| Basic Information | |
|---|---|
| Family ID | F047217 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 44 residues |
| Representative Sequence | QGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 84.00 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.43% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF03358 | FMN_red | 10.00 |
| PF07963 | N_methyl | 10.00 |
| PF13544 | Obsolete Pfam Family | 4.67 |
| PF01063 | Aminotran_4 | 3.33 |
| PF04542 | Sigma70_r2 | 2.67 |
| PF11306 | DUF3108 | 2.67 |
| PF13505 | OMP_b-brl | 2.00 |
| PF16313 | DUF4953 | 2.00 |
| PF14031 | D-ser_dehydrat | 2.00 |
| PF08544 | GHMP_kinases_C | 2.00 |
| PF01047 | MarR | 1.33 |
| PF07884 | VKOR | 0.67 |
| PF13443 | HTH_26 | 0.67 |
| PF13463 | HTH_27 | 0.67 |
| PF13424 | TPR_12 | 0.67 |
| PF00413 | Peptidase_M10 | 0.67 |
| PF02518 | HATPase_c | 0.67 |
| PF12840 | HTH_20 | 0.67 |
| PF06452 | CBM9_1 | 0.67 |
| PF16561 | AMPK1_CBM | 0.67 |
| PF05960 | DUF885 | 0.67 |
| PF11074 | DUF2779 | 0.67 |
| PF13365 | Trypsin_2 | 0.67 |
| PF01915 | Glyco_hydro_3_C | 0.67 |
| PF01263 | Aldose_epim | 0.67 |
| PF07995 | GSDH | 0.67 |
| PF00248 | Aldo_ket_red | 0.67 |
| PF03447 | NAD_binding_3 | 0.67 |
| PF02954 | HTH_8 | 0.67 |
| PF07715 | Plug | 0.67 |
| PF00970 | FAD_binding_6 | 0.67 |
| PF04229 | GrpB | 0.67 |
| PF11741 | AMIN | 0.67 |
| PF08545 | ACP_syn_III | 0.67 |
| PF02922 | CBM_48 | 0.67 |
| PF08281 | Sigma70_r4_2 | 0.67 |
| PF01979 | Amidohydro_1 | 0.67 |
| PF13564 | DoxX_2 | 0.67 |
| PF17162 | DUF5118 | 0.67 |
| PF00072 | Response_reg | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 6.67 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.67 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.67 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.67 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.67 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.67 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.67 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.67 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.67 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.67 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.67 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.67 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.67 % |
| Unclassified | root | N/A | 3.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig59743 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig63197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1146 | Open in IMG/M |
| 2170459005|F1BAP7Q01BO0P4 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004114|Ga0062593_101233630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 787 | Open in IMG/M |
| 3300004114|Ga0062593_103495558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300004156|Ga0062589_100286706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1262 | Open in IMG/M |
| 3300005166|Ga0066674_10122907 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300005179|Ga0066684_10469632 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005181|Ga0066678_10470171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 836 | Open in IMG/M |
| 3300005186|Ga0066676_10803920 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005341|Ga0070691_10413221 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005406|Ga0070703_10497879 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005441|Ga0070700_100289234 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005441|Ga0070700_101130844 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005450|Ga0066682_10038208 | All Organisms → cellular organisms → Bacteria | 2859 | Open in IMG/M |
| 3300005451|Ga0066681_10482069 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005454|Ga0066687_10035402 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300005455|Ga0070663_101250141 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005544|Ga0070686_100039549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2939 | Open in IMG/M |
| 3300005544|Ga0070686_100620839 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300005547|Ga0070693_101036045 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005549|Ga0070704_100103963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2146 | Open in IMG/M |
| 3300005552|Ga0066701_10230577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1142 | Open in IMG/M |
| 3300005564|Ga0070664_100166445 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300005566|Ga0066693_10308023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300005568|Ga0066703_10022337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3286 | Open in IMG/M |
| 3300005569|Ga0066705_10097904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1740 | Open in IMG/M |
| 3300005574|Ga0066694_10404519 | Not Available | 642 | Open in IMG/M |
| 3300005598|Ga0066706_10248251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1384 | Open in IMG/M |
| 3300005598|Ga0066706_10819092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 732 | Open in IMG/M |
| 3300005598|Ga0066706_10819093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 732 | Open in IMG/M |
| 3300005718|Ga0068866_10176475 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300006175|Ga0070712_101179052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
| 3300006175|Ga0070712_101476662 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006794|Ga0066658_10116794 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300006796|Ga0066665_10044489 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
| 3300006804|Ga0079221_10349183 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 892 | Open in IMG/M |
| 3300006806|Ga0079220_10007752 | All Organisms → cellular organisms → Bacteria | 4007 | Open in IMG/M |
| 3300006806|Ga0079220_10115544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1420 | Open in IMG/M |
| 3300006864|Ga0066797_1271016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300006894|Ga0079215_11111711 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006914|Ga0075436_101330575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
| 3300006954|Ga0079219_10180275 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300009012|Ga0066710_100512893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1809 | Open in IMG/M |
| 3300009029|Ga0066793_10049620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2375 | Open in IMG/M |
| 3300009029|Ga0066793_10156573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1328 | Open in IMG/M |
| 3300009093|Ga0105240_12257886 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009098|Ga0105245_10402331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1368 | Open in IMG/M |
| 3300009137|Ga0066709_100657580 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300009137|Ga0066709_101187443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1123 | Open in IMG/M |
| 3300009137|Ga0066709_101761965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 873 | Open in IMG/M |
| 3300009137|Ga0066709_103520527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300009143|Ga0099792_11277076 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010326|Ga0134065_10140008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 837 | Open in IMG/M |
| 3300010373|Ga0134128_11557990 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
| 3300010375|Ga0105239_12990156 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010396|Ga0134126_12288251 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010397|Ga0134124_10227815 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300010400|Ga0134122_10323369 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300010400|Ga0134122_12558777 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300011987|Ga0120164_1001493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 7170 | Open in IMG/M |
| 3300011991|Ga0120153_1069929 | Not Available | 603 | Open in IMG/M |
| 3300012205|Ga0137362_10283014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1434 | Open in IMG/M |
| 3300012208|Ga0137376_10008254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 7218 | Open in IMG/M |
| 3300012208|Ga0137376_10122530 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300012209|Ga0137379_10996876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 743 | Open in IMG/M |
| 3300012211|Ga0137377_10503884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1149 | Open in IMG/M |
| 3300012211|Ga0137377_11273110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 665 | Open in IMG/M |
| 3300012361|Ga0137360_10155324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1818 | Open in IMG/M |
| 3300012900|Ga0157292_10174663 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012922|Ga0137394_11376841 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012930|Ga0137407_10329344 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300012960|Ga0164301_11816155 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300012976|Ga0134076_10426396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 595 | Open in IMG/M |
| 3300012977|Ga0134087_10102031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1203 | Open in IMG/M |
| 3300012984|Ga0164309_11707369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300013100|Ga0157373_10801235 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300013105|Ga0157369_10364495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1500 | Open in IMG/M |
| 3300014157|Ga0134078_10510495 | Not Available | 560 | Open in IMG/M |
| 3300014166|Ga0134079_10009143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2984 | Open in IMG/M |
| 3300014745|Ga0157377_11376737 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300015371|Ga0132258_11261015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1868 | Open in IMG/M |
| 3300015371|Ga0132258_11774242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1555 | Open in IMG/M |
| 3300015373|Ga0132257_100046595 | All Organisms → cellular organisms → Bacteria | 4812 | Open in IMG/M |
| 3300015373|Ga0132257_100340934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1810 | Open in IMG/M |
| 3300015374|Ga0132255_103542577 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018028|Ga0184608_10115087 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300018051|Ga0184620_10216373 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300018052|Ga0184638_1127766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 927 | Open in IMG/M |
| 3300018066|Ga0184617_1013606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1686 | Open in IMG/M |
| 3300018066|Ga0184617_1166422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 652 | Open in IMG/M |
| 3300018076|Ga0184609_10109457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1248 | Open in IMG/M |
| 3300018468|Ga0066662_10080026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2230 | Open in IMG/M |
| 3300018476|Ga0190274_13307883 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018482|Ga0066669_11020459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 747 | Open in IMG/M |
| 3300019874|Ga0193744_1007989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1933 | Open in IMG/M |
| 3300019877|Ga0193722_1019037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1773 | Open in IMG/M |
| 3300019879|Ga0193723_1097349 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300019881|Ga0193707_1112017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 804 | Open in IMG/M |
| 3300019882|Ga0193713_1035373 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1456 | Open in IMG/M |
| 3300019883|Ga0193725_1002772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5086 | Open in IMG/M |
| 3300019885|Ga0193747_1020625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1619 | Open in IMG/M |
| 3300019886|Ga0193727_1035101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1694 | Open in IMG/M |
| 3300020018|Ga0193721_1048252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1121 | Open in IMG/M |
| 3300020059|Ga0193745_1033839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1123 | Open in IMG/M |
| 3300020062|Ga0193724_1006999 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300021073|Ga0210378_10100961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1124 | Open in IMG/M |
| 3300021078|Ga0210381_10081141 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1027 | Open in IMG/M |
| 3300021344|Ga0193719_10038508 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300021510|Ga0222621_1028040 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300021510|Ga0222621_1071564 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300021968|Ga0193698_1013726 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300022534|Ga0224452_1114363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
| 3300022756|Ga0222622_10002273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 8118 | Open in IMG/M |
| 3300022756|Ga0222622_10454922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 909 | Open in IMG/M |
| 3300024245|Ga0247677_1071664 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025907|Ga0207645_10609459 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025910|Ga0207684_10056220 | All Organisms → cellular organisms → Bacteria | 3338 | Open in IMG/M |
| 3300025912|Ga0207707_10296742 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300025915|Ga0207693_11421423 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025918|Ga0207662_10346962 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300025931|Ga0207644_10165339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1723 | Open in IMG/M |
| 3300025939|Ga0207665_10068583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2417 | Open in IMG/M |
| 3300025949|Ga0207667_10790336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 946 | Open in IMG/M |
| 3300026067|Ga0207678_10350506 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300026075|Ga0207708_10128706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1978 | Open in IMG/M |
| 3300026075|Ga0207708_10508047 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300026142|Ga0207698_11955861 | Not Available | 601 | Open in IMG/M |
| 3300026308|Ga0209265_1230598 | Not Available | 510 | Open in IMG/M |
| 3300026312|Ga0209153_1015951 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300026315|Ga0209686_1105173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 973 | Open in IMG/M |
| 3300026323|Ga0209472_1034357 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300026331|Ga0209267_1170803 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300026528|Ga0209378_1214456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 622 | Open in IMG/M |
| 3300026548|Ga0209161_10450930 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027903|Ga0209488_10179070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1600 | Open in IMG/M |
| 3300028713|Ga0307303_10156797 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300028718|Ga0307307_10151703 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300028768|Ga0307280_10072942 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300028799|Ga0307284_10111564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1031 | Open in IMG/M |
| 3300028811|Ga0307292_10128873 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300028819|Ga0307296_10383291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 768 | Open in IMG/M |
| 3300028824|Ga0307310_10101707 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300028880|Ga0307300_10050818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1175 | Open in IMG/M |
| 3300028884|Ga0307308_10008570 | All Organisms → cellular organisms → Bacteria | 4490 | Open in IMG/M |
| 3300028884|Ga0307308_10085137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1500 | Open in IMG/M |
| 3300028884|Ga0307308_10445506 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031547|Ga0310887_11147556 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031720|Ga0307469_11082711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300034125|Ga0370484_0009107 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.33% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.33% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01344240 | 2124908044 | Soil | SQNVTVVIVNAVGPPASWSGTATHSQSAKTCTMVNGVIACV |
| A5_c1_00206260 | 2124908044 | Soil | APLQGFSPSQNVTVVIVNVAGPPGSWSGTATHSQSAKVCDMTNGVITCV |
| E41_08574890 | 2170459005 | Grass Soil | NVTVVIVNVLGPPAVWSGTATHSQSAKVCTMANGVIACV |
| Ga0062593_1012336302 | 3300004114 | Soil | PLQGFSPSQNVTVIVTAVAGPPPSWSATASHSQTAKTCAMTNGVITCT* |
| Ga0062593_1034955581 | 3300004114 | Soil | PLQGFTPSQNVTIVATVVVGPPPSWSATATHSQSAKTCDMTNGVLTCV* |
| Ga0062589_1002867061 | 3300004156 | Soil | QNVTVTVTAVAGPPPDWSATATHTQTAKVCDMTAGVITCT* |
| Ga0066674_101229072 | 3300005166 | Soil | AAPLQGFSPSQNVTVVVTAVAGPPPSWSATATHTQSAKVCDMTNGVITCA* |
| Ga0066684_104696322 | 3300005179 | Soil | AAPLQGFTPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCSMVNGVITCV* |
| Ga0066678_104701713 | 3300005181 | Soil | QNVTIVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA* |
| Ga0066676_108039202 | 3300005186 | Soil | SQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0070691_104132211 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | NVTVVVTNVAGPPPSWNATATHSQSAKTCAMTNGVITCT* |
| Ga0070703_104978791 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | SQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA* |
| Ga0070700_1002892343 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT* |
| Ga0070700_1011308442 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | PLQGFSPSQNVTVVVTNVAGPPPSWSATATHTQSAKTCAMTNGVITCT* |
| Ga0066682_100382085 | 3300005450 | Soil | SQNVTVVVTNVAGPPPSWSATATHSQSAKVCDMTNGVITCI* |
| Ga0066681_104820691 | 3300005451 | Soil | ASPVQGFTPSQNVTIVVTAVAGPPPSWSATATHSQSAKTCQMVNGVITCT* |
| Ga0066687_100354021 | 3300005454 | Soil | AAPLQGFTPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA* |
| Ga0070663_1012501412 | 3300005455 | Corn Rhizosphere | QGFSPSQNVTVVVTNVAGPPPSWSATATHTQSAKTCAMTNGVITCT* |
| Ga0070686_1000395494 | 3300005544 | Switchgrass Rhizosphere | TSPVQGFTPSQNVTVTVTAVAGPPPSWDATATHTQSAKTCAMTAGVITCT* |
| Ga0070686_1006208391 | 3300005544 | Switchgrass Rhizosphere | PLQGFTPSQNVTVTVNSTAGPPPSWDATATHTQSAKTCAMTNGVITCT* |
| Ga0070693_1010360451 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TSAAPVQGFTPSQNVTIVATAVAGPPPSWSGTATHSQSAKTCAMTNGVITCT* |
| Ga0070704_1001039634 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | NGFSTSQNVTITATADPGPPPDWSATATHSQSAKSCTMATGVITCTP* |
| Ga0066701_102305771 | 3300005552 | Soil | AAPLQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKVCDMTNGVITCI* |
| Ga0070664_1001664455 | 3300005564 | Corn Rhizosphere | FSPSQNVTVVVTGVAGPPPSWSATATHTQTAKVCDMTNGVITCT* |
| Ga0066693_103080231 | 3300005566 | Soil | FSPSQNVTVVVTNVAGPPPSWSATATHTQSAKTCQMVNGVITCA* |
| Ga0066703_100223374 | 3300005568 | Soil | FSPSQNVTVVVTAVAGPPPSWSATATHTQSAKTCQMLNGVITCA* |
| Ga0066705_100979044 | 3300005569 | Soil | TPLQGFTPSQNVTVTVTAVAGPPPSWSATATHSQSAKVCDMTNGVITCV* |
| Ga0066694_104045191 | 3300005574 | Soil | NVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT* |
| Ga0066706_102482511 | 3300005598 | Soil | PLQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKVCSMTNGVITCV* |
| Ga0066706_108190923 | 3300005598 | Soil | LQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKVCSMVNGVITCV* |
| Ga0066706_108190932 | 3300005598 | Soil | LQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKVCSMINGVITCV* |
| Ga0068866_101764751 | 3300005718 | Miscanthus Rhizosphere | AAPLQGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT* |
| Ga0070712_1011790522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LQGFSPSQNVTVVITNVVGPPPSWSGTATHSQSAKTCTMINGVIACA* |
| Ga0070712_1014766621 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0066658_101167944 | 3300006794 | Soil | FTPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA* |
| Ga0066665_100444891 | 3300006796 | Soil | GFSPSQNVTVVVTAVAGPPPSWSATATHTQSAKVCDMTNGVITCA* |
| Ga0079221_103491832 | 3300006804 | Agricultural Soil | AAPLQGFTPSQNVTIVVTAVAGPPPSWSATATHSQSAKTCDMTNGVITCT* |
| Ga0079220_100077521 | 3300006806 | Agricultural Soil | AAPLQGFTPSQNVTIVVTSVAGPPPSWSATATHSQSAKTCDMTNGVITCT* |
| Ga0079220_101155442 | 3300006806 | Agricultural Soil | APLQGFTPSQNVTIVVTAVAGPPPSWSATATHSQSAKTCAMVNGVITCT* |
| Ga0066797_12710162 | 3300006864 | Soil | IVNLPGPPASWSGTATHSQSAKVCDMTNGVITCV* |
| Ga0079215_111117112 | 3300006894 | Agricultural Soil | VVVNLAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0075436_1013305752 | 3300006914 | Populus Rhizosphere | PLQGFTPSQNVTIVVTGVAGPPPSWSATATHSQSAKTCDMTGGVITCTP* |
| Ga0079219_101802751 | 3300006954 | Agricultural Soil | AAPLQGFTPSQNVTIVVTAVAGPPPSWSATATHSQSAKTCAMVNGVITCT* |
| Ga0066710_1005128934 | 3300009012 | Grasslands Soil | SQNVTVVVTNVAGPPPSWSATATHSQSAKVCDMTNGVITCI |
| Ga0066793_100496205 | 3300009029 | Prmafrost Soil | VVIVDVAGPPGSGSGTATHSQSAKVCDMTNGVITCV* |
| Ga0066793_101565731 | 3300009029 | Prmafrost Soil | QGFTPSQNVTVVIVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV* |
| Ga0105240_122578861 | 3300009093 | Corn Rhizosphere | AAPLQGFSPSQNVTVVVTGVAGPPPSWSATATHTQTAKVCDMTNGVITCT* |
| Ga0105245_104023313 | 3300009098 | Miscanthus Rhizosphere | IVTAVAGPPPSWSATASHTQTAKVCDMTNGVITCT* |
| Ga0066709_1006575801 | 3300009137 | Grasslands Soil | QRISPSQNGTVVVTHVAGPPPSWTATATHSQSAKVCSMINGLITCV* |
| Ga0066709_1011874431 | 3300009137 | Grasslands Soil | AAPLQGFSPSQNVTVVVVNVAGPPPSWRATATHSQSAKSCDMSNGVITCV* |
| Ga0066709_1017619651 | 3300009137 | Grasslands Soil | NVTVVVTNVAGPPPSWSATATHSQSAKVCDMTNGVITCI* |
| Ga0066709_1035205271 | 3300009137 | Grasslands Soil | SPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCSMVNGVITCV* |
| Ga0099792_112770762 | 3300009143 | Vadose Zone Soil | SAAPLQGFSPSQNVTVVVNNVAGPPPSWDATATHSQSAKVCTMTNGVIVCV* |
| Ga0134065_101400081 | 3300010326 | Grasslands Soil | QGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0134128_115579901 | 3300010373 | Terrestrial Soil | PLQGFSPSQNVTVVITNLAGPPPSWQGTATHSQSAKVCDMTNGVITCV* |
| Ga0105239_129901562 | 3300010375 | Corn Rhizosphere | AAAPLQGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT* |
| Ga0134126_122882511 | 3300010396 | Terrestrial Soil | AAPLQGFSPSQNVTVVVVNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0134124_102278153 | 3300010397 | Terrestrial Soil | APLQGFTPSQNVTIVATNVAGPPPSWSGTATHSQSAKTCDMTGGVITCTP* |
| Ga0134122_103233692 | 3300010400 | Terrestrial Soil | SAAPLQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0134122_125587771 | 3300010400 | Terrestrial Soil | TVTAVAGPPPSWDATATHTQSAKTCAMTAGVITCT* |
| Ga0120164_10014931 | 3300011987 | Permafrost | VITNLPGPPASWSGTATHSQSAKVCDMTNGVITCV* |
| Ga0120153_10699291 | 3300011991 | Permafrost | PSQNVTVVITNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV* |
| Ga0137362_102830141 | 3300012205 | Vadose Zone Soil | IIAVTVGGPPPSWSATATHSQSAKVCDMIGGVITCA* |
| Ga0137376_100082541 | 3300012208 | Vadose Zone Soil | AAPLQGFSPSQNVTVVVVNVAGPPPSWSATATHTQSAKVCDMTNGVITCT* |
| Ga0137376_101225305 | 3300012208 | Vadose Zone Soil | GFSPSQNVTVVVTAVAGPPPSWSATANHTQSAKTCQMVNGVITCA* |
| Ga0137379_109968761 | 3300012209 | Vadose Zone Soil | FSPSQNVTVVVTNVAGPPPSWSATATHSQSAKVCDMTNGVITCA* |
| Ga0137377_105038841 | 3300012211 | Vadose Zone Soil | QNVTVVVVNVAGPPPSWSATATHTQSAKVCTMINGVITCV* |
| Ga0137377_112731101 | 3300012211 | Vadose Zone Soil | GFSPSQNVTVTITNDPGPPPTWSGSATHSQSAKVCSMSNGVITCV* |
| Ga0137360_101553241 | 3300012361 | Vadose Zone Soil | NVTIVAVTVAGPPPGWNATATHSLTARTCDMTNGVITCT* |
| Ga0157292_101746632 | 3300012900 | Soil | VVTGVAGPPPSWSATATHTQTAKVCDMTNGVITCT* |
| Ga0137394_113768412 | 3300012922 | Vadose Zone Soil | AAPLQGFIPSQNVTIVAAIAAGPPPSWSATATHAQSAKVCDMTGGVITCA* |
| Ga0137407_103293441 | 3300012930 | Vadose Zone Soil | LQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCSMVNGVITCV* |
| Ga0164301_118161551 | 3300012960 | Soil | NVTIVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA* |
| Ga0134076_104263961 | 3300012976 | Grasslands Soil | TAAPLQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCSMVNGVITCV* |
| Ga0134087_101020313 | 3300012977 | Grasslands Soil | IVAVNVAGPPPSWSANATHSQSAKVCDMTNGVITCA* |
| Ga0164309_117073692 | 3300012984 | Soil | LQGFTPSQNVTIVVTGVTGPPPDWSAAATHSQSAKTCSMAAGVITCT* |
| Ga0157373_108012351 | 3300013100 | Corn Rhizosphere | LQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAQTCAMTNGVISCA* |
| Ga0157369_103644953 | 3300013105 | Corn Rhizosphere | FSPSQNVTVVITNLAGPPPSWQGTATHSQSAKVCDMTNGVITCV* |
| Ga0134078_105104952 | 3300014157 | Grasslands Soil | VTVVVTNVAGPPPSWSATATHTQSPKTCDMTNGVITCT* |
| Ga0134079_100091431 | 3300014166 | Grasslands Soil | MAAPLQGFTPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0157377_113767372 | 3300014745 | Miscanthus Rhizosphere | APLQGFSPSQNVTVVVTGVAGPPPSWSATATHTQTAKVCDMTNGVITCT* |
| Ga0132258_112610153 | 3300015371 | Arabidopsis Rhizosphere | VTVTVTAVAGPPPSWDATATHTQSAKTCAMTAGVITCT* |
| Ga0132258_117742423 | 3300015371 | Arabidopsis Rhizosphere | PLQGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT* |
| Ga0132257_1000465954 | 3300015373 | Arabidopsis Rhizosphere | PLQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV* |
| Ga0132257_1003409341 | 3300015373 | Arabidopsis Rhizosphere | VTVTAVAGPPPSWDATATHTQSAKTCAMTAGVITCT* |
| Ga0132255_1035425771 | 3300015374 | Arabidopsis Rhizosphere | VTVVVTNVAGPPPSWSATATHTQSAKTCAMTNGVITCT* |
| Ga0184608_101150871 | 3300018028 | Groundwater Sediment | AAPLQGFSPSQNVTVVVVSVAGPPPSWSATANHSQSAKVCSMINGVITCV |
| Ga0184620_102163731 | 3300018051 | Groundwater Sediment | SPSQNVTVVITNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0184638_11277661 | 3300018052 | Groundwater Sediment | FSPSQNVTVIVTAVAGPPPSWSATASHTQTAKLCDMTNGVITCT |
| Ga0184617_10136064 | 3300018066 | Groundwater Sediment | AAPLQGFTPSQNVTIVAVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0184617_11664222 | 3300018066 | Groundwater Sediment | QGFSPSQNVTVVVVNVAGPPPSWSATATHAQSAKVCDMTNGVITCV |
| Ga0184609_101094571 | 3300018076 | Groundwater Sediment | VIVTAVAGPPPSWSATASHTQTAKLCDMTNGVITCT |
| Ga0066662_100800266 | 3300018468 | Grasslands Soil | PLQGFTPSQNVTIVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA |
| Ga0190274_133078832 | 3300018476 | Soil | IVTALAGPPPSWSATASHTQTAKTCDMTNGVITCT |
| Ga0066669_110204591 | 3300018482 | Grasslands Soil | QGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV |
| Ga0193744_10079894 | 3300019874 | Soil | SQNVTVVITNLAGPPPSWQGTATHSQSAKVCDMTNGVITCV |
| Ga0193722_10190374 | 3300019877 | Soil | PSQNVTVVITNLPGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0193723_10973491 | 3300019879 | Soil | LQGFSPSQNVTVVIVNVAGPPPSWSGTATHSQSAKVCSMTNGVIACV |
| Ga0193707_11120172 | 3300019881 | Soil | NVTVVVVNVAGPPPSWSATATHSQSAKVCSMVNGVITCV |
| Ga0193713_10353732 | 3300019882 | Soil | SLAPLQGFSPSQNVTVVIVNALGPPASWSGTATHSQSAKVCTMVNGVIACV |
| Ga0193725_10027727 | 3300019883 | Soil | VIVNVAGPPPSWSGTATHSQSAKTCTMVNGVIACV |
| Ga0193747_10206251 | 3300019885 | Soil | NVTVVVTNVAGPPPSWSATATHSQSAKVCDMTNGVITCV |
| Ga0193727_10351014 | 3300019886 | Soil | VVNATVGPPPSWDATATHSQSAKVCTMINGVITCV |
| Ga0193721_10482523 | 3300020018 | Soil | IVAVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0193745_10338391 | 3300020059 | Soil | SQNVTVVVTNLPGPPPSWQGTATHSQSAKVCDMTNGVITCV |
| Ga0193724_10069996 | 3300020062 | Soil | LQGFSPSQNVTVVIVNALGPPASWSGTATHSQSAKVCTMTNGVIACV |
| Ga0210378_101009611 | 3300021073 | Groundwater Sediment | NVTVIITAVAGPPPSWSATASHTQTAKVCDMTNGVITCT |
| Ga0210381_100811413 | 3300021078 | Groundwater Sediment | LQGFTPSQNVTIVAVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0193719_100385081 | 3300021344 | Soil | APLQGFSPSQNVTVVVVNVAGPPPSWSATATHSQSAKVCTMINGVITCV |
| Ga0222621_10280401 | 3300021510 | Groundwater Sediment | SQNVTVVVNATVGPPPSWDATATHTQSAKVCTMLNGVITCV |
| Ga0222621_10715641 | 3300021510 | Groundwater Sediment | APLQGFSPSQNVTVVVNATVGPPPSWDATATHTQSAKVCTMINGVITCV |
| Ga0193698_10137263 | 3300021968 | Soil | QNVTVVIVNVAGPPPSWSGTATHSQSAKVCSMTNGVIACV |
| Ga0224452_11143631 | 3300022534 | Groundwater Sediment | VAVNVAGPPPSWSATATHSQSAKVCDMTNGVITCV |
| Ga0222622_100022731 | 3300022756 | Groundwater Sediment | SAAPLQGFSPSQNVTVVVNATVGPPPSWDATATHTQSAKVCTMINGVITCV |
| Ga0222622_104549223 | 3300022756 | Groundwater Sediment | VTVVIVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0247677_10716642 | 3300024245 | Soil | APLQGFTPSQNVTVVVTNLPGPPPSWSGTATHTQSAKVCDMTNGVITCV |
| Ga0207645_106094591 | 3300025907 | Miscanthus Rhizosphere | PLQGFSPSQNVTVVVTNVAGPPPSWNATATHTQSAKTCAMTNGVITCT |
| Ga0207684_100562201 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LQGFSPSQNVTVVVTAVGGPPPSWSATATHTQSAKTCQMVNGVITCA |
| Ga0207707_102967422 | 3300025912 | Corn Rhizosphere | QNVTVTVTAVAGPPPSWDATATHTQSAKTCAMTAGVITCT |
| Ga0207693_114214231 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVVVTNVAGPPPSWSATATHSQSAKVCSMINGVITCV |
| Ga0207662_103469622 | 3300025918 | Switchgrass Rhizosphere | QNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCV |
| Ga0207644_101653391 | 3300025931 | Switchgrass Rhizosphere | VTVTVTAVAGPPPSWDATATHTQSAKTCAMTAGVITCT |
| Ga0207665_100685835 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PSQNVTIVVTAVAGPPPSWSATATHSQSAKTCAMVNGVITCT |
| Ga0207667_107903361 | 3300025949 | Corn Rhizosphere | NVTIVVTGVAGPPPSWSATATHSQSAKTCDMTGGVITCTP |
| Ga0207678_103505062 | 3300026067 | Corn Rhizosphere | GFSPSQNVTVVVTNVAGPPPSWSATATHTQSAKTCAMTNGVITCT |
| Ga0207708_101287061 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKVCDMTNGVITCT |
| Ga0207708_105080473 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT |
| Ga0207698_119558611 | 3300026142 | Corn Rhizosphere | VTVVVTSVAGPPPSWSATATHTQSAKVCDMTNGVITCV |
| Ga0209265_12305982 | 3300026308 | Soil | LQGFTPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCSMVNGVITCV |
| Ga0209153_10159511 | 3300026312 | Soil | QNVTVVVTAVAGPPPSWSATATHTQTAKTCDMTNGVITCT |
| Ga0209686_11051733 | 3300026315 | Soil | QNVTIVVTAVAGPPPSWSATATHSQSAKTCDMTNGVITCT |
| Ga0209472_10343573 | 3300026323 | Soil | APLQGFSPSQNVTVVVTAVAGPPPSWSATATHTQTAKVCDMTNGVITCT |
| Ga0209267_11708031 | 3300026331 | Soil | NVTVVVTAVAGPPPSWSATATHTQSPKTCQMVNGVITCA |
| Ga0209378_12144562 | 3300026528 | Soil | PLQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKVCSMVNGVITCV |
| Ga0209161_104509302 | 3300026548 | Soil | LQGFSPSQNVTVVVTNVAGPPPSWSATATHSQSAKTCDMTNGVITCA |
| Ga0209488_101790701 | 3300027903 | Vadose Zone Soil | PLQGFTPSQNVTIVAVNVAGPPPSWSATATHSQSAKVCDMTNGVITCV |
| Ga0307303_101567972 | 3300028713 | Soil | PSQNVTVVVTAVVGPPPSWSATANHTQSAKVCSMINGVITCV |
| Ga0307307_101517032 | 3300028718 | Soil | VTVVIISIPGPPPSWTGTATHSQSAKTCSMVNGVITCV |
| Ga0307280_100729422 | 3300028768 | Soil | SLVPLQGFSPSQNVTVVIVNALGPPASWSGTATHSQSAKVCTMVNGVIACV |
| Ga0307284_101115643 | 3300028799 | Soil | SQNVTIVAVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0307292_101288732 | 3300028811 | Soil | SAAPLQGFSPSQNVTVVVVNVAGPPPSWSATATHSQSAKVCSMINGVITCV |
| Ga0307296_103832913 | 3300028819 | Soil | KGFTPSQNVTIVAVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0307310_101017071 | 3300028824 | Soil | APLQGFSPSQNVTVVIVNVAGPPPSWSGTATHSQSAKVCSMINGVITCV |
| Ga0307300_100508181 | 3300028880 | Soil | LQGFSPSQNVTVVIVNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| Ga0307308_100085705 | 3300028884 | Soil | PSQNVTVVIVNVAGPPPSWSGTATHSQSAKVCTMVNGVITCV |
| Ga0307308_100851371 | 3300028884 | Soil | SVAPLQGFSPSQNVTVVVVNVAGPPPSWSATATHSQSAKVCDMTNGVITCV |
| Ga0307308_104455061 | 3300028884 | Soil | PSQNVTVVIVNVAGPPPSWSGTATHSQSAKVCSMINGVITCV |
| Ga0310887_111475561 | 3300031547 | Soil | MASPLQGFTPSQNVTVTVNSTAGPPPSWDATATHTQSAKTCAMTAGVITCT |
| Ga0307469_110827111 | 3300031720 | Hardwood Forest Soil | AAAPLQGFSPSQNVTVVVTAVAGPPPSWSATANHTQSAKVCSMINGVITCV |
| Ga0370484_0009107_5_157 | 3300034125 | Untreated Peat Soil | LAPLQGFSPSQNVTVVITNVAGPPPSWSGTATHSQSAKVCDMTNGVITCV |
| ⦗Top⦘ |