517_100037941 | 3300031835 | Soil | VLYIPHPVQLLSAGELAARADAVFPDVLAALTAGPVA |
| Ga0306919_102178003 | 3300031879 | Soil | RLGMPGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0306919_106379843 | 3300031879 | Soil | EAVQQARLLGMPGCRMAYIPHPVQLLSSDELAGRADAVFPDVLAALTEPG |
| Ga0306925_103673891 | 3300031890 | Soil | RVVYVPHPVQLLTDGELDARADAIFPDVVAALTEPAAP |
| Ga0318522_100796111 | 3300031894 | Soil | VLYIPHPVQLLSRDELAGRADAVFPGVLAALTETR |
| Ga0318520_101771511 | 3300031897 | Soil | LLGMPGTTVAYIPHPVQLLSAAELAARADAVFPSVLAALTTRPAG |
| Ga0306923_118277721 | 3300031910 | Soil | EQARRLGMPGARMVYIPHPVQLLTDDELGAQADAIFPDVLAALTGGE |
| Ga0306921_116121212 | 3300031912 | Soil | RRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0306921_122015122 | 3300031912 | Soil | VYIPHPVQLLSAGELDQRADDIFPAVLAALTQAGL |
| Ga0310912_104381392 | 3300031941 | Soil | MPGARMVYIPHPVQLLTDDELDARADTIFPDVLAALTGAE |
| Ga0318563_101695541 | 3300032009 | Soil | RVVYIPHPVQLLTDDELSSRADAAFPAVLEALTENP |
| Ga0318563_101788101 | 3300032009 | Soil | EQARRLGMPGARMVYIPHPVQLLTGDELDARADAIFPDVLAALTTVGYE |
| Ga0318563_107515711 | 3300032009 | Soil | VYIPHPVQLLTHDELAGRADAAFPGVLAALTAGPVS |
| Ga0318569_101312653 | 3300032010 | Soil | RLLGMPGCRMAYIPHPVQLLSGDELAGRAEAVFPDVLAALTEPA |
| Ga0318549_102237871 | 3300032041 | Soil | EQARRLGMPGARMVYVPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0318549_105220862 | 3300032041 | Soil | RMLYIPHPVQLLSDDELAGRADAVFPDVLAALTAGPGAG |
| Ga0318558_106926681 | 3300032044 | Soil | IEQARRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTGGE |
| Ga0318533_111990331 | 3300032059 | Soil | LGMPGARMVYVPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0318504_100230753 | 3300032063 | Soil | IPHPVQLLSDDELAARADAVFPDVLAALTAGPAAG |
| Ga0318514_103217282 | 3300032066 | Soil | ARMVYIPHPVQLLTDGELHARADAIFPDVLAALTGSE |
| Ga0318514_104760802 | 3300032066 | Soil | VYIPHPVQLLSGDELDRRADAILPAVLAALTEAQPGV |
| Ga0311301_109397011 | 3300032160 | Peatlands Soil | QACRLGMPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTAGE |
| Ga0335085_103306013 | 3300032770 | Soil | MVYIPHPVQLLTGSELNARADAVFPDVLAALTGGK |
| Ga0335078_103353722 | 3300032805 | Soil | MPDARMVYIPHPVQLLTGSELNARADAVFPDVLAALTGGK |
| Ga0335078_104189171 | 3300032805 | Soil | AIEQARRLGMRGARVVYVPHPVQLLSDAELAARADAAFPAVLEALTEPAGPPTPVTA |
| Ga0335078_113329201 | 3300032805 | Soil | CRMLYIPHPVQLLTAPELDDRADTIFPAVLAALTTPP |
| Ga0335080_105157981 | 3300032828 | Soil | EAIEQARRLGMPTSRVVYIPHPVQLLTDDELAARADASFPAVLAALTEPGGPPAPFTA |
| Ga0335081_113531771 | 3300032892 | Soil | RVVYVPHPVQLLSDAELAARADAAFPAVLEALTAPASGAPA |
| Ga0335076_103925831 | 3300032955 | Soil | ARRLGMPGARVVYVPHPVQLLTNGELDARADAVFPDVLAALTEPGAAG |
| Ga0310811_105808112 | 3300033475 | Soil | MPGARMVYIPHPVQLLTDDELDARADAIFPDVLAALTSGQ |
| ⦗Top⦘ |